DK951042
Clone id TST38A01NGRL0010_F09
Library
Length 476
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_F09. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID
Sequence
GCCCTTACAGCTTTGATGGAAAAGGAAATTACAATCTTGGGCTCAAAGAGCAGGGTGTGT
TCCCAGAAATAAAATTTTTTTAAAAAGACAAACCCAGGGGGATGGACATATCTATTGTTA
CCTCAGCAAGGACAGATAAAGAAGGTCAAAAGTTGTTGACATTGCTAGGAATGCCGTTCC
GTGCAGGTGATGTATCAGCAAAACCTGTTGTGATAAAGAAGAAAGGAAACTTCAATATCA
AGGGTGGAAAGGGCAAAGCTAAGAAGCCAGTCACGAAGAGTAAGAAGAAGAAGTGAGGAA
GGTAAAGGCAAATGCTGGAGACAACCATGTTGGTTGTTGATTTTGGGGGGAGAAGAGATG
GCTATTTTTTTTTTTCCCCCCCCCCCCAANGGGAAANTGAAGTTAAAAAAAAAAGGGGGG
GGGGATGCGGTGACCCGTTCCAATGGTCATTTTGATTCTCTGAGTAAAGGCTATGG
■■Homology search results ■■ -
sp_hit_id O04603
Definition sp|O04603|RK5_ARATH 50S ribosomal protein L5, chloroplastic OS=Arabidopsis thaliana
Align length 62
Score (bit) 88.2
E-value 2.0e-17
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK951042|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_F09, 5'
(476 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O04603|RK5_ARATH 50S ribosomal protein L5, chloroplastic OS=A... 88 2e-17
sp|P24315|RL5_THEAQ 50S ribosomal protein L5 OS=Thermus aquaticu... 86 1e-16
sp|Q7V533|RL5_PROMM 50S ribosomal protein L5 OS=Prochlorococcus ... 84 2e-16
sp|A2CC40|RL5_PROM3 50S ribosomal protein L5 OS=Prochlorococcus ... 84 3e-16
sp|Q1XDI6|RK5_PORYE 50S ribosomal protein L5, chloroplastic OS=P... 84 4e-16
sp|P51302|RK5_PORPU 50S ribosomal protein L5, chloroplastic OS=P... 84 4e-16
sp|P73308|RL5_SYNY3 50S ribosomal protein L5 OS=Synechocystis sp... 83 7e-16
sp|B0C1E5|RL5_ACAM1 50S ribosomal protein L5 OS=Acaryochloris ma... 83 7e-16
sp|Q1IX84|RL5_DEIGD 50S ribosomal protein L5 OS=Deinococcus geot... 82 9e-16
sp|Q7V9X4|RL5_PROMA 50S ribosomal protein L5 OS=Prochlorococcus ... 82 1e-15
sp|Q7NEG4|RL5_GLOVI 50S ribosomal protein L5 OS=Gloeobacter viol... 82 2e-15
sp|P82192|RK5_SPIOL 50S ribosomal protein L5, chloroplastic OS=S... 82 2e-15
sp|Q0ID17|RL5_SYNS3 50S ribosomal protein L5 OS=Synechococcus sp... 81 2e-15
sp|A5GIT3|RL5_SYNPW 50S ribosomal protein L5 OS=Synechococcus sp... 81 2e-15
sp|Q9RXJ0|RL5_DEIRA 50S ribosomal protein L5 OS=Deinococcus radi... 81 2e-15
sp|Q8DMM0|RL5_THEEB 50S ribosomal protein L5 OS=Thermosynechococ... 80 4e-15
sp|A1ALV3|RL5_PELPD 50S ribosomal protein L5 OS=Pelobacter propi... 80 4e-15
sp|P41201|RL5_THETH 50S ribosomal protein L5 OS=Thermus thermoph... 80 5e-15
sp|Q5SHQ0|RL5_THET8 50S ribosomal protein L5 OS=Thermus thermoph... 80 5e-15
sp|Q72I16|RL5_THET2 50S ribosomal protein L5 OS=Thermus thermoph... 80 5e-15
sp|Q7UZV6|RL5_PROMP 50S ribosomal protein L5 OS=Prochlorococcus ... 80 5e-15
sp|O24701|RL5_SYNP6 50S ribosomal protein L5 OS=Synechococcus sp... 80 6e-15
sp|Q31L19|RL5_SYNE7 50S ribosomal protein L5 OS=Synechococcus el... 80 6e-15
sp|Q318J6|RL5_PROM9 50S ribosomal protein L5 OS=Prochlorococcus ... 80 6e-15
sp|A8G749|RL5_PROM2 50S ribosomal protein L5 OS=Prochlorococcus ... 80 6e-15
sp|A3PF35|RL5_PROM0 50S ribosomal protein L5 OS=Prochlorococcus ... 80 6e-15
sp|Q03IG3|RL5_STRTD 50S ribosomal protein L5 OS=Streptococcus th... 79 8e-15
sp|Q5M2C5|RL5_STRT2 50S ribosomal protein L5 OS=Streptococcus th... 79 8e-15
sp|Q5LXS3|RL5_STRT1 50S ribosomal protein L5 OS=Streptococcus th... 79 8e-15
sp|B1X4Z6|RK5_PAUCH 50S ribosomal protein L5, chromatophore OS=P... 79 8e-15

>sp|O04603|RK5_ARATH 50S ribosomal protein L5, chloroplastic
OS=Arabidopsis thaliana GN=RPL5 PE=1 SV=1
Length = 262

Score = 88.2 bits (217), Expect = 2e-17
Identities = 40/62 (64%), Positives = 51/62 (82%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
P SFDG GNY++G+K+QGVFPEI+F K RGMD+ I T+A++D+EGQKLL L+GMPFR
Sbjct: 174 PSSFDGNGNYSIGVKDQGVFPEIRFDAVGKTRGMDVCISTTAKSDQEGQKLLALMGMPFR 233

Query: 183 AG 188
G
Sbjct: 234 EG 235


>sp|P24315|RL5_THEAQ 50S ribosomal protein L5 OS=Thermus aquaticus
GN=rplE PE=3 SV=1
Length = 182

Score = 85.5 bits (210), Expect = 1e-16
Identities = 40/60 (66%), Positives = 49/60 (81%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
P SFDG+GNYNLGLKEQ +FPEI + D PRGMDI++VT+A+TD+E + LL LLG PFR
Sbjct: 122 PNSFDGRGNYNLGLKEQLIFPEITYDMVDVPRGMDIAVVTTAKTDEEAKALLELLGFPFR 181


>sp|Q7V533|RL5_PROMM 50S ribosomal protein L5 OS=Prochlorococcus
marinus (strain MIT 9313) GN=rplE PE=3 SV=1
Length = 179

Score = 84.3 bits (207), Expect = 2e-16
Identities = 41/61 (67%), Positives = 49/61 (80%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
P SFDG+GNY LG++EQ +FPEI F D RGMDI+IVTSARTD+EGQ LL +GMPFR
Sbjct: 118 PKSFDGRGNYTLGVREQLIFPEISFDKIDAIRGMDITIVTSARTDEEGQSLLREMGMPFR 177

Query: 183 A 185
+
Sbjct: 178 S 178


>sp|A2CC40|RL5_PROM3 50S ribosomal protein L5 OS=Prochlorococcus
marinus (strain MIT 9303) GN=rplE PE=3 SV=1
Length = 179

Score = 84.0 bits (206), Expect = 3e-16
Identities = 40/61 (65%), Positives = 49/61 (80%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
P SFDG+GNY LG++EQ +FPE+ F D RGMDI+IVTSARTD+EGQ LL +GMPFR
Sbjct: 118 PKSFDGRGNYTLGVREQLIFPEVSFDKIDAIRGMDITIVTSARTDEEGQSLLREMGMPFR 177

Query: 183 A 185
+
Sbjct: 178 S 178


>sp|Q1XDI6|RK5_PORYE 50S ribosomal protein L5, chloroplastic
OS=Porphyra yezoensis GN=rpl5 PE=3 SV=1
Length = 181

Score = 83.6 bits (205), Expect = 4e-16
Identities = 41/60 (68%), Positives = 49/60 (81%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
P SFDGKGNYNLGL+EQ +FPEI + D+ RG+DISIVT+A+TD+EG LL LGMPFR
Sbjct: 120 PRSFDGKGNYNLGLREQLIFPEIDYDNIDQIRGLDISIVTTAKTDQEGLALLKKLGMPFR 179


>sp|P51302|RK5_PORPU 50S ribosomal protein L5, chloroplastic
OS=Porphyra purpurea GN=rpl5 PE=3 SV=1
Length = 181

Score = 83.6 bits (205), Expect = 4e-16
Identities = 41/60 (68%), Positives = 49/60 (81%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
P SFDGKGNYNLGL+EQ +FPEI + D+ RG+DISIVT+A+TD+EG LL LGMPFR
Sbjct: 120 PKSFDGKGNYNLGLREQLIFPEIDYDNIDQIRGLDISIVTTAKTDQEGLALLKKLGMPFR 179


>sp|P73308|RL5_SYNY3 50S ribosomal protein L5 OS=Synechocystis sp.
(strain PCC 6803) GN=rplE PE=3 SV=2
Length = 180

Score = 82.8 bits (203), Expect = 7e-16
Identities = 38/61 (62%), Positives = 51/61 (83%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
P SFDG+GNY+LG++EQ +FPEI + D+ RGMD+SI+TSA+TD+EG+ LL LGMPFR
Sbjct: 120 PNSFDGRGNYSLGIREQLIFPEIDYDTIDQIRGMDVSIITSAQTDEEGRALLKALGMPFR 179

Query: 183 A 185
+
Sbjct: 180 S 180


>sp|B0C1E5|RL5_ACAM1 50S ribosomal protein L5 OS=Acaryochloris
marina (strain MBIC 11017) GN=rplE PE=3 SV=1
Length = 181

Score = 82.8 bits (203), Expect = 7e-16
Identities = 38/60 (63%), Positives = 50/60 (83%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
P SFDG+GNY LGL+EQ +FPE+ + D+ RGMDISI+T+A+TD+EG+ LL +LGMPFR
Sbjct: 120 PKSFDGRGNYTLGLREQLIFPEVDYDSIDQIRGMDISIITTAKTDEEGRALLKVLGMPFR 179


>sp|Q1IX84|RL5_DEIGD 50S ribosomal protein L5 OS=Deinococcus
geothermalis (strain DSM 11300) GN=rplE PE=3 SV=1
Length = 179

Score = 82.4 bits (202), Expect = 9e-16
Identities = 38/60 (63%), Positives = 49/60 (81%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
P SFDG+GNYNLG+KEQ +FPEI + DK RGMDI+IVT+A+TD+E + LL +G+PFR
Sbjct: 119 PNSFDGRGNYNLGIKEQLIFPEITYDMVDKVRGMDITIVTTAKTDEEARALLQAMGLPFR 178


>sp|Q7V9X4|RL5_PROMA 50S ribosomal protein L5 OS=Prochlorococcus
marinus GN=rplE PE=3 SV=1
Length = 179

Score = 82.0 bits (201), Expect = 1e-15
Identities = 40/61 (65%), Positives = 49/61 (80%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
P SFDG+GN+ LG+KEQ +FPEI F D RGMDI+IVTSARTD+EG+ LL +GMPFR
Sbjct: 118 PKSFDGRGNFTLGVKEQLIFPEISFDKIDAIRGMDITIVTSARTDEEGRALLKEMGMPFR 177

Query: 183 A 185
+
Sbjct: 178 S 178


tr_hit_id A9TXG3
Definition tr|A9TXG3|A9TXG3_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 60
Score (bit) 89.0
E-value 1.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK951042|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_F09, 5'
(476 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TXG3|A9TXG3_PHYPA Predicted protein OS=Physcomitrella paten... 89 1e-16
tr|Q14K87|Q14K87_PLAAC Plastid ribosomal protein PRPL5 (Fragment... 87 3e-16
tr|B5TV71|B5TV71_CAMSI 50S ribosomal protein L5 OS=Camellia sine... 87 3e-16
tr|A9RPS4|A9RPS4_PHYPA Predicted protein OS=Physcomitrella paten... 87 4e-16
tr|A7PZN4|A7PZN4_VITVI Chromosome chr15 scaffold_40, whole genom... 87 4e-16
tr|B7A567|B7A567_THEAQ Ribosomal protein L5 OS=Thermus aquaticus... 86 9e-16
tr|B5YDV5|B5YDV5_DICT6 50S ribosomal protein L5 OS=Dictyoglomus ... 84 3e-15
tr|B8E1E5|B8E1E5_9BACT Ribosomal protein L5 OS=Dictyoglomus turg... 84 3e-15
tr|B0TC68|B0TC68_HELMI 50S ribosomal protein L5 OS=Heliobacteriu... 83 6e-15
tr|Q110B9|Q110B9_TRIEI 50S ribosomal protein L5 OS=Trichodesmium... 82 1e-14
tr|A5D5G7|A5D5G7_PELTS 50S ribosomal protein L5 OS=Pelotomaculum... 82 1e-14
tr|B8HMR6|B8HMR6_9CHRO Ribosomal protein L5 OS=Cyanothece sp. PC... 82 1e-14
tr|B1XJS7|B1XJS7_SYNP2 50S ribosomal protein L5 OS=Synechococcus... 82 2e-14
tr|A9BCN5|A9BCN5_PROM4 50S ribosomal protein L5 OS=Prochlorococc... 82 2e-14
tr|B8FES3|B8FES3_9DELT Ribosomal protein L5 OS=Desulfatibacillum... 81 2e-14
tr|A4CSM7|A4CSM7_SYNPV 50S ribosomal protein L5 OS=Synechococcus... 81 2e-14
tr|A3Z8W0|A3Z8W0_9SYNE 50S ribosomal protein L5 OS=Synechococcus... 81 2e-14
tr|B6U8G6|B6U8G6_MAIZE 50S ribosomal protein L5 OS=Zea mays PE=2... 81 2e-14
tr|B6SUE4|B6SUE4_MAIZE 50S ribosomal protein L5 OS=Zea mays PE=2... 81 2e-14
tr|B6SST7|B6SST7_MAIZE 50S ribosomal protein L5 OS=Zea mays PE=2... 81 2e-14
tr|A9PJP8|A9PJP8_POPJC Putative uncharacterized protein OS=Popul... 81 3e-14
tr|B7KHZ9|B7KHZ9_9CHRO Ribosomal protein L5 OS=Cyanothece sp. PC... 80 4e-14
tr|B5IPR5|B5IPR5_9CHRO 50S ribosomal protein L5 OS=Cyanobium sp.... 80 4e-14
tr|B4B3N6|B4B3N6_9CHRO Ribosomal protein L5 OS=Cyanothece sp. PC... 80 4e-14
tr|B1SWD9|B1SWD9_9BACI Ribosomal protein L5 OS=Geobacillus sp. W... 80 4e-14
tr|B1CA27|B1CA27_9FIRM 50S ribosomal protein L5 OS=Anaerofustis ... 80 4e-14
tr|A9PED8|A9PED8_POPTR Putative uncharacterized protein OS=Popul... 80 4e-14
tr|B7GJ79|B7GJ79_9BACI Ribosomal protein L5 OS=Anoxybacillus fla... 80 5e-14
tr|B5W6R9|B5W6R9_SPIMA Ribosomal protein L5 OS=Arthrospira maxim... 80 5e-14
tr|B2ITP3|B2ITP3_NOSP7 Ribosomal protein L5 OS=Nostoc punctiform... 80 7e-14

>tr|A9TXG3|A9TXG3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_152246 PE=3 SV=1
Length = 269

Score = 89.0 bits (219), Expect = 1e-16
Identities = 43/60 (71%), Positives = 49/60 (81%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
PYSFDG+GNY LGL+E VFPEIKF DK RG+DI IVTSA+ D EG KLL+LLGMPF+
Sbjct: 185 PYSFDGRGNYTLGLQEISVFPEIKFENIDKVRGLDICIVTSAKNDAEGHKLLSLLGMPFK 244


>tr|Q14K87|Q14K87_PLAAC Plastid ribosomal protein PRPL5 (Fragment)
OS=Platanus acerifolia GN=prpl5 PE=2 SV=1
Length = 182

Score = 87.4 bits (215), Expect = 3e-16
Identities = 39/62 (62%), Positives = 50/62 (80%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
P SFDG GNY++G++EQ VFPEI++ KPRGMD+ I T+A+TDKE QKLL+L+GMP R
Sbjct: 97 PNSFDGHGNYSIGIREQSVFPEIRYDALGKPRGMDVCITTTAKTDKEAQKLLSLMGMPLR 156

Query: 183 AG 188
G
Sbjct: 157 EG 158


>tr|B5TV71|B5TV71_CAMSI 50S ribosomal protein L5 OS=Camellia
sinensis PE=2 SV=1
Length = 221

Score = 87.4 bits (215), Expect = 3e-16
Identities = 39/60 (65%), Positives = 49/60 (81%)
Frame = +3

Query: 9 SFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFRAG 188
SFDG GN+++G KEQGVFPEI++ KPRGMD+ I T+A+TDKEG +LL L+GMPFR G
Sbjct: 135 SFDGHGNFSIGFKEQGVFPEIRYDALGKPRGMDVCITTTAKTDKEGYRLLALMGMPFREG 194


>tr|A9RPS4|A9RPS4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_117652 PE=3 SV=1
Length = 235

Score = 87.0 bits (214), Expect = 4e-16
Identities = 41/60 (68%), Positives = 48/60 (80%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
PYSFDGKGNY LGL E VFPEIKF DK RG+D+ IVT+A+ D EG KLL+L+GMPF+
Sbjct: 151 PYSFDGKGNYTLGLPEISVFPEIKFENIDKVRGLDVCIVTTAKNDAEGHKLLSLMGMPFK 210


>tr|A7PZN4|A7PZN4_VITVI Chromosome chr15 scaffold_40, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00026943001
PE=3 SV=1
Length = 265

Score = 87.0 bits (214), Expect = 4e-16
Identities = 39/62 (62%), Positives = 50/62 (80%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
P SFDG GNY++G+K+Q VFPEI+F + RGMD+ I T+A+TDKEGQ+LL L+GMPFR
Sbjct: 177 PNSFDGHGNYSIGMKDQSVFPEIRFDILGRARGMDVCITTTAKTDKEGQQLLALMGMPFR 236

Query: 183 AG 188
G
Sbjct: 237 EG 238


>tr|B7A567|B7A567_THEAQ Ribosomal protein L5 OS=Thermus aquaticus
Y51MC23 GN=TaqDRAFT_4974 PE=4 SV=1
Length = 182

Score = 85.9 bits (211), Expect = 9e-16
Identities = 40/60 (66%), Positives = 49/60 (81%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
P SFDG+GNYNLGLKEQ +FPEI + D PRGMDI++VT+A+TD+E + LL LLG PFR
Sbjct: 122 PNSFDGRGNYNLGLKEQLIFPEITYDMVDAPRGMDIAVVTTAKTDEEAKALLELLGFPFR 181


>tr|B5YDV5|B5YDV5_DICT6 50S ribosomal protein L5 OS=Dictyoglomus
thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
GN=DICTH_0849 PE=4 SV=1
Length = 179

Score = 84.3 bits (207), Expect = 3e-15
Identities = 40/60 (66%), Positives = 52/60 (86%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
P SFDG+GNY+LGLKEQ VFPEI++ D+ RGMDI+IVT+A+TD+E ++LL LLGMPF+
Sbjct: 119 PNSFDGRGNYSLGLKEQLVFPEIEYDKIDRIRGMDITIVTTAKTDEEAKELLALLGMPFK 178


>tr|B8E1E5|B8E1E5_9BACT Ribosomal protein L5 OS=Dictyoglomus
turgidum DSM 6724 GN=Dtur_0993 PE=4 SV=1
Length = 179

Score = 84.3 bits (207), Expect = 3e-15
Identities = 40/60 (66%), Positives = 52/60 (86%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
P SFDG+GNY+LGLKEQ VFPEI++ D+ RGMDI+IVT+A+TD+E ++LL LLGMPF+
Sbjct: 119 PNSFDGRGNYSLGLKEQLVFPEIEYDKIDRIRGMDITIVTTAKTDEEAKELLALLGMPFK 178


>tr|B0TC68|B0TC68_HELMI 50S ribosomal protein L5 OS=Heliobacterium
modesticaldum (strain ATCC 51547 / Ice1) GN=rplE PE=3
SV=1
Length = 180

Score = 83.2 bits (204), Expect = 6e-15
Identities = 38/61 (62%), Positives = 51/61 (83%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
P SFDG+GNY LGLKEQ +FPEI++ D+ RGMD++ VT+A+TD+E ++LL L+GMPFR
Sbjct: 119 PKSFDGRGNYTLGLKEQLIFPEIEYDKIDRLRGMDVTFVTTAKTDEEARELLRLIGMPFR 178

Query: 183 A 185
A
Sbjct: 179 A 179


>tr|Q110B9|Q110B9_TRIEI 50S ribosomal protein L5 OS=Trichodesmium
erythraeum (strain IMS101) GN=Tery_3000 PE=3 SV=1
Length = 181

Score = 82.4 bits (202), Expect = 1e-14
Identities = 38/61 (62%), Positives = 52/61 (85%)
Frame = +3

Query: 3 PYSFDGKGNYNLGLKEQGVFPEIKFF*KDKPRGMDISIVTSARTDKEGQKLLTLLGMPFR 182
P SFDG+GNY+LG+KEQ +FPEI++ D+ RGMDISI+T+A+TD+EG+ LL +GMPFR
Sbjct: 120 PKSFDGRGNYSLGVKEQLIFPEIEYDKIDQIRGMDISIITTAKTDEEGRALLKEMGMPFR 179

Query: 183 A 185
+
Sbjct: 180 S 180