DK951097
Clone id TST38A01NGRL0010_H18
Library
Length 634
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_H18. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID
Sequence
ATCGGGACTTGGAAGCTAGCTCGAAGGAGATTGATGCTGCGAATGCGCAGATAAGCACGT
TGTTTGAGGAGCTGAAGGTTACAAAGGAAAGCAATGAACAACTAGAAAAGAAGATTTTAG
ATGCTCAGAAGGAAGCAGGGTCTATTGTGAACTCTCTAAAGGAAGCTTTAAAGCACGAGC
AGTCAGTCTCCAGTAATTTGAGAAAAGAGCTGGAAAAGGTTACAAGTGACTTAGAGCTGT
CAAAGAAAGAAGCTAGTTTATTGAATGAGCAATCAAAAGATCTTGAGGCTTCCCTTGAGC
AGTTAAAGAAAGAGCTTGCTAAGTCTGAGAATTCGGCAAGAGCTATGGAAACAGCTCTGG
AAGAGGAAAGGGAAGTGTCAGCATCAAACAAGAAGCAGTTGGAGGCTTCACGCAAATCCA
TTGCTGAAGCAAAAGACAATATTAAGCTTTTGCGACAAGATGTTGAAAAAGCGAAGTTAG
AGTCTGAGAAACTTATCAAGGAAGTGAAGGACCTTGAGAGGAAGCTTGGAGTTGCAAATA
GCAAAGCTGCTGAACTTGAAGCGGAAAAGTCTTCTCTTAGCATGTCACTTCTTGAAGAGA
GAGAGGTTTCAGAAAAACTGAAGGGTAAGGTAAA
■■Homology search results ■■ -
sp_hit_id P30141
Definition sp|P30141|MRP4_STRPY Fibrinogen- and Ig-binding protein OS=Streptococcus pyogenes
Align length 177
Score (bit) 65.1
E-value 3.0e-10
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK951097|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_H18, 5'
(634 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P30141|MRP4_STRPY Fibrinogen- and Ig-binding protein OS=Strep... 65 3e-10
sp|Q9LW85|MFP1_ARATH MAR-binding filament-like protein 1 OS=Arab... 65 4e-10
sp|P22312|PU92_SCICO Puff II/9-2 protein OS=Sciara coprophila GN... 64 6e-10
sp|P35748|MYH11_RABIT Myosin-11 OS=Oryctolagus cuniculus GN=MYH1... 63 1e-09
sp|P10587|MYH11_CHICK Myosin-11 OS=Gallus gallus GN=MYH11 PE=1 SV=4 62 2e-09
sp|Q9Z221|PMFBP_RAT Polyamine-modulated factor 1-binding protein... 61 4e-09
sp|P58301|RAD50_PYRFU DNA double-strand break repair rad50 ATPas... 61 5e-09
sp|P39922|MYS3_HYDAT Myosin heavy chain, clone 203 (Fragment) OS... 60 7e-09
sp|Q8C9S4|CJ118_MOUSE Uncharacterized protein C10orf118 homolog ... 60 7e-09
sp|Q9NQX4|MYO5C_HUMAN Myosin-Vc OS=Homo sapiens GN=MYO5C PE=1 SV=1 60 9e-09
sp|O08638|MYH11_MOUSE Myosin-11 OS=Mus musculus GN=Myh11 PE=1 SV=1 60 9e-09
sp|P12882|MYH1_HUMAN Myosin-1 OS=Homo sapiens GN=MYH1 PE=1 SV=2 60 1e-08
sp|P35749|MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 60 1e-08
sp|Q9M7J4|MFP1_TOBAC MAR-binding filament-like protein 1-1 OS=Ni... 60 1e-08
sp|Q076A6|MYH1_CANFA Myosin-1 OS=Canis familiaris GN=MYH1 PE=3 SV=2 59 2e-08
sp|P12379|M24_STRPY M protein, serotype 24 OS=Streptococcus pyog... 59 2e-08
sp|Q5SX40|MYH1_MOUSE Myosin-1 OS=Mus musculus GN=Myh1 PE=1 SV=1 59 3e-08
sp|P93203|MFP1_SOLLC MAR-binding filament-like protein 1 OS=Sola... 59 3e-08
sp|Q9WVQ0|PMFBP_MOUSE Polyamine-modulated factor 1-binding prote... 58 4e-08
sp|P05661|MYSA_DROME Myosin heavy chain, muscle OS=Drosophila me... 58 4e-08
sp|Q28641|MYH4_RABIT Myosin-4 OS=Oryctolagus cuniculus GN=MYH4 P... 58 4e-08
sp|Q1HPU0|TPM1_BOMMO Tropomyosin-1 OS=Bombyx mori PE=1 SV=1 58 5e-08
sp|Q258K2|MYH9_CANFA Myosin-9 OS=Canis familiaris GN=MYH9 PE=2 SV=1 58 5e-08
sp|Q5SNZ0|GRDN_MOUSE Girdin OS=Mus musculus GN=Ccdc88a PE=1 SV=2 58 5e-08
sp|Q9P2M7|CING_HUMAN Cingulin OS=Homo sapiens GN=CGN PE=1 SV=2 58 5e-08
sp|O96133|YB145_PLAF7 Uncharacterized protein PFB0145c OS=Plasmo... 57 6e-08
sp|P29616|MYSC_CHICK Myosin heavy chain, cardiac muscle isoform ... 57 6e-08
sp|Q5SX39|MYH4_MOUSE Myosin-4 OS=Mus musculus GN=Myh4 PE=2 SV=1 57 6e-08
sp|Q9TV61|MYH1_PIG Myosin-1 OS=Sus scrofa GN=MYH1 PE=2 SV=1 57 6e-08
sp|Q8MJV0|MYH1_HORSE Myosin-1 OS=Equus caballus GN=MYH1 PE=2 SV=1 57 6e-08

>sp|P30141|MRP4_STRPY Fibrinogen- and Ig-binding protein
OS=Streptococcus pyogenes GN=mrp4 PE=4 SV=1
Length = 388

Score = 65.1 bits (157), Expect = 3e-10
Identities = 46/177 (25%), Positives = 87/177 (49%), Gaps = 4/177 (2%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQ 182
R++ A +E+ AA +Q+ E++ K+ + ++I Q EA ++ N L A
Sbjct: 145 REIAAKQQELAAAKSQLEAKNAEIEALKQQDASKTEEIAKLQSEAATLENLLGSA----- 199

Query: 183 SVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALE 362
++EL ++ + L+ + E + L Q LE L K+EL + A E
Sbjct: 200 ------KRELTELQAKLDTATAEKAKLESQVTTLENLLGSAKRELTDLQAKLDAANAEKE 253

Query: 363 EEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEK----AKLESEKLIKEVKDLER 521
+ + +A+ +KQLEA++K +A+ + + Q+ EK AK E+L K+ ++L +
Sbjct: 254 KLQSQAATLEKQLEATKKELADLQAKLAATNQEKEKLEAEAKALKEQLAKQAEELAK 310



Score = 40.0 bits (92), Expect = 0.010
Identities = 44/175 (25%), Positives = 76/175 (43%), Gaps = 3/175 (1%)
Frame = +3

Query: 15 ASSKEIDAANAQISTLFEELKVTKESNEQLE-KKILDAQ-KEAGSIVNSLKEALKHEQSV 188
A++ ++ A + + L KE+N+ E +K L+ Q ++ G +N + + + +
Sbjct: 34 ANTTDVKAESRRYQAPPRVLLQGKEANKVFEERKALEKQARDLGDTINHMSQTISEQSRK 93

Query: 189 SSNLRKELE-KVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEE 365
+ L+ E E K LE + N+Q DL QLK+ + + + +
Sbjct: 94 IAALKSEAELKNQQALEALNNK----NKQISDLTNENAQLKEAIEGYVQTIQNASREIAA 149

Query: 366 EREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERKLG 530
+++ A+ K QLEA I K +QD K + E KL E LE LG
Sbjct: 150 KQQELAAAKSQLEAKNAEIEALK------QQDASKTE-EIAKLQSEAATLENLLG 197


>sp|Q9LW85|MFP1_ARATH MAR-binding filament-like protein 1
OS=Arabidopsis thaliana GN=MFP1 PE=2 SV=2
Length = 726

Score = 64.7 bits (156), Expect = 4e-10
Identities = 59/178 (33%), Positives = 87/178 (48%), Gaps = 11/178 (6%)
Frame = +3

Query: 30 IDAANAQISTLFEELKVT----KESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSN 197
+D + A S L EL + KE+ E+ E+ LDA+K+ I S L E+ +
Sbjct: 464 LDESRALCSKLESELAIVHEEWKEAKERYERN-LDAEKQKNEISAS---ELALEKDLRRR 519

Query: 198 LRKELEKVTSDL-ELSKKEASL---LNEQSKDLEAS---LEQLKKELAKSENSARAMETA 356
++ ELE VT +L E S K SL L E K +E S LE+ KK + + ME
Sbjct: 520 VKDELEGVTHELKESSVKNQSLQKELVEIYKKVETSNKELEEEKKTVLSLNKEVKGMEKQ 579

Query: 357 LEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERKLG 530
+ ERE S + LE + KS+ E N +L +++EK + L E + L+R LG
Sbjct: 580 ILMEREARKSLETDLEEAVKSLDEMNKNTSILSRELEKVNTHASNLEDEKEVLQRSLG 637



Score = 57.4 bits (137), Expect = 6e-08
Identities = 43/168 (25%), Positives = 84/168 (50%), Gaps = 7/168 (4%)
Frame = +3

Query: 48 QISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNLRKELEKVTS 227
++ + ELK + N+ L+K++++ K+ V + + L+ E+ +L KE++ +
Sbjct: 523 ELEGVTHELKESSVKNQSLQKELVEIYKK----VETSNKELEEEKKTVLSLNKEVKGM-- 576

Query: 228 DLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSASNKKQLEA 407
+K+ + E K LE LE+ K L + + + LE+ +++ + + E
Sbjct: 577 -----EKQILMEREARKSLETDLEEAVKSLDEMNKNTSILSRELEKVNTHASNLEDEKEV 631

Query: 408 SRKSIAEAKDNIKLLRQDVEKAKL-------ESEKLIKEVKDLERKLG 530
++S+ EAK+ K +++VE A + E E L K+VK LE LG
Sbjct: 632 LQRSLGEAKNASKEAKENVEDAHILVMSLGKEREVLEKKVKKLEEDLG 679



Score = 47.4 bits (111), Expect = 6e-05
Identities = 41/189 (21%), Positives = 85/189 (44%), Gaps = 15/189 (7%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQS 185
+L++ + I+ N +I+TL E + + + + K + + + + E + ++
Sbjct: 333 ELDSKNSAIEELNTRITTLVAEKESYIQKLDSISKDYSALKLTSETQAAADAELISRKEQ 392

Query: 186 VSSNLRKELEKVTSDLELSKKEASLLNEQSKD--------------LEASLEQLKKELAK 323
L + L++ D+ SK + + L E+ +D L LE KK L
Sbjct: 393 EIQQLNENLDRALDDVNKSKDKVADLTEKYEDSKRMLDIELTTVKNLRHELEGTKKTLQA 452

Query: 324 SENSARAMETALEEEREVSASNKKQLEASRKSIAEAKDNI-KLLRQDVEKAKLESEKLIK 500
S + +ET L+E R + + + +L + EAK+ + L + +K ++ + +L
Sbjct: 453 SRDRVSDLETMLDESRALCSKLESELAIVHEEWKEAKERYERNLDAEKQKNEISASELAL 512

Query: 501 EVKDLERKL 527
E KDL R++
Sbjct: 513 E-KDLRRRV 520



Score = 34.3 bits (77), Expect = 0.55
Identities = 26/102 (25%), Positives = 49/102 (48%), Gaps = 11/102 (10%)
Frame = +3

Query: 255 SLLNEQSKDLEASLEQLKKELAKSENSA----RAMETALEEEREVSASNKKQLEASRKS- 419
+L + +K E ++E LK +L E + + E L+ E+E KK++E +++
Sbjct: 145 ALARQDTKAAEETIESLKNQLKDRERALVLKEKDFEAKLQHEQE---ERKKEVEKAKEEQ 201

Query: 420 ------IAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERKL 527
+ AKD + L +++ K EKL +++ LE L
Sbjct: 202 LSLINQLNSAKDLVTELGRELSSEKKLCEKLKDQIESLENSL 243


>sp|P22312|PU92_SCICO Puff II/9-2 protein OS=Sciara coprophila
GN=II/9-2 PE=2 SV=1
Length = 286

Score = 63.9 bits (154), Expect = 6e-10
Identities = 44/164 (26%), Positives = 82/164 (50%)
Frame = +3

Query: 24 KEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNLR 203
KE D A+ L E LK KE+ ++ EK + + QK +LKE ++ + + +
Sbjct: 73 KENDGLRAENCQLSEALKREKEARQKAEKALKECQKNT----ENLKETIEQLKKELAEAQ 128

Query: 204 KELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSA 383
K LEK +L KKE + L + ++L ++ QL+++L + R ++ L+E ++
Sbjct: 129 KALEKCKKELADCKKENAKLLNKIEELNCTITQLQEKLERCRGRERDLQCQLDECKKKLN 188

Query: 384 SNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDL 515
+L A RK E + I+ L ++EK + ++ K++ L
Sbjct: 189 ICNNELIACRKQQEELRCKIERLNTEIEKLRKQNAACEKDLNTL 232



Score = 41.6 bits (96), Expect = 0.003
Identities = 37/159 (23%), Positives = 74/159 (46%), Gaps = 1/159 (0%)
Frame = +3

Query: 60 LFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQ-SVSSNLRKELEKVTSDLE 236
L + L + + N+ LEK I+D K+ +I+ + L+ E +S L++E E
Sbjct: 43 LIDRLVLCNQRNDNLEK-IIDGLKKENNILRKENDGLRAENCQLSEALKREKEA------ 95

Query: 237 LSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSASNKKQLEASRK 416
K E +L K+ + + E LK+ + + + + ALE+ ++ A KK+
Sbjct: 96 RQKAEKAL-----KECQKNTENLKETIEQLKKELAEAQKALEKCKKELADCKKENAKLLN 150

Query: 417 SIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERKLGV 533
I E I L++ +E+ + L ++ + ++KL +
Sbjct: 151 KIEELNCTITQLQEKLERCRGRERDLQCQLDECKKKLNI 189


>sp|P35748|MYH11_RABIT Myosin-11 OS=Oryctolagus cuniculus GN=MYH11
PE=2 SV=2
Length = 1972

Score = 63.2 bits (152), Expect = 1e-09
Identities = 56/181 (30%), Positives = 89/181 (49%), Gaps = 18/181 (9%)
Frame = +3

Query: 39 ANAQISTLFEELKVTKESNEQL--EKKILDAQ---------KEAGSIVNSLKEALKHEQS 185
A A+I L +++ V + N +L E+K+L+ + +E N K KHE
Sbjct: 976 AEAKIKKLEDDILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESM 1035

Query: 186 VSS---NLRKELEKVTSDLELSKK----EASLLNEQSKDLEASLEQLKKELAKSENSARA 344
+S L+KE EK +LE K+ EAS L+EQ DL+A + +LK +LAK E +A
Sbjct: 1036 ISELEVRLKKE-EKSRQELEKLKRKMDGEASDLHEQIADLQAQIAELKMQLAKKEEELQA 1094

Query: 345 METALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERK 524
LE+E Q + K I E + +I L++D++ + K K+ +DL +
Sbjct: 1095 ALARLEDE-------TSQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEE 1147

Query: 525 L 527
L
Sbjct: 1148 L 1148



Score = 53.1 bits (126), Expect = 1e-06
Identities = 47/197 (23%), Positives = 92/197 (46%), Gaps = 29/197 (14%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVTKE-----------SNEQLEKKILDAQKEAGSIV 149
RDL+A ++ + Q+ E + E + ++LE + D + +A S +
Sbjct: 1578 RDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRALAAAAKKKLEGDLKDLELQADSAI 1637

Query: 150 NSLKEALKHEQSVSSNLRKELEKVTSDLELSKKE----ASLLNEQSKDLEASLEQLKKEL 317
+EA+K + + + K+ ++ D S+ E A +++K LEA L QL+++L
Sbjct: 1638 KGREEAIKQLLKLQAQM-KDFQRELEDARASRDEIFATAKENEKKAKSLEADLMQLQEDL 1696

Query: 318 AKSENSARAMETALEEEREVSASN----------KKQLEAS----RKSIAEAKDNIKLLR 455
A +E + + + EE E AS+ K++LEA + + E + N++ +
Sbjct: 1697 AAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQGNMEAMS 1756

Query: 456 QDVEKAKLESEKLIKEV 506
V KA ++E+L E+
Sbjct: 1757 DRVRKATQQAEQLSNEL 1773



Score = 50.4 bits (119), Expect = 7e-06
Identities = 46/191 (24%), Positives = 97/191 (50%), Gaps = 19/191 (9%)
Frame = +3

Query: 12 EASSKEIDAANAQISTLFEELKVTKESNEQLEKKI-------LDAQKEAGSIVNSLKEAL 170
EA ++E + ++ EE KE E+ K + + ++ + G V+ L+++
Sbjct: 1475 EAEAREKETKALSLARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSK 1534

Query: 171 KHEQSVSSNLRKELEKVTSDLELSKKEASL---LNEQS------KDLEASLEQLKKELAK 323
+ ++ ++ +LE++ +L+ ++ +A L +N Q+ +DL+A EQ +++ +
Sbjct: 1535 RALETQMEEMKTQLEELEDELQATE-DAKLRLEVNMQALKVQFERDLQARDEQNEEKRRQ 1593

Query: 324 SENSARAMETALEEERE---VSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKL 494
+ ET LE+ER+ ++A+ KK+LE K + D+ R++ K L KL
Sbjct: 1594 LQRQLHEYETELEDERKQRALAAAAKKKLEGDLKDLELQADSAIKGREEAIKQLL---KL 1650

Query: 495 IKEVKDLERKL 527
++KD +R+L
Sbjct: 1651 QAQMKDFQREL 1661



Score = 48.5 bits (114), Expect = 3e-05
Identities = 47/182 (25%), Positives = 89/182 (48%), Gaps = 12/182 (6%)
Frame = +3

Query: 18 SSKEIDAANAQISTLFEELKVTKESNEQ--LEKKILDAQKEAGSIV--NSLKEALKHEQS 185
+ K+ + A + L E+L + + +Q LEK+ L A++ A S+ N+L++ + ++
Sbjct: 1678 NEKKAKSLEADLMQLQEDLAAAERARKQADLEKEEL-AEELASSLSGRNALQDEKRRLEA 1736

Query: 186 VSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETA--- 356
+ L +ELE+ ++E +Q+ EQL ELA ++A+ E+A
Sbjct: 1737 RIAQLEEELEEEQGNMEAMSDRVRKATQQA-------EQLSNELATERSTAQKNESARQQ 1789

Query: 357 LEEEREVSASNKKQLEASRKS-----IAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLER 521
LE + + S +++E + KS IA + I L + VE+ E + K +K ++
Sbjct: 1790 LERQNKELKSKLQEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAAAKALKQRDK 1849

Query: 522 KL 527
KL
Sbjct: 1850 KL 1851



Score = 48.1 bits (113), Expect = 4e-05
Identities = 42/182 (23%), Positives = 87/182 (47%), Gaps = 8/182 (4%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFEEL---KVTKESNEQLEKKILDAQKEAGSIVNSLKEALKH 176
++EA S + A Q L EL + T + NE +++ KE S + ++ A+K
Sbjct: 1751 NMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELKSKLQEMEGAVKS 1810

Query: 177 E-QSVSSNLRKELEKVTSDLELSKKE----ASLLNEQSKDLEASLEQLKKELAKSENSAR 341
+ +S + L ++ ++ +E +E A L ++ K L+ L Q++ E +E
Sbjct: 1811 KFKSTIAALEAKIAQLEEQVEQEAREKQAAAKALKQRDKKLKEMLLQVEDERKMAEQYKE 1870

Query: 342 AMETALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLER 521
E + +++ K+QLE + + N + L++++++A +E + +EV L+
Sbjct: 1871 QAEKGNAKVKQL----KRQLEEAEEESQRINANRRKLQRELDEATESNEAMGREVNALKS 1926

Query: 522 KL 527
KL
Sbjct: 1927 KL 1928



Score = 45.1 bits (105), Expect = 3e-04
Identities = 42/174 (24%), Positives = 79/174 (45%), Gaps = 3/174 (1%)
Frame = +3

Query: 12 EASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIV---NSLKEALKHEQ 182
EA K I A ++++L +L+ T+E ++ ++ L+ + + NSL+E L E
Sbjct: 1298 EAEGKAIKLAK-EVASLGSQLQDTQELLQEETRQKLNVSTKLRQLEDERNSLQEQLDEEM 1356

Query: 183 SVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALE 362
NL + + + L SKK+ L + + +E SLE+ KK K S
Sbjct: 1357 EAKQNLERHISTLNIQLSDSKKK---LQDFASTVE-SLEEGKKRFQKEIESLTQQYEEKA 1412

Query: 363 EEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERK 524
+ K +L+ + DN + L ++EK + + ++L+ E K++ K
Sbjct: 1413 AAYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQKKFDQLLAEEKNISSK 1466



Score = 42.7 bits (99), Expect = 0.002
Identities = 38/175 (21%), Positives = 78/175 (44%), Gaps = 2/175 (1%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVT-KESNEQLEKKILDAQKEAGSIVNSLKEALKHE 179
R ++ + ++ A + ELK+ + E+L+ + + E N+LK+ + E
Sbjct: 1058 RKMDGEASDLHEQIADLQAQIAELKMQLAKKEEELQAALARLEDETSQKNNALKKIRELE 1117

Query: 180 QSVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKS-ENSARAMETA 356
+S + DL+ + + +Q +DL LE LK EL + + +A E
Sbjct: 1118 GHISD--------LQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDTTATQQELR 1169

Query: 357 LEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLER 521
+ E+EV+ K E +R A+ ++ + Q VE+ + E+ + +L++
Sbjct: 1170 AKREQEVTVLKKALDEETRSHEAQVQEMRQKHTQVVEELTEQLEQFKRAKANLDK 1224



Score = 42.0 bits (97), Expect = 0.003
Identities = 37/175 (21%), Positives = 84/175 (48%), Gaps = 1/175 (0%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQS 185
+LE K+ D A+ + + + ++ E + + + +A S+ +L+EAL+
Sbjct: 1445 NLEKKQKKFDQLLAEEKNISSKYA---DERDRAEAEAREKETKALSLARALEEALE---- 1497

Query: 186 VSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEE 365
++ELE+ +L + +DL +S + + K + + E S RA+ET +EE
Sbjct: 1498 ----AKEELERTNK----------MLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEE 1543

Query: 366 EREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEK-AKLESEKLIKEVKDLERKL 527
+ + +L+A+ + + N++ L+ E+ + E+ ++ + L+R+L
Sbjct: 1544 MKTQLEELEDELQATEDAKLRLEVNMQALKVQFERDLQARDEQNEEKRRQLQRQL 1598


>sp|P10587|MYH11_CHICK Myosin-11 OS=Gallus gallus GN=MYH11 PE=1 SV=4
Length = 1979

Score = 62.4 bits (150), Expect = 2e-09
Identities = 52/183 (28%), Positives = 88/183 (48%), Gaps = 20/183 (10%)
Frame = +3

Query: 39 ANAQISTLFEELKVTKESNEQL--EKKILDAQ---------KEAGSIVNSLKEALKHEQS 185
A+ +I + +++ + ++ N +L E+K+L+ + +E N K KHE
Sbjct: 982 ADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNLTKLKNKHESM 1041

Query: 186 VSS---------NLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSA 338
+S R+ELEK+ LE E+S L+EQ +L+A + +LK +LAK E
Sbjct: 1042 ISELEVRLKKEEKSRQELEKIKRKLE---GESSDLHEQIAELQAQIAELKAQLAKKEEEL 1098

Query: 339 RAMETALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLE 518
+A LE+E Q + K I E + +I L++D+E K K K+ +DL
Sbjct: 1099 QAALARLEDE-------TSQKNNALKKIRELESHISDLQEDLESEKAARNKAEKQKRDLS 1151

Query: 519 RKL 527
+L
Sbjct: 1152 EEL 1154



Score = 53.5 bits (127), Expect = 9e-07
Identities = 41/154 (26%), Positives = 82/154 (53%)
Frame = +3

Query: 48 QISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNLRKELEKVTS 227
+I +L ++ + S ++LEK Q+E +V L +++ + SNL K+ +K
Sbjct: 1406 EIESLTQQFEEKAASYDKLEKTKNRLQQELDDLVVDLD----NQRQLVSNLEKKQKKFDQ 1461

Query: 228 DLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSASNKKQLEA 407
L K +S ++ EA + +++ K+ + ARA+E ALE + E+ +N K L+A
Sbjct: 1462 MLAEEKNISSKYADERDRAEA---EAREKETKALSLARALEEALEAKEELERTN-KMLKA 1517

Query: 408 SRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVK 509
+ + +KD++ ++EK+K E+ ++E+K
Sbjct: 1518 EMEDLVSSKDDVGKNVHELEKSKRTLEQQVEEMK 1551



Score = 50.1 bits (118), Expect = 1e-05
Identities = 46/196 (23%), Positives = 79/196 (40%), Gaps = 23/196 (11%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVT-KESNEQLEKKILDAQKEAGSIVNSLKEALKHE 179
R LE S ++ A++ ELK + E+L+ + + E N+LK+ + E
Sbjct: 1064 RKLEGESSDLHEQIAELQAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELE 1123

Query: 180 QSVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKEL-------------- 317
+S + DLE K + +Q +DL LE LK EL
Sbjct: 1124 SHISD--------LQEDLESEKAARNKAEKQKRDLSEELEALKTELEDTLDTTATQQELR 1175

Query: 318 AKSENSARAMETALEEEREVSASNKKQLEASR----KSIAEAKDNIKLLRQDVEKAKLES 485
AK E ++ ALEEE + +++ + + E + K + +++K K
Sbjct: 1176 AKREQEVTVLKRALEEETRTHEAQVQEMRQKHTQAVEELTEQLEQFKRAKANLDKTKQTL 1235

Query: 486 EK----LIKEVKDLER 521
EK L E++ L +
Sbjct: 1236 EKDNADLANEIRSLSQ 1251



Score = 49.3 bits (116), Expect = 2e-05
Identities = 42/190 (22%), Positives = 90/190 (47%), Gaps = 18/190 (9%)
Frame = +3

Query: 12 EASSKEIDAANAQISTLFEELKVTKESNEQLEKKI-------LDAQKEAGSIVNSLKEAL 170
EA ++E + ++ EE KE E+ K + + ++ + G V+ L+++
Sbjct: 1481 EAEAREKETKALSLARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSK 1540

Query: 171 KHEQSVSSNLRKELEKVTSDLE--------LSKKEASLLNEQSKDLEASLEQLKKELAKS 326
+ + ++ +LE++ +L+ L ++ ++ +DL+A EQ +++ +
Sbjct: 1541 RTLEQQVEEMKTQLEELEDELQAAEDAKLRLEVNMQAMKSQFERDLQARDEQNEEKRRQL 1600

Query: 327 ENSARAMETALEEERE---VSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLI 497
ET LE+ER+ ++A+ KK+LE K + D+ R++ K + KL
Sbjct: 1601 LKQLHEHETELEDERKQRALAAAAKKKLEVDVKDLESQVDSANKAREEAIK---QLRKLQ 1657

Query: 498 KEVKDLERKL 527
++KD +R L
Sbjct: 1658 AQMKDYQRDL 1667



Score = 48.9 bits (115), Expect = 2e-05
Identities = 35/168 (20%), Positives = 78/168 (46%)
Frame = +3

Query: 24 KEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNLR 203
+E+D ++ I T+ + ++ + EQL ++ + A N+ ++ + + + S L+
Sbjct: 1749 EELDEEHSNIETMSDRMRKAVQQAEQLNNELATERATAQKNENARQQLERQNKELRSKLQ 1808

Query: 204 KELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSA 383
+ V S K + L + LE LEQ +E + + R + L++
Sbjct: 1809 EMEGAVKSKF---KSTIAALEAKIASLEEQLEQEAREKQAAAKTLRQKDKKLKDALLQVE 1865

Query: 384 SNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERKL 527
+KQ E + + +K L++ +E+A+ ES+++ + L+R+L
Sbjct: 1866 DERKQAEQYKDQAEKGNLRLKQLKRQLEEAEEESQRINANRRKLQREL 1913



Score = 48.1 bits (113), Expect = 4e-05
Identities = 44/199 (22%), Positives = 87/199 (43%), Gaps = 30/199 (15%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQS 185
+ E + A ++ + E++ E E+ +++ +K+ + L+E L+ E++
Sbjct: 911 EAEEMRVRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKKMQQQMLDLEEQLEEEEA 970

Query: 186 VSSNLRKELEKVTSDLELSK----------------KEASLLNEQSKDLEASL---EQLK 308
L +LEKVT+D ++ K KE LL E+ DL +L E+
Sbjct: 971 ARQKL--QLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKA 1028

Query: 309 KELAKSENSARAMETALEEEREVSASNKKQLEASRK-----------SIAEAKDNIKLLR 455
K L K +N +M + LE + ++++LE ++ IAE + I L+
Sbjct: 1029 KNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELK 1088

Query: 456 QDVEKAKLESEKLIKEVKD 512
+ K + E + + ++D
Sbjct: 1089 AQLAKKEEELQAALARLED 1107



Score = 46.6 bits (109), Expect = 1e-04
Identities = 46/180 (25%), Positives = 88/180 (48%), Gaps = 9/180 (5%)
Frame = +3

Query: 12 EASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIV---NSLKEALKHEQ 182
EA SK I ++TL +L+ T+E ++ ++ L+ + + NSL+E L E
Sbjct: 1304 EAESKNIKLTK-DVATLGSQLQDTQELLQEETRQKLNVTTKLRQLEDDKNSLQEQLDEEV 1362

Query: 183 SVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALE 362
NL + + +T L SKK+ L E + +E ++E+ KK+L R +E+ +
Sbjct: 1363 EAKQNLERHISTLTIQLSDSKKK---LQEFTATVE-TMEEGKKKL------QREIESLTQ 1412

Query: 363 EEREVSAS------NKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERK 524
+ E +AS K +L+ + DN + L ++EK + + ++++ E K++ K
Sbjct: 1413 QFEEKAASYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQKKFDQMLAEEKNISSK 1472



Score = 42.7 bits (99), Expect = 0.002
Identities = 40/183 (21%), Positives = 84/183 (45%), Gaps = 8/183 (4%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQ 182
R+ E +K ++A Q+ E+L + + +Q + + + +E S NS + +L+ E+
Sbjct: 1682 RENEKKAKNLEAELIQLQ---EDLAAAERARKQADLEKEEMAEELAS-ANSGRTSLQDEK 1737

Query: 183 SVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETA-- 356
L + ++ +L+ ++++ + EQL ELA +A+ E A
Sbjct: 1738 R---RLEARIAQLEEELDEEHSNIETMSDRMRKAVQQAEQLNNELATERATAQKNENARQ 1794

Query: 357 -LEEEREVSASNKKQLEASRKS-----IAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLE 518
LE + + S +++E + KS IA + I L + +E+ E + K ++ +
Sbjct: 1795 QLERQNKELRSKLQEMEGAVKSKFKSTIAALEAKIASLEEQLEQEAREKQAAAKTLRQKD 1854

Query: 519 RKL 527
+KL
Sbjct: 1855 KKL 1857



Score = 40.8 bits (94), Expect = 0.006
Identities = 34/157 (21%), Positives = 81/157 (51%), Gaps = 3/157 (1%)
Frame = +3

Query: 45 AQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNLRKELEKVT 224
A S +L+ E NE+ +++L K+ L++ K ++++++ +K+LE
Sbjct: 1577 AMKSQFERDLQARDEQNEEKRRQLL---KQLHEHETELEDERK-QRALAAAAKKKLEVDV 1632

Query: 225 SDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSAS---NKK 395
DLE S ++ +K E +++QL+K A+ ++ R ++ A E+ A+ N+K
Sbjct: 1633 KDLE------SQVDSANKAREEAIKQLRKLQAQMKDYQRDLDDARAAREEIFATARENEK 1686

Query: 396 QLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEV 506
+ + + + ++++ + ++A LE E++ +E+
Sbjct: 1687 KAKNLEAELIQLQEDLAAAERARKQADLEKEEMAEEL 1723


>sp|Q9Z221|PMFBP_RAT Polyamine-modulated factor 1-binding protein 1
OS=Rattus norvegicus GN=Pmfbp1 PE=2 SV=2
Length = 971

Score = 61.2 bits (147), Expect = 4e-09
Identities = 47/190 (24%), Positives = 93/190 (48%), Gaps = 17/190 (8%)
Frame = +3

Query: 9 LEASSKEIDAANAQISTLFEELKVTKESNEQLEKKI---LDAQKEAGSIVNSLKEALKHE 179
LE + +++ ++ +S +E ++ + E +K+ L K ++ L+ L+
Sbjct: 433 LEEAREQLRVSDQNLSQCKDEAHLSANNLEDAHRKLENCLLQDKRKDDVIKDLQSQLQKL 492

Query: 180 QSVSS-------NLRKELEKVTSDLE-------LSKKEASLLNEQSKDLEASLEQLKKEL 317
Q SS N R++L +++S+L ++KE SLL + + E +++L
Sbjct: 493 QKESSETEEERKNNRQQLLELSSELNEGQRRLSSAEKEKSLLQKTLDEEEKKIDELLHGA 552

Query: 318 AKSENSARAMETALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLI 497
SE R + +L + ++ A K+ LE R+ + ++KD K L +++E + ES+K
Sbjct: 553 KVSEQKQRELTNSLSKLQDELAETKRLLEEKREQLRKSKDQEKALEEEIEALRQESKKKE 612

Query: 498 KEVKDLERKL 527
K K+ RKL
Sbjct: 613 KMAKEQLRKL 622



Score = 47.4 bits (111), Expect = 6e-05
Identities = 43/178 (24%), Positives = 86/178 (48%), Gaps = 21/178 (11%)
Frame = +3

Query: 21 SKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNL 200
S E++ ++S+ +E + +++ ++ EKKI +++ K + + ++ ++++L
Sbjct: 514 SSELNEGQRRLSSAEKEKSLLQKTLDEEEKKI-------DELLHGAKVSEQKQRELTNSL 566

Query: 201 RK---ELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEER 371
K EL + LE +++ +Q K LE +E L++E K E A+ LEEE+
Sbjct: 567 SKLQDELAETKRLLEEKREQLRKSKDQEKALEEEIEALRQESKKKEKMAKEQLRKLEEEK 626

Query: 372 E-------------VSASNK-----KQLEASRKSIAEAKDNIKLLRQDVEKAKLESEK 491
E S+ NK K ++ IA KD+I +L+ ++ A ++ EK
Sbjct: 627 ENLQAELSSCSSQLDSSINKYNNSQKVIQELNTEIARQKDSIMILQTQLDSA-IQKEK 683


>sp|P58301|RAD50_PYRFU DNA double-strand break repair rad50 ATPase
OS=Pyrococcus furiosus GN=rad50 PE=1 SV=1
Length = 882

Score = 60.8 bits (146), Expect = 5e-09
Identities = 41/150 (27%), Positives = 80/150 (53%), Gaps = 1/150 (0%)
Frame = +3

Query: 75 KVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNLRKELEKVTSDLELSKKEA 254
K KE N +LE + ++ S + L+E K ++ N +KELE ++ +K+
Sbjct: 573 KELKELNTKLESFGFKSVEDLDSKLRELEEIYKRYLTLL-NSKKELEITQREIAKAKETL 631

Query: 255 SLLNEQSKDLEASLEQLKKELAKSENSARAMETALE-EEREVSASNKKQLEASRKSIAEA 431
+ E+ ++EA +E+++K+L++ + E + EE+E +LEA +K + +
Sbjct: 632 EMSFEELAEVEADIERIEKKLSQLKQKYNEEEYKKKREEKEELEKELARLEAQKKELEKR 691

Query: 432 KDNIKLLRQDVEKAKLESEKLIKEVKDLER 521
+D IK + ++ K E++ KE+KDLE+
Sbjct: 692 RDTIKSTLEKLKAEKENRERVKKEIKDLEK 721



Score = 47.4 bits (111), Expect = 6e-05
Identities = 43/188 (22%), Positives = 85/188 (45%), Gaps = 13/188 (6%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVN---------SL 158
++E S + ++ TL E +K T+E E+L++K + +++ I + +L
Sbjct: 245 EIENSERLLEKRRGDKRTLEERIKNTEEYLEKLKEKEKELEEQVKEITSIKKDVDAYLAL 304

Query: 159 KEALKHEQSVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSA 338
KE + KEL +V + +K LNE+ + E LE KKE+ N
Sbjct: 305 KEFKNEYLDKKYKIEKELTRVEELINEIQKRIEELNEKESEKE-KLENEKKEIL---NKL 360

Query: 339 RAMETALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKL----ESEKLIKEV 506
+E + E+ A + + K ++ ++IK L +++E K E ++ + +
Sbjct: 361 AILEKDHQLYEEIKAKKENLRQLKEKLGDKSPEDIKKLLEELETKKTTIEEERNEITQRI 420

Query: 507 KDLERKLG 530
+L+ K+G
Sbjct: 421 GELKNKIG 428



Score = 45.8 bits (107), Expect = 2e-04
Identities = 44/176 (25%), Positives = 80/176 (45%), Gaps = 1/176 (0%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQ 182
++LE + +EI A + FEEL + E++EKK+ + LK+ E
Sbjct: 615 KELEITQREIAKAKETLEMSFEELAEVEADIERIEKKL-----------SQLKQKYNEE- 662

Query: 183 SVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALE 362
E +K + E +KE + L Q K+LE + +K L K L+
Sbjct: 663 --------EYKKKREEKEELEKELARLEAQKKELEKRRDTIKSTLEK-----------LK 703

Query: 363 EEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAK-LESEKLIKEVKDLERKL 527
E+E N+++++ K + +AKD + L + V+K K L E + ++ +L ++
Sbjct: 704 AEKE----NRERVKKEIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEI 755



Score = 40.0 bits (92), Expect = 0.010
Identities = 41/191 (21%), Positives = 79/191 (41%), Gaps = 35/191 (18%)
Frame = +3

Query: 60 LFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNLRKELEKVTSDLEL 239
L+EE+K KE+ QL++K+ D E +K+ L+ ++ + + +E ++T +
Sbjct: 369 LYEEIKAKKENLRQLKEKLGDKSPE------DIKKLLEELETKKTTIEEERNEITQRIGE 422

Query: 240 SKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSASNKKQLEASRKS 419
K + DL+ ++E+LKK AK + E E E+ + L S+ +
Sbjct: 423 LKNKIG-------DLKTAIEELKK--AKGKCPVCGRELTDEHREELLSKYHLDLNNSKNT 473

Query: 420 IAEAKDNIKLLRQD-----------------------------------VEKAKLESEKL 494
+A+ D L ++ +EK E EKL
Sbjct: 474 LAKLIDRKSELERELRRIDMEIKRLTPLLTVAEQIRSIEEELNVVNLEKIEKNATEYEKL 533

Query: 495 IKEVKDLERKL 527
++E++ LE ++
Sbjct: 534 LEELRTLEGRI 544


>sp|P39922|MYS3_HYDAT Myosin heavy chain, clone 203 (Fragment)
OS=Hydra attenuata PE=2 SV=1
Length = 539

Score = 60.5 bits (145), Expect = 7e-09
Identities = 45/173 (26%), Positives = 87/173 (50%), Gaps = 4/173 (2%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEA---LKH 176
D+ + I NA+ + EELK E + E K + K + +S++E LK
Sbjct: 184 DIRKQDETISKMNAEKKHVDEELKDRTEQLQAAEDKCNNLNKTKNKLESSIREIEQDLKK 243

Query: 177 EQSVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETA 356
E+ L KE +KV SDL+ ++ + S + K+ + + + +K ++ EN+ +E+
Sbjct: 244 EKDSKMKLEKEKKKVESDLKDNRDKLSETETRLKETQDLVTKREKSISDLENAKEGLESQ 303

Query: 357 LEE-EREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKD 512
+ + +R++ ++L A + + E +N + LRQ E + E E I+E++D
Sbjct: 304 ISQLQRKI-----QELLAKIEELEEELENERKLRQKSELQRKELESRIEELQD 351



Score = 51.6 bits (122), Expect = 3e-06
Identities = 46/195 (23%), Positives = 88/195 (45%), Gaps = 20/195 (10%)
Frame = +3

Query: 3 RDLEASSK---EIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALK 173
+D EA K E+ A AQ L+ L+ + +E K+L+ Q + +SL EAL+
Sbjct: 68 KDAEAKKKMEEELTEAMAQKEKLYASLQAETDRLITIEDKLLNLQTVKDKLESSLNEALE 127

Query: 174 ----HEQSV------SSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAK 323
E SV ++++++T E + S L + ++ + ++ L +++ K
Sbjct: 128 KLDGEEHSVLVLEEKIQEAEEKIDELTEKTEELQSNISRLETEKQNRDKQIDTLNEDIRK 187

Query: 324 SENSARAMETALEEEREVSASNKKQLEAS-------RKSIAEAKDNIKLLRQDVEKAKLE 482
+ + M + E +QL+A+ K+ + + +I+ + QD++K K
Sbjct: 188 QDETISKMNAEKKHVDEELKDRTEQLQAAEDKCNNLNKTKNKLESSIREIEQDLKKEKDS 247

Query: 483 SEKLIKEVKDLERKL 527
KL KE K +E L
Sbjct: 248 KMKLEKEKKKVESDL 262



Score = 43.9 bits (102), Expect = 7e-04
Identities = 44/207 (21%), Positives = 88/207 (42%), Gaps = 39/207 (18%)
Frame = +3

Query: 24 KEIDAANAQISTLFEELKVTKESNE--QLEKKILDAQKE--------AGSIVNSLKEALK 173
++I A+I L EEL+ ++ + +L++K L+++ E AG ++ E K
Sbjct: 309 RKIQELLAKIEELEEELENERKLRQKSELQRKELESRIEELQDQLETAGGATSAQVEVGK 368

Query: 174 HEQSVSSNLRKELE--KVTSDLELS---------------------------KKEASLLN 266
++ + LRKE+E + +D +S +KE S LN
Sbjct: 369 KREAECNRLRKEIEALNIANDAAISAIKAKTNATIAEIQEENEAMKKAKAKLEKEKSALN 428

Query: 267 EQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSASNKKQLEASRKSIAEAKDNIK 446
+ + + SL+Q+KK+ S+ ++R +E + E A + S ++ +
Sbjct: 429 NELNETKNSLDQIKKQKTNSDKNSRMLEEQINELNSKLAQVDELHSQSESKNSKVNSELL 488

Query: 447 LLRQDVEKAKLESEKLIKEVKDLERKL 527
L + +++ K +K LE +L
Sbjct: 489 ALNSQLSESEHNLGIATKNIKTLESQL 515



Score = 43.1 bits (100), Expect = 0.001
Identities = 32/174 (18%), Positives = 79/174 (45%), Gaps = 24/174 (13%)
Frame = +3

Query: 78 VTKESNEQLEKKI----------------LDAQKE-AGSIVNSLKEALKHEQSVSSNLR- 203
V +E ++ E+KI L+ +K+ +++L E ++ + S +
Sbjct: 138 VLEEKIQEAEEKIDELTEKTEELQSNISRLETEKQNRDKQIDTLNEDIRKQDETISKMNA 197

Query: 204 ------KELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEE 365
+EL+ T L+ ++ + + LN+ LE+S+ +++++L K ++S +E ++
Sbjct: 198 EKKHVDEELKDRTEQLQAAEDKCNNLNKTKNKLESSIREIEQDLKKEKDSKMKLEKEKKK 257

Query: 366 EREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERKL 527
N+ +L + + E +D + + + + E L ++ L+RK+
Sbjct: 258 VESDLKDNRDKLSETETRLKETQDLVTKREKSISDLENAKEGLESQISQLQRKI 311



Score = 40.4 bits (93), Expect = 0.008
Identities = 42/166 (25%), Positives = 78/166 (46%), Gaps = 8/166 (4%)
Frame = +3

Query: 3 RDLEASSKEIDAA--------NAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSL 158
+++EA + DAA NA I+ + EE + K++ +LEK+
Sbjct: 379 KEIEALNIANDAAISAIKAKTNATIAEIQEENEAMKKAKAKLEKE--------------- 423

Query: 159 KEALKHEQSVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSA 338
K AL +E + + N +++K ++ S K + +L EQ +L + L Q+ + ++SE+
Sbjct: 424 KSALNNELNETKNSLDQIKKQKTN---SDKNSRMLEEQINELNSKLAQVDELHSQSESKN 480

Query: 339 RAMETALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAK 476
+ + E+ A N QL S ++ A NIK L + ++K
Sbjct: 481 SKVNS------ELLALN-SQLSESEHNLGIATKNIKTLESQLAESK 519



Score = 31.6 bits (70), Expect = 3.5
Identities = 26/90 (28%), Positives = 45/90 (50%)
Frame = +3

Query: 216 KVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSASNKK 395
KV L +++ E + + ++LEA+ EQLKK+ + + A+ ++ ++ AS
Sbjct: 38 KVQPLLSVARAEDEM-RAKEEELEAAKEQLKKDAEAKKKMEEELTEAMAQKEKLYAS--- 93

Query: 396 QLEASRKSIAEAKDNIKLLRQDVEKAKLES 485
L+A + +D KLL K KLES
Sbjct: 94 -LQAETDRLITIED--KLLNLQTVKDKLES 120


>sp|Q8C9S4|CJ118_MOUSE Uncharacterized protein C10orf118 homolog
OS=Mus musculus GN=Otg1 PE=2 SV=2
Length = 917

Score = 60.5 bits (145), Expect = 7e-09
Identities = 42/176 (23%), Positives = 89/176 (50%), Gaps = 10/176 (5%)
Frame = +3

Query: 30 IDAANAQISTLFEELKVTKESNEQLE------KKILDAQKEAGSIVNSLKEALKHEQSVS 191
I+ ++I L +++K+T + +EQL+ + + + + S++N L++ ++ +
Sbjct: 545 INRQKSEIQNLLDKVKITDQLHEQLQSGKQEIEHLKEEMESLNSLINDLQKDIEGSRKRE 604

Query: 192 SNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEER 371
S L EK+TS + E+S L Q +L + QL+ + + + R +E+ L +E
Sbjct: 605 SELLLFTEKLTSKNAQLQSESSALQSQVDNLSCTESQLQSQCQQMGQANRNLESKLLKEE 664

Query: 372 EVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAK----LESEKLIKEVKDLERKL 527
E+ K++++ + ++ A+ +K L VE+ K + K VKDL ++L
Sbjct: 665 EL---RKEEVQTLQAELSAAQTEVKALSTQVEELKDELVTQRRKHASNVKDLSKQL 717



Score = 41.6 bits (96), Expect = 0.003
Identities = 40/161 (24%), Positives = 67/161 (41%), Gaps = 1/161 (0%)
Frame = +3

Query: 48 QISTLFEEL-KVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNLRKELEKVT 224
Q+ EEL K K S +QL + + A+ I + + + R+E E +
Sbjct: 272 QLELRIEELNKEIKASKDQLVAQDVTAKNAIQQIHKEMAQRMDQANKKCEEARQEKEAMV 331

Query: 225 SDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSASNKKQLE 404
+KEA L ++ + LE L KEL K+ N + + + E+ R K+ E
Sbjct: 332 MKYVRGEKEALDLRKEKETLERKLRDASKELEKNTNKIK--QLSQEKGRLQQLYESKEGE 389

Query: 405 ASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERKL 527
+R L +++EK K E + +VK + KL
Sbjct: 390 TTR------------LIREIEKLKEEMNSQVIKVKWAQNKL 418



Score = 39.7 bits (91), Expect = 0.013
Identities = 36/172 (20%), Positives = 80/172 (46%), Gaps = 2/172 (1%)
Frame = +3

Query: 15 ASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSS 194
A ++D + S L + + ++N LE K+L ++ V +L+ L Q+
Sbjct: 627 ALQSQVDNLSCTESQLQSQCQQMGQANRNLESKLLKEEELRKEEVQTLQAELSAAQTEVK 686

Query: 195 NLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAME-TALEEER 371
L ++E++ +L +++ + KDL L+Q +++L ++EN + +++
Sbjct: 687 ALSTQVEELKDELVTQRRKHA---SNVKDLSKQLQQARRKLEQTENGNHDKDISSMGSRS 743

Query: 372 EVSASNKKQLEASRKSIAEAKDNIKLLR-QDVEKAKLESEKLIKEVKDLERK 524
S S ++ A +S ++ + +V+KA L E++++ K RK
Sbjct: 744 SSSGSLNARISAEDRSPENTSSSVAVDNFPEVDKAML-IERIVRLQKAHARK 794



Score = 37.7 bits (86), Expect = 0.050
Identities = 35/162 (21%), Positives = 73/162 (45%), Gaps = 5/162 (3%)
Frame = +3

Query: 60 LFEELKVTK--ESNEQLEKKILDAQKEAGSIVNSLK---EALKHEQSVSSNLRKELEKVT 224
L +EL V + + N+ ++ IL+ E S+ L+ E K + L +E++
Sbjct: 222 LQQELTVKQLIKENKNHQELILNICSEKDSLREELRKRTETEKQHMNTIKQLELRIEELN 281

Query: 225 SDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSASNKKQLE 404
+++ SK + L Q + +++Q+ KE+A+ + A +E+E + E
Sbjct: 282 KEIKASKDQ---LVAQDVTAKNAIQQIHKEMAQRMDQANKKCEEARQEKEAMVMKYVRGE 338

Query: 405 ASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERKLG 530
+ + K+ ++ +D K E EK ++K L ++ G
Sbjct: 339 KEALDLRKEKETLERKLRDASK---ELEKNTNKIKQLSQEKG 377


>sp|Q9NQX4|MYO5C_HUMAN Myosin-Vc OS=Homo sapiens GN=MYO5C PE=1 SV=1
Length = 1742

Score = 60.1 bits (144), Expect = 9e-09
Identities = 42/162 (25%), Positives = 81/162 (50%), Gaps = 18/162 (11%)
Frame = +3

Query: 96 EQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNLRKELEKVTSD-----------LELS 242
E L K++ +E +N L++ + E ++ ++R E+ ++TS+ EL
Sbjct: 1167 EALNFKVVHLSQE----INHLQKLFREENDINESIRHEVTRLTSENMMIPDFKQQISELE 1222

Query: 243 KKEASL---LNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSASNKKQLEASR 413
K++ L LNEQ++ ++ LE+L +L +S+ ALE + E+ K++L
Sbjct: 1223 KQKQDLEIRLNEQAEKMKGKLEELSNQLHRSQEEEGTQRKALEAQNEIHTKEKEKLIDKI 1282

Query: 414 KSIAEAKDNIKLLRQDVEKAKL----ESEKLIKEVKDLERKL 527
+ + EA D++K + + K E+ +L E +DLE +L
Sbjct: 1283 QEMQEASDHLKKQFETESEVKCNFRQEASRLTLENRDLEEEL 1324



Score = 39.3 bits (90), Expect = 0.017
Identities = 29/131 (22%), Positives = 67/131 (51%), Gaps = 2/131 (1%)
Frame = +3

Query: 3 RDLEAS-SKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNS-LKEALKH 176
+DLE +++ + ++ L +L ++E E ++K L+AQ E + L + ++
Sbjct: 1226 QDLEIRLNEQAEKMKGKLEELSNQLHRSQEE-EGTQRKALEAQNEIHTKEKEKLIDKIQE 1284

Query: 177 EQSVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETA 356
Q S +L+K+ E + ++EAS L +++DLE L+ + + K ++ + +
Sbjct: 1285 MQEASDHLKKQFETESEVKCNFRQEASRLTLENRDLEEELDMKDRVIKKLQDQVKTLSKT 1344

Query: 357 LEEEREVSASN 389
+ + +V +S+
Sbjct: 1345 IGKANDVHSSS 1355


tr_hit_id Q4Q3D8
Definition tr|Q4Q3D8|Q4Q3D8_LEIMA Putative uncharacterized protein OS=Leishmania major
Align length 171
Score (bit) 74.3
E-value 6.0e-12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK951097|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_H18, 5'
(634 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q4Q3D8|Q4Q3D8_LEIMA Putative uncharacterized protein OS=Leish... 74 6e-12
tr|B2W3G7|B2W3G7_PYRTR Predicted protein OS=Pyrenophora tritici-... 71 6e-11
tr|B6W6V0|B6W6V0_9FIRM Putative uncharacterized protein OS=Anaer... 70 1e-10
tr|Q2SR11|Q2SR11_MYCCT Membrane protein, putative OS=Mycoplasma ... 70 1e-10
tr|A2EJ43|A2EJ43_TRIVA Viral A-type inclusion protein, putative ... 70 1e-10
tr|A1C6F5|A1C6F5_ASPCL Nuclear condensin complex subunit Smc2, p... 68 4e-10
tr|Q5AFC4|Q5AFC4_CANAL Putative uncharacterized protein SLK19 OS... 68 5e-10
tr|A2DDX5|A2DDX5_TRIVA Viral A-type inclusion protein, putative ... 67 7e-10
tr|B6LMK0|B6LMK0_BRAFL Putative uncharacterized protein OS=Branc... 67 9e-10
tr|B8YGH5|B8YGH5_STRSG M protein (Fragment) OS=Streptococcus sp.... 66 2e-09
tr|A2EVM7|A2EVM7_TRIVA DNA-directed RNA polymerase, omega subuni... 66 2e-09
tr|A2E8Z5|A2E8Z5_TRIVA Viral A-type inclusion protein, putative ... 66 2e-09
tr|Q48R47|Q48R47_STRPM Emm-like protein OS=Streptococcus pyogene... 66 2e-09
tr|Q4X159|Q4X159_ASPFU Nuclear condensin complex subunit Smc2, p... 66 2e-09
tr|B0XSE2|B0XSE2_ASPFC Nuclear condensin complex subunit Smc2, p... 66 2e-09
tr|A5DJG0|A5DJG0_PICGU Putative uncharacterized protein OS=Pichi... 66 2e-09
tr|A1DH28|A1DH28_NEOFI Nuclear condensin complex subunit Smc2, p... 66 2e-09
tr|Q9BLM9|Q9BLM9_TOXCA Myosin heavy chain (Fragment) OS=Toxocara... 65 3e-09
tr|A8PYZ8|A8PYZ8_BRUMA Myosin heavy chain, putative OS=Brugia ma... 65 3e-09
tr|A0BIX7|A0BIX7_PARTE Chromosome undetermined scaffold_11, whol... 65 3e-09
tr|B8M091|B8M091_9EURO M protein repeat protein OS=Talaromyces s... 65 3e-09
tr|Q1J4H6|Q1J4H6_STRPF M protein OS=Streptococcus pyogenes serot... 65 3e-09
tr|B7P1Q2|B7P1Q2_IXOSC Myosin heavy chain, skeletal muscle or ca... 65 3e-09
tr|Q8TZY2|Q8TZY2_PYRFU Chromosome segregation protein smc OS=Pyr... 65 3e-09
tr|Q877I1|Q877I1_PYRFU SMC protein OS=Pyrococcus furiosus GN=smc... 65 3e-09
tr|B1RL27|B1RL27_CLOPE Putative uncharacterized protein OS=Clost... 65 4e-09
tr|B1BT25|B1BT25_CLOPE Putative uncharacterized protein OS=Clost... 65 4e-09
tr|B1BIX7|B1BIX7_CLOPE Putative uncharacterized protein OS=Clost... 65 4e-09
tr|A2FRC3|A2FRC3_TRIVA Putative uncharacterized protein OS=Trich... 65 4e-09
tr|A2FQ07|A2FQ07_TRIVA Viral A-type inclusion protein, putative ... 65 4e-09

>tr|Q4Q3D8|Q4Q3D8_LEIMA Putative uncharacterized protein OS=Leishmania
major GN=LmjF34.0690 PE=4 SV=1
Length = 3167

Score = 74.3 bits (181), Expect = 6e-12
Identities = 47/171 (27%), Positives = 89/171 (52%), Gaps = 3/171 (1%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQS 185
+LE + +E + A + E+ + K NEQL ++ AQ+EA + L+ A + +
Sbjct: 1953 ELEKAQEEAERLAADLEKAEEDAERQKADNEQLAAELNRAQEEAKRLAADLERAQEEAEK 2012

Query: 186 VSSNLRK---ELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETA 356
+++ L + E EK+ +DLE ++++A ++ L A E+L EL +++ A +
Sbjct: 2013 LAAELERAQEEAEKLAADLEKAEEDAERQKADNERLAADNERLAAELERTQEEAEKLAAD 2072

Query: 357 LEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVK 509
LE+ E + K E + A++ K L D+E+A+ E+EKL E++
Sbjct: 2073 LEKAEEDAERQKADNEQLAAELNRAQEEAKRLAADLERAQEEAEKLAAELE 2123



Score = 68.6 bits (166), Expect = 3e-10
Identities = 45/171 (26%), Positives = 89/171 (52%), Gaps = 3/171 (1%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEA---LKH 176
D E + E++ A + L EL+ +E E+L ++ AQ+EA + L++A +
Sbjct: 1848 DNERLAAELERAQEEAERLAAELERAQEEAERLAAEVDRAQEEAEQLAADLEKAEEEAER 1907

Query: 177 EQSVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETA 356
+++ + L + E++ ++L+ +++EA L + + E E+L EL K++ A +
Sbjct: 1908 QKADNRRLAADNERLAAELDRAQEEAERLAAELEKAEEEAERLAAELEKAQEEAERLAAD 1967

Query: 357 LEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVK 509
LE+ E + K E + A++ K L D+E+A+ E+EKL E++
Sbjct: 1968 LEKAEEDAERQKADNEQLAAELNRAQEEAKRLAADLERAQEEAEKLAAELE 2018



Score = 62.8 bits (151), Expect = 2e-08
Identities = 49/190 (25%), Positives = 93/190 (48%), Gaps = 17/190 (8%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKH-EQ 182
+LE + +E + A + EE + K NE+L ++ AQ+EA + L++A + E+
Sbjct: 2163 ELERTQEEAEKLAADLEKAEEEAERQKADNERLAAELDRAQEEAEKLAADLEKAEEDAER 2222

Query: 183 SVSSNLR---------KELEKVTSDLELSKKEASLLNEQSKDLEASL-------EQLKKE 314
+ N R +E EK+ +DLE ++++A ++ L A L E+L E
Sbjct: 2223 QKADNERLAAELNRAQEEAEKLAADLEKAEEDAERQKADNERLAAELNRAQEEAERLAAE 2282

Query: 315 LAKSENSARAMETALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKL 494
L +++ A + LE+ E + K E + A++ + L ++EKA+ E+EKL
Sbjct: 2283 LERAQEEAEKLAADLEKAEEEAERQKADNEQLAAELNRAQEEAEKLAAELEKAQEEAEKL 2342

Query: 495 IKEVKDLERK 524
+++ E +
Sbjct: 2343 AADLEKAEEE 2352



Score = 62.0 bits (149), Expect = 3e-08
Identities = 45/181 (24%), Positives = 90/181 (49%), Gaps = 10/181 (5%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKH-EQ 182
+ E + E++ A + L EL+ +E E+L ++ AQ+EA + L++A + E+
Sbjct: 2534 EAERLAAELERAREEAERLAAELEKAQEEAERLAAELDRAQEEAEKLAADLEKAEEEAER 2593

Query: 183 SVSSNLR---------KELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENS 335
+ N R +E E++ ++LE +++EA L + + E+L EL +++
Sbjct: 2594 QKADNERLAAELDRAQEEAERLAAELERAQEEAERLAAELDRAQEEAERLAAELDRAQEE 2653

Query: 336 ARAMETALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDL 515
A + LE+ E + K E + A++ + L ++EKA+ E+EKL +++
Sbjct: 2654 AEKLAADLEKAEEEAERQKADNERLAAELNRAQEEAERLAAELEKAQEEAEKLAADLEKA 2713

Query: 516 E 518
E
Sbjct: 2714 E 2714



Score = 58.2 bits (139), Expect = 4e-07
Identities = 41/184 (22%), Positives = 94/184 (51%), Gaps = 10/184 (5%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEA---LKH 176
D E + E++ A + L +L+ +E E+L ++ AQ+EA + L++A +
Sbjct: 1981 DNEQLAAELNRAQEEAKRLAADLERAQEEAEKLAAELERAQEEAEKLAADLEKAEEDAER 2040

Query: 177 EQSVSSNLRKELEKVTSDLELSKKEASLL-------NEQSKDLEASLEQLKKELAKSENS 335
+++ + L + E++ ++LE +++EA L E ++ +A EQL EL +++
Sbjct: 2041 QKADNERLAADNERLAAELERTQEEAEKLAADLEKAEEDAERQKADNEQLAAELNRAQEE 2100

Query: 336 ARAMETALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDL 515
A+ + LE +E + +LE +++ + +++ +D E+ K ++ +L + + L
Sbjct: 2101 AKRLAADLERAQEEAEKLAAELERAQEEAEKLAADLEKAEEDAERQKADNRRLAADNERL 2160

Query: 516 ERKL 527
+L
Sbjct: 2161 AAEL 2164



Score = 58.2 bits (139), Expect = 4e-07
Identities = 45/190 (23%), Positives = 95/190 (50%), Gaps = 17/190 (8%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKH-EQ 182
+L+ + +E + A + E+ + K NE+L ++ AQ+EA + L++A + E+
Sbjct: 2198 ELDRAQEEAEKLAADLEKAEEDAERQKADNERLAAELNRAQEEAEKLAADLEKAEEDAER 2257

Query: 183 SVSSNLR---------KELEKVTSDLELSKKEASLL-------NEQSKDLEASLEQLKKE 314
+ N R +E E++ ++LE +++EA L E+++ +A EQL E
Sbjct: 2258 QKADNERLAAELNRAQEEAERLAAELERAQEEAEKLAADLEKAEEEAERQKADNEQLAAE 2317

Query: 315 LAKSENSARAMETALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKL 494
L +++ A + LE+ +E + LE + + K + + L ++ +A+ E+EKL
Sbjct: 2318 LNRAQEEAEKLAAELEKAQEEAEKLAADLEKAEEEAERQKADNERLAAELNRAQEEAEKL 2377

Query: 495 IKEVKDLERK 524
E++ + +
Sbjct: 2378 AAELEKAQEE 2387



Score = 57.0 bits (136), Expect = 9e-07
Identities = 45/191 (23%), Positives = 95/191 (49%), Gaps = 17/191 (8%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFEELKVTKES--------------NEQLEKKILDAQKEAGS 143
+ E + E+D A + L +L+ +E NE+L ++ AQ+EA
Sbjct: 1876 EAERLAAEVDRAQEEAEQLAADLEKAEEEAERQKADNRRLAADNERLAAELDRAQEEAER 1935

Query: 144 IVNSLKEALKHEQSVSSNLRK---ELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKE 314
+ L++A + + +++ L K E E++ +DLE ++++A E+ K A EQL E
Sbjct: 1936 LAAELEKAEEEAERLAAELEKAQEEAERLAADLEKAEEDA----ERQK---ADNEQLAAE 1988

Query: 315 LAKSENSARAMETALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKL 494
L +++ A+ + LE +E + +LE +++ + +++ +D E+ K ++E+L
Sbjct: 1989 LNRAQEEAKRLAADLERAQEEAEKLAAELERAQEEAEKLAADLEKAEEDAERQKADNERL 2048

Query: 495 IKEVKDLERKL 527
+ + L +L
Sbjct: 2049 AADNERLAAEL 2059


>tr|B2W3G7|B2W3G7_PYRTR Predicted protein OS=Pyrenophora
tritici-repentis (strain Pt-1C-BFP) GN=PTRG_05017 PE=4
SV=1
Length = 1367

Score = 70.9 bits (172), Expect = 6e-11
Identities = 55/183 (30%), Positives = 95/183 (51%), Gaps = 15/183 (8%)
Frame = +3

Query: 6 DLEASSKEI----DAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGS---------- 143
+LEA+ E+ +A+NA+++ L LK ++S E ++ A++E
Sbjct: 656 ELEAAKGEVTKVSEASNAKVTELEGSLKEAQDSLAAKESELAAAKEEVSKASEASATKVA 715

Query: 144 -IVNSLKEALKHEQSVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELA 320
+ SLKEA + + S L E+ T +E SK +A L + DLEASL++ K L+
Sbjct: 716 ELEGSLKEAQESLATKESELAAAKEEATKAVESSKGDAEGLQKTIADLEASLKEAKDSLS 775

Query: 321 KSENSARAMETALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIK 500
E+ A + + + E S+S +LEAS K EA+++I + ++E AK E++K ++
Sbjct: 776 SKESELEAAKGDVTKVTESSSSKIAELEASLK---EAQESITAHKSELEAAKSEAKKAVE 832

Query: 501 EVK 509
K
Sbjct: 833 SSK 835



Score = 62.8 bits (151), Expect = 2e-08
Identities = 51/192 (26%), Positives = 99/192 (51%), Gaps = 18/192 (9%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDA---QKEAGSIVNSLKEALK 173
+DL A+ + ++ + EELK TKE+ + ++ A + E + S +++
Sbjct: 1079 KDLAAAEQSLEETKKAKEAVDEELKATKEAEAEAKETAAKASTLESELAELKISTEKSTA 1138

Query: 174 HEQSVSSNLRKELEKVT---SDLELSK-KEASL------LNEQSKDLEASLEQLKKELAK 323
+ + L+ KVT + +E +K KE+ L L+E ++ EAS+++L E AK
Sbjct: 1139 EKSELEEKLKASETKVTELEASVEAAKAKESELTALQAKLDEATQASEASIKEL--EAAK 1196

Query: 324 S-----ENSARAMETALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESE 488
S + S ++ L+E+ E + + + + EA++K+ EAK ++ ++ +EKAK + E
Sbjct: 1197 SGETEAKTSLETLQATLKEQEEKTTALQSEAEAAKKAQEEAKAELESAKEQLEKAKADQE 1256

Query: 489 KLIKEVKDLERK 524
+L K +L K
Sbjct: 1257 ELKKTNAELLEK 1268



Score = 61.6 bits (148), Expect = 4e-08
Identities = 63/209 (30%), Positives = 96/209 (45%), Gaps = 37/209 (17%)
Frame = +3

Query: 12 EASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVS 191
EA SK +DA A+IS L LK +++S + ++ + +A S K + QS
Sbjct: 560 EAKSK-VDALTAKISELEASLKESQDSLSAKDAELETVKGDASKAAESAKVEVAGLQSTV 618

Query: 192 SNLRKELE--KVTSDLELS--KKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETAL 359
S L E+E K +SD + + KKEA L E LEA LE K E+ K ++ A T L
Sbjct: 619 SKLEAEIESTKGSSDEQTTAAKKEAEELRETVAKLEAELEAAKGEVTKVSEASNAKVTEL 678

Query: 360 E------------EEREVSASNK---KQLEASRKSIAEAKDNIKLLRQD----------- 461
E +E E++A+ + K EAS +AE + ++K ++
Sbjct: 679 EGSLKEAQDSLAAKESELAAAKEEVSKASEASATKVAELEGSLKEAQESLATKESELAAA 738

Query: 462 -------VEKAKLESEKLIKEVKDLERKL 527
VE +K ++E L K + DLE L
Sbjct: 739 KEEATKAVESSKGDAEGLQKTIADLEASL 767



Score = 57.0 bits (136), Expect = 9e-07
Identities = 49/189 (25%), Positives = 91/189 (48%), Gaps = 15/189 (7%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFEELKVTKESNE----QLEKKILDAQKEAGSIVNSLKEALK 173
+LE + KE +AA A+ + E K + +LE + + + + E+L+
Sbjct: 959 ELETAVKEKEAALAEATQATEAAKGGANESAAKIAELEASLKETTSKLEAKETEHSESLQ 1018

Query: 174 HEQSVSSNLRKELEKVTSDL--------ELSKKEASLLNEQSKDLEASLEQLKKELAKSE 329
QS S++ LEK +D EL K A+ +E S+ L+ + +++A E
Sbjct: 1019 AAQSSSNDKIAALEKELADAKAEASKVAELEAKLAAKESEHSEALQTAQSSGNEKVASLE 1078

Query: 330 NSARAMETALEEEREVSASNKKQLEASRKSIAEAKD---NIKLLRQDVEKAKLESEKLIK 500
A E +LEE ++ + ++L+A++++ AEAK+ L ++ + K+ +EK
Sbjct: 1079 KDLAAAEQSLEETKKAKEAVDEELKATKEAEAEAKETAAKASTLESELAELKISTEKSTA 1138

Query: 501 EVKDLERKL 527
E +LE KL
Sbjct: 1139 EKSELEEKL 1147



Score = 53.9 bits (128), Expect = 8e-06
Identities = 50/184 (27%), Positives = 85/184 (46%), Gaps = 11/184 (5%)
Frame = +3

Query: 9 LEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNS-------LKEA 167
+E+S + + I+ L LK K+S E ++ A+ + + S L+ +
Sbjct: 746 VESSKGDAEGLQKTIADLEASLKEAKDSLSSKESELEAAKGDVTKVTESSSSKIAELEAS 805

Query: 168 LKHEQSVSSNLRKELEKVTSD----LELSKKEASLLNEQSKDLEASLEQLKKELAKSENS 335
LK Q + + ELE S+ +E SK +A L +LEASL++ K LA E+
Sbjct: 806 LKEAQESITAHKSELEAAKSEAKKAVESSKGDAEGLRSTISELEASLKEAKDGLAAKESE 865

Query: 336 ARAMETALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDL 515
A + + + E S S +LEAS K+ A+D++ ++ E+ K V +L
Sbjct: 866 LEAAKADVSQATESSGSKIAELEASLKA---AQDSLAAKESELGAKSAEAGK----VTEL 918

Query: 516 ERKL 527
E+ L
Sbjct: 919 EQAL 922



Score = 47.8 bits (112), Expect = 6e-04
Identities = 46/196 (23%), Positives = 82/196 (41%), Gaps = 26/196 (13%)
Frame = +3

Query: 18 SSKEIDAANAQISTLFEELKVTKESNEQLEKKILDA--------QKEAGSIVNSLKEALK 173
+S E++A A++ST +L + EK++ DA + ++ + +AL
Sbjct: 310 NSAELEAKEAELSTAKAQLDELTAAKSNTEKELADALATIEELKSQSQDTVAKADLDALA 369

Query: 174 HEQSVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMET 353
++ +E + L+ E L + +LEA+ +L +ELA E
Sbjct: 370 ADRDAQKTKVEEFVAEVAILKSQISELEELKSKHAELEAAHSKLSEELAARGTQDADAEK 429

Query: 354 ALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDV------------------EKAKL 479
A +EE E S +L+A S+ EAKD ++ ++ E +K
Sbjct: 430 ASKEEAEGLRSTITELQA---SLQEAKDTLEQKASELDAKTKEHAAAADQVASLTESSKS 486

Query: 480 ESEKLIKEVKDLERKL 527
E + L E+ DL+ KL
Sbjct: 487 EVDSLKAEISDLQEKL 502



Score = 46.6 bits (109), Expect = 0.001
Identities = 40/167 (23%), Positives = 76/167 (45%)
Frame = +3

Query: 12 EASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVS 191
+AS +E + + I+ L L+ K++ EQ ++ KE + + + + +S
Sbjct: 429 KASKEEAEGLRSTITELQASLQEAKDTLEQKASELDAKTKEHAAAADQVASLTESSKSEV 488

Query: 192 SNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEER 371
+L+ E+ SDL+ K + + +L + L+K L ++++ A + LE
Sbjct: 489 DSLKAEI----SDLQEKLKTVDMSKGDADELAQKVSALEKSLKEAQDDLSAKTSELEAS- 543

Query: 372 EVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKD 512
SAS + EA+ K+ EAK + L + E E +KE +D
Sbjct: 544 --SASLASEKEAAVKAAEEAKSKVDALTAKIS----ELEASLKESQD 584



Score = 44.3 bits (103), Expect = 0.006
Identities = 50/185 (27%), Positives = 85/185 (45%), Gaps = 22/185 (11%)
Frame = +3

Query: 6 DLEASSKEIDAA-NAQISTLFEELKVTKESNEQ----LEKKILDAQKEAGSIV------- 149
+LEAS KE + A+ + E L+ + S+ LEK++ DA+ EA +
Sbjct: 994 ELEASLKETTSKLEAKETEHSESLQAAQSSSNDKIAALEKELADAKAEASKVAELEAKLA 1053

Query: 150 ---NSLKEALKHEQSVSS----NLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLK 308
+ EAL+ QS + +L K+L LE +KK ++E+ K + + + K
Sbjct: 1054 AKESEHSEALQTAQSSGNEKVASLEKDLAAAEQSLEETKKAKEAVDEELKATKEAEAEAK 1113

Query: 309 KELAKSENSARAMETALEEER---EVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKL 479
+ AK A +E+ L E + E S + K +LE K+ ++ + L VE AK
Sbjct: 1114 ETAAK----ASTLESELAELKISTEKSTAEKSELEEKLKA---SETKVTELEASVEAAKA 1166

Query: 480 ESEKL 494
+ +L
Sbjct: 1167 KESEL 1171



Score = 40.4 bits (93), Expect = 0.089
Identities = 36/182 (19%), Positives = 80/182 (43%), Gaps = 8/182 (4%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQ 182
+DLE + + + E V +E + +KI D KEA + ++ E +
Sbjct: 225 KDLEEHMVSVVVQQVREAKAKERNTVREECEAEFNEKIADITKEAEGLRGTVSEL----E 280

Query: 183 SVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALE 362
+ ++ + E+EK+ ++ + + + S +LEA +L A+ + A +
Sbjct: 281 AQIASYKDEIEKLKGIIDSHQAAGTESADNSAELEAKEAELSTAKAQLDELTAAKSNTEK 340

Query: 363 EEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLES--------EKLIKEVKDLE 518
E + A+ ++ S+ ++A+A + +D +K K+E + I E+++L+
Sbjct: 341 ELADALATIEELKSQSQDTVAKADLDALAADRDAQKTKVEEFVAEVAILKSQISELEELK 400

Query: 519 RK 524
K
Sbjct: 401 SK 402


>tr|B6W6V0|B6W6V0_9FIRM Putative uncharacterized protein
OS=Anaerococcus hydrogenalis DSM 7454 GN=ANHYDRO_00284
PE=4 SV=1
Length = 684

Score = 70.1 bits (170), Expect = 1e-10
Identities = 44/173 (25%), Positives = 90/173 (52%), Gaps = 4/173 (2%)
Frame = +3

Query: 18 SSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSN 197
+ ++I+ A Q + L E KE+ E+ EK ++++ A V L+++ + Q+
Sbjct: 427 AERKIEEAKDQANNLVEAANQAKENAEKAEKLAKESEQAAKDKVKELEKSNQASQAEKEK 486

Query: 198 LRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKS----ENSARAMETALEE 365
+K+LEK +DLE + KE + +++KD +A ++ K+ L K+ EN + E +E
Sbjct: 487 AQKDLEKAQTDLEQANKEKEKVEKEAKDAKAQAQEAKESLEKAQENIENLKKEKENLTKE 546

Query: 366 EREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERK 524
+ E+ + EA++K+ AEA + + KA+ +E+ K+ + + +
Sbjct: 547 KSEIENQLAEAKEAAKKAQAEASE----ANKKANKAQTSAEEANKKAQQAQEE 595



Score = 69.3 bits (168), Expect = 2e-10
Identities = 52/171 (30%), Positives = 84/171 (49%), Gaps = 4/171 (2%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSL---KEALK 173
++ E KE A AQ E L+ +E+ E L+K+ + KE I N L KEA K
Sbjct: 503 KEKEKVEKEAKDAKAQAQEAKESLEKAQENIENLKKEKENLTKEKSEIENQLAEAKEAAK 562

Query: 174 HEQSVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENS-ARAME 350
Q+ +S K+ K + E + K+A E++ + E+ K + KSE A+A
Sbjct: 563 KAQAEASEANKKANKAQTSAEEANKKAQQAQEEANKAKTEAEEAKADKTKSEEEKAKAQA 622

Query: 351 TALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKE 503
A E ER+ K E ++KS+ EA+ + ++ KAK E++K+ +E
Sbjct: 623 KAEEAERKAQEEIAKAKEEAQKSVKEAQTAAETAKEAEVKAK-EAQKVAEE 672



Score = 63.9 bits (154), Expect = 8e-09
Identities = 48/180 (26%), Positives = 89/180 (49%), Gaps = 14/180 (7%)
Frame = +3

Query: 12 EASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVS 191
+AS E + A + +L+ + E++EK+ DA+ +A KE+L+ Q
Sbjct: 478 QASQAEKEKAQKDLEKAQTDLEQANKEKEKVEKEAKDAKAQA----QEAKESLEKAQENI 533

Query: 192 SNLRKELEKVTSDL-----------ELSKK---EASLLNEQSKDLEASLEQLKKELAKSE 329
NL+KE E +T + E +KK EAS N+++ + S E+ K+ +++
Sbjct: 534 ENLKKEKENLTKEKSEIENQLAEAKEAAKKAQAEASEANKKANKAQTSAEEANKKAQQAQ 593

Query: 330 NSARAMETALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVK 509
A +T EE + A K E K+ A+A++ + ++++ KAK E++K +KE +
Sbjct: 594 EEANKAKTEAEEAK---ADKTKSEEEKAKAQAKAEEAERKAQEEIAKAKEEAQKSVKEAQ 650



Score = 56.2 bits (134), Expect = 2e-06
Identities = 48/193 (24%), Positives = 95/193 (49%), Gaps = 18/193 (9%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQ 182
+++E K+I A I L EL+ K+S ++ + + ++ EA + A + +
Sbjct: 306 KEIEELKKQIKEKEAVIKRLQSELEEAKKSAQKSKDALEKSKSEAQAANEKANAAQEKAK 365

Query: 183 SVSSNL---RKELEKVTSDLELSKKEASLLNEQSKDLEAS-LEQLKKELA---KSENSAR 341
+ NL +K+ E+ E +KK+ASL ++ K+ E +E KE A ++E + +
Sbjct: 366 KAAENLEAAQKDAEEAKRQAEEAKKDASLSKQEKKEAEEKVIEAQTKEKAARLEAEKAKK 425

Query: 342 AMETALEEERE-----VSASN------KKQLEASRKSIAEAKDNIKLLRQDVEKAKLESE 488
E +EE ++ V A+N +K + +++S AKD +K L + + ++ E E
Sbjct: 426 DAERKIEEAKDQANNLVEAANQAKENAEKAEKLAKESEQAAKDKVKELEKSNQASQAEKE 485

Query: 489 KLIKEVKDLERKL 527
K K+++ + L
Sbjct: 486 KAQKDLEKAQTDL 498



Score = 52.0 bits (123), Expect = 3e-05
Identities = 25/87 (28%), Positives = 56/87 (64%)
Frame = +3

Query: 243 KKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSASNKKQLEASRKSI 422
KKE L +Q K+ EA +++L+ EL +++ SA+ + ALE+ + + + ++ A+++
Sbjct: 305 KKEIEELKKQIKEKEAVIKRLQSELEEAKKSAQKSKDALEKSKSEAQAANEKANAAQEKA 364

Query: 423 AEAKDNIKLLRQDVEKAKLESEKLIKE 503
+A +N++ ++D E+AK ++E+ K+
Sbjct: 365 KKAAENLEAAQKDAEEAKRQAEEAKKD 391



Score = 43.5 bits (101), Expect = 0.011
Identities = 21/87 (24%), Positives = 47/87 (54%)
Frame = +3

Query: 264 NEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSASNKKQLEASRKSIAEAKDNI 443
+ Q +DL+ +E+LKK++ + E + +++ LEE ++ + +K LE S+ A +
Sbjct: 298 DNQYEDLKKEIEELKKQIKEKEAVIKRLQSELEEAKKSAQKSKDALEKSKSEAQAANEKA 357

Query: 444 KLLRQDVEKAKLESEKLIKEVKDLERK 524
++ +KA E K+ ++ +R+
Sbjct: 358 NAAQEKAKKAAENLEAAQKDAEEAKRQ 384


>tr|Q2SR11|Q2SR11_MYCCT Membrane protein, putative OS=Mycoplasma
capricolum subsp. capricolum (strain California kid /
ATCC 27343 / NCTC 10154) GN=MCAP_0860 PE=4 SV=1
Length = 752

Score = 69.7 bits (169), Expect = 1e-10
Identities = 47/161 (29%), Positives = 87/161 (54%), Gaps = 3/161 (1%)
Frame = +3

Query: 60 LFEELKVTKESNEQLEKKILDAQKEAGSI---VNSLKEALKHEQSVSSNLRKELEKVTSD 230
L E+LK +E ++ KI + +K ++ L++ +K ++ +S+ +KEL +
Sbjct: 312 LKEQLKSKQEKLTTIKSKISENEKAISEFTEQISILEKEVKDLENDNSSKQKELNEKHQQ 371

Query: 231 LELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSASNKKQLEAS 410
LEL KKE ++ K+LE+ + L+ ++ K E + +T +EE +E +K++E
Sbjct: 372 LELVKKENDSKKQEIKNLESQINSLELKIKKQEVDTQIFDTEIEEAQESKLVIEKEIEKL 431

Query: 411 RKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERKLGV 533
+ IA+ KD IK L++ +L+ EKL DL+ +L V
Sbjct: 432 KSEIAKNKDTIKDLKEQDYVFELKYEKLDSLRDDLKTQLKV 472



Score = 49.3 bits (116), Expect = 2e-04
Identities = 43/204 (21%), Positives = 93/204 (45%), Gaps = 31/204 (15%)
Frame = +3

Query: 9 LEASSKEIDAANA----QISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEA--- 167
LE K+++ N+ +++ ++L++ K+ N+ +++I + + + S+ +K+
Sbjct: 347 LEKEVKDLENDNSSKQKELNEKHQQLELVKKENDSKKQEIKNLESQINSLELKIKKQEVD 406

Query: 168 -------LKHEQSVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKS 326
++ Q + KE+EK+ S++ +K L EQ E E+L
Sbjct: 407 TQIFDTEIEEAQESKLVIEKEIEKLKSEIAKNKDTIKDLKEQDYVFELKYEKLDSLRDDL 466

Query: 327 ENSARAMETALEEEREVSASNKKQLEASRKSIAEAKDNIK--------------LLRQDV 464
+ + E ++++ ++ K++L++ + I + D +K LL+ +V
Sbjct: 467 KTQLKVFEISIKKTKQNLEKTKQELKSKEQEIKKFNDEVKKIDQENKELNKQISLLKNNV 526

Query: 465 EKA---KLESEKLIKEVKDLERKL 527
EK KLE E +E K LE K+
Sbjct: 527 EKLESEKLEKE---QEFKQLESKI 547



Score = 48.5 bits (114), Expect = 3e-04
Identities = 32/169 (18%), Positives = 84/169 (49%)
Frame = +3

Query: 21 SKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNL 200
+ +I+ AQ + L + + + +L+ KIL+ QK+ L+ + +
Sbjct: 217 TSQINELKAQNNKLESQKDLENKKFSELQTKILEVQKQ-----------LEDTKVQQPKI 265

Query: 201 RKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVS 380
+ +LE+ S ++ + + L ++ K LE+ ++ L + K + + ++ L+ ++E
Sbjct: 266 KTQLEEKESQIKQNNTKIDNLTKEFKQLESQIQNLNNQ--KKQGWNKELKEQLKSKQEKL 323

Query: 381 ASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERKL 527
+ K ++ + K+I+E + I +L ++V+ + ++ KE+ + ++L
Sbjct: 324 TTIKSKISENEKAISEFTEQISILEKEVKDLENDNSSKQKELNEKHQQL 372



Score = 48.5 bits (114), Expect = 3e-04
Identities = 43/163 (26%), Positives = 79/163 (48%)
Frame = +3

Query: 24 KEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNLR 203
KEI+ ++I+ + +K KE + E K ++ S+ + LK LK + +
Sbjct: 426 KEIEKLKSEIAKNKDTIKDLKEQDYVFELKY----EKLDSLRDDLKTQLKVFEISIKKTK 481

Query: 204 KELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSA 383
+ LEK +L+ ++E N++ K ++Q KEL K + + LE E+
Sbjct: 482 QNLEKTKQELKSKEQEIKKFNDEVK----KIDQENKELNKQISLLKNNVEKLESEKLEKE 537

Query: 384 SNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKD 512
KQLE+ I E K N L ++++EK + +K I+++K+
Sbjct: 538 QEFKQLES---KINEMKSN--LTKEELEKEIQQKQKEIEQLKE 575



Score = 45.4 bits (106), Expect = 0.003
Identities = 41/150 (27%), Positives = 76/150 (50%), Gaps = 9/150 (6%)
Frame = +3

Query: 24 KEIDAANAQISTLFEELK--VTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSN 197
K+ID N +++ LK V K +E+LEK+ K+ S +N +K L E+
Sbjct: 506 KKIDQENKELNKQISLLKNNVEKLESEKLEKE--QEFKQLESKINEMKSNLTKEE----- 558

Query: 198 LRKELEKVTSDLE-LSKKEASLLNEQS------KDLEASLEQLKKELAKSENSARAMETA 356
L KE+++ ++E L + SLL Q+ K+ E ++++ ELAK + ++
Sbjct: 559 LEKEIQQKQKEIEQLKENYNSLLASQTEFDQLVKEYEFERKKIRSELAKK----IILSSS 614

Query: 357 LEEEREVSASNKKQLEASRKSIAEAKDNIK 446
+E+E E K++E+ K++ + K +K
Sbjct: 615 IEDEIESVNKENKEIESQIKTVLKKKHTLK 644



Score = 39.7 bits (91), Expect = 0.15
Identities = 35/145 (24%), Positives = 67/145 (46%)
Frame = +3

Query: 90 SNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNLRKELEKVTSDLELSKKEASLLNE 269
SN E+K+L+ + S++ LK+ + NL EK ++ E KK LN+
Sbjct: 30 SNNTKEQKMLNK-------IQSIRNDLKNREQELRNL----EKYLNEKESRKK---YLND 75

Query: 270 QSKDLEASLEQLKKELAKSENSARAMETALEEEREVSASNKKQLEASRKSIAEAKDNIKL 449
Q K LEA++ L + S++ + + L + + +K+ + I + + I+
Sbjct: 76 QIKTLEANISDLNNKDKISKSKIDKLNSDLLKLNDELNLDKQNILTKESEINKLEKQIRE 135

Query: 450 LRQDVEKAKLESEKLIKEVKDLERK 524
+++ + K E K +E+K L K
Sbjct: 136 IKETLNKTSTEILKKEQELKSLTNK 160


>tr|A2EJ43|A2EJ43_TRIVA Viral A-type inclusion protein, putative
OS=Trichomonas vaginalis G3 GN=TVAG_139760 PE=4 SV=1
Length = 940

Score = 69.7 bits (169), Expect = 1e-10
Identities = 51/175 (29%), Positives = 91/175 (52%), Gaps = 3/175 (1%)
Frame = +3

Query: 9 LEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSV 188
L+ +EID N QI + +E K+ E+ +K+ QKE E LK E
Sbjct: 632 LQEKDEEIDGLNEQIEQIIKENNDLKQKQEENQKENEQKQKE--------NEDLKKEVD- 682

Query: 189 SSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEE 368
+L +E+EK+ + S+KE +N + ++L+ +E+LKKE+ E + E +EE
Sbjct: 683 --DLTQEIEKLEE--QKSQKEEENVNSEQENLQKQIEELKKEV---EQYKKQNEDLIEEN 735

Query: 369 REVSASNK---KQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERK 524
E+ K KQ+E +++ E+ + I L++D+E A+ E E+++K ++ K
Sbjct: 736 EEMDEKMKILQKQIEEIKETNEESSEQIYALKKDLEIAEQEKERIVKMEREQNMK 790



Score = 61.6 bits (148), Expect = 4e-08
Identities = 41/164 (25%), Positives = 87/164 (53%)
Frame = +3

Query: 12 EASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVS 191
E + KEID +I + ++L ++ N+ L+K+ + QKE V+ +K+ + Q+
Sbjct: 390 EKNQKEIDDLTQEIEEINQKLDEKQKENDDLKKEKENLQKE----VDEIKKNFEENQNQI 445

Query: 192 SNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEER 371
NL+KE + + + S +E ++ ++++ + E+ +KE+ M L+E++
Sbjct: 446 ENLQKENDDLKKGMNQSSEEK---QKEIEEIKKNFEEKQKEIDDLTQENEEMNQKLDEKQ 502

Query: 372 EVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKE 503
+ K+++E ++K + K ++ L Q++E KLE +K KE
Sbjct: 503 KEIEEIKQKIEENQKQNVDLKKEVEDLTQEIE--KLEEQKSQKE 544



Score = 59.3 bits (142), Expect = 2e-07
Identities = 41/190 (21%), Positives = 99/190 (52%), Gaps = 18/190 (9%)
Frame = +3

Query: 12 EASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGS---IVNSLKEALKHEQ 182
E K+ D+A + L +E + K+ N ++ +KI + QKE G V LK+ ++
Sbjct: 326 ELLKKDSDSAQEE---LMKENENLKKENGEITEKIEELQKEIGERQKTVEDLKQKIEEIN 382

Query: 183 SVSS-----------NLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSE 329
S ++ +L +E+E++ L+ +KE L ++ ++L+ ++++KK +++
Sbjct: 383 SQNAEESEKNQKEIDDLTQEIEEINQKLDEKQKENDDLKKEKENLQKEVDEIKKNFEENQ 442

Query: 330 NSARAMETALEEER----EVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLI 497
N ++ ++ + + S +K++E +K+ E + I L Q+ E+ + ++
Sbjct: 443 NQIENLQKENDDLKKGMNQSSEEKQKEIEEIKKNFEEKQKEIDDLTQENEEMNQKLDEKQ 502

Query: 498 KEVKDLERKL 527
KE++++++K+
Sbjct: 503 KEIEEIKQKI 512



Score = 58.9 bits (141), Expect = 2e-07
Identities = 47/194 (24%), Positives = 91/194 (46%), Gaps = 19/194 (9%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVTKESNEQLEKK-----------ILDAQKEAGSIV 149
+ E EI+ QI L +++ K NE L+K+ I D QKE
Sbjct: 24 KQTEEKETEINELMNQIEDLQKQIDEIKNQNENLQKEKENSLNEMNKQIDDLQKEKEETE 83

Query: 150 NSLKEALKHEQSVSSNLRKELEKVTSD----LELSKKEASLLNEQSKDLEASLEQLKKEL 317
+L E + ++ S L+K++E + ++ +E KKE N + KDL+ +E LKK +
Sbjct: 84 KALIEENEDYKNQLSELKKQIEDLQNENEEKVENLKKENEEFNNEIKDLQDQIELLKKSM 143

Query: 318 AKSENSAR----AMETALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLES 485
++SE+ + + +E+ ++ + K ++ + I + K L + K +
Sbjct: 144 SESEDKDQKFVIELNQQIEKLKQKVSDEKDLIQVKDEEIIDLKQKNTDLSEQNNKLNEDK 203

Query: 486 EKLIKEVKDLERKL 527
+L K++++L +KL
Sbjct: 204 NELEKQIEELAQKL 217



Score = 57.4 bits (137), Expect = 7e-07
Identities = 38/175 (21%), Positives = 90/175 (51%), Gaps = 2/175 (1%)
Frame = +3

Query: 9 LEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSV 188
+ ++EID A + +L E NE+L + + + ++ V ++ K + +
Sbjct: 262 ISQKTREIDEAETAKEDISLKLDNLAEENEKLSQNLSEIYEKLNEKVTETEKLQKENEDL 321

Query: 189 SSNLRKELEKVTSDL--ELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALE 362
S EL K SD E KE L +++ ++ +E+L+KE+ + + + ++ +E
Sbjct: 322 KSE--NELLKKDSDSAQEELMKENENLKKENGEITEKIEELQKEIGERQKTVEDLKQKIE 379

Query: 363 EEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERKL 527
E+++ N ++ E ++K I + I+ + Q +++ + E++ L KE ++L++++
Sbjct: 380 ---EINSQNAEESEKNQKEIDDLTQEIEEINQKLDEKQKENDDLKKEKENLQKEV 431



Score = 53.9 bits (128), Expect = 8e-06
Identities = 42/175 (24%), Positives = 85/175 (48%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQ 182
++ E KEID +T+E NE++ +K+ + QKE + +K+ ++ Q
Sbjct: 475 KNFEEKQKEID-------------DLTQE-NEEMNQKLDEKQKE----IEEIKQKIEENQ 516

Query: 183 SVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALE 362
+ +L+KE+E +T ++E +++ S ++ +++ + E L+K++ + +N + LE
Sbjct: 517 KQNVDLKKEVEDLTQEIEKLEEQKS---QKEENVNSEQENLQKQIEELKNEKETISNELE 573

Query: 363 EEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERKL 527
+ + + L+ K AE I+ L Q E E LI V DL+ +
Sbjct: 574 SKTKHNEKLVSSLQEFAKKNAELDITIERLTQ-------EKEVLINNVNDLQNNV 621



Score = 52.8 bits (125), Expect = 2e-05
Identities = 32/174 (18%), Positives = 82/174 (47%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQ 182
++++ ++EI+ N ++ +E K+ E L+K++ + +K N ++ K
Sbjct: 394 KEIDDLTQEIEEINQKLDEKQKENDDLKKEKENLQKEVDEIKKNFEENQNQIENLQKEND 453

Query: 183 SVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALE 362
+ + + E+ ++E KK ++ DL E++ ++L + + ++ +E
Sbjct: 454 DLKKGMNQSSEEKQKEIEEIKKNFEEKQKEIDDLTQENEEMNQKLDEKQKEIEEIKQKIE 513

Query: 363 EEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERK 524
E ++ + KK++E + I + ++ Q E E E L K++++L+ +
Sbjct: 514 ENQKQNVDLKKEVEDLTQEIEKLEEQ---KSQKEENVNSEQENLQKQIEELKNE 564



Score = 50.8 bits (120), Expect = 7e-05
Identities = 42/179 (23%), Positives = 91/179 (50%), Gaps = 5/179 (2%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQS 185
DL+ +EI++ NA E +E+ +K+I D +E + + + L +Q
Sbjct: 373 DLKQKIEEINSQNA-------------EESEKNQKEIDDLTQE----IEEINQKLDEKQK 415

Query: 186 VSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKEL-AKSENSARAMETAL- 359
+ +L+KE E + +++ KK Q ++L+ + LKK + SE + +E
Sbjct: 416 ENDDLKKEKENLQKEVDEIKKNFEENQNQIENLQKENDDLKKGMNQSSEEKQKEIEEIKK 475

Query: 360 ---EEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERKL 527
E+++E+ ++ E ++K + E + I+ ++Q +E+ + ++ L KEV+DL +++
Sbjct: 476 NFEEKQKEIDDLTQENEEMNQK-LDEKQKEIEEIKQKIEENQKQNVDLKKEVEDLTQEI 533



Score = 49.7 bits (117), Expect = 1e-04
Identities = 39/174 (22%), Positives = 81/174 (46%), Gaps = 24/174 (13%)
Frame = +3

Query: 66 EELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNLRKELEKV---TSD-- 230
E+++ K+ NE+ +I D Q + + S+ E+ +Q L +++EK+ SD
Sbjct: 113 EKVENLKKENEEFNNEIKDLQDQIELLKKSMSESEDKDQKFVIELNQQIEKLKQKVSDEK 172

Query: 231 ----------LELSKKEASL------LNEQSKDLEASLEQLKKELAKSENSARAMETALE 362
++L +K L LNE +LE +E+L ++L+ + + E
Sbjct: 173 DLIQVKDEEIIDLKQKNTDLSEQNNKLNEDKNELEKQIEELAQKLSDESEKEKLKQEINE 232

Query: 363 EEREVSASNK---KQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDL 515
+ E S K K+LE + + E +D+I +++++A+ E + ++ +L
Sbjct: 233 LKSEKENSEKDFNKKLENLTQKVTELEDSISQKTREIDEAETAKEDISLKLDNL 286



Score = 47.4 bits (111), Expect = 7e-04
Identities = 53/223 (23%), Positives = 106/223 (47%), Gaps = 53/223 (23%)
Frame = +3

Query: 24 KEIDAANAQISTLFEELKVTKESN-----EQLEKKILDAQKEAGSIVNSLKEALKHEQSV 188
KE++ +I L EE K KE N E L+K+I + + E +I N L+ KH + +
Sbjct: 524 KEVEDLTQEIEKL-EEQKSQKEENVNSEQENLQKQIEELKNEKETISNELESKTKHNEKL 582

Query: 189 SSNLRKELEKVTSDLE-----LSKKEASLLNE-------------------QSKD----- 281
S+L+ E K ++L+ L++++ L+N Q KD
Sbjct: 583 VSSLQ-EFAKKNAELDITIERLTQEKEVLINNVNDLQNNVDAEIRDLKVKLQEKDEEIDG 641

Query: 282 LEASLEQL---------KKELAKSENSARAMETA-LEEE-----REVSASNKKQLEASRK 416
L +EQ+ K+E + EN + E L++E +E+ +++ + +
Sbjct: 642 LNEQIEQIIKENNDLKQKQEENQKENEQKQKENEDLKKEVDDLTQEIEKLEEQKSQKEEE 701

Query: 417 SIAEAKDN----IKLLRQDVEKAKLESEKLIKEVKDLERKLGV 533
++ ++N I+ L+++VE+ K ++E LI+E ++++ K+ +
Sbjct: 702 NVNSEQENLQKQIEELKKEVEQYKKQNEDLIEENEEMDEKMKI 744


>tr|A1C6F5|A1C6F5_ASPCL Nuclear condensin complex subunit Smc2,
putative OS=Aspergillus clavatus GN=ACLA_070070 PE=4 SV=1
Length = 1235

Score = 68.2 bits (165), Expect = 4e-10
Identities = 46/174 (26%), Positives = 91/174 (52%), Gaps = 5/174 (2%)
Frame = +3

Query: 9 LEASSKEIDAANA---QISTLFEELKVTKES-NEQLEKKILDAQKEAGSIVNSLKEALKH 176
+ K++DA A ++ E+K+T+E + I+ A +E + + LK+ +
Sbjct: 760 MRKEKKKLDAVRAIKQELDLKTHEIKLTEEQISNNSSSSIIHAVEEMKTNIEQLKKDISD 819

Query: 177 EQSVSSNLRKELEKVTSDL-ELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMET 353
++ S K+++++ D+ E + + S L E L+ASL+ LKK LAK+ NS +A++
Sbjct: 820 AKTRQSEATKDIKRIEKDMSEFNNNKDSKLAE----LQASLDSLKKSLAKNSNSVKALQK 875

Query: 354 ALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDL 515
L+ R S L A+ + A+A++ +K ++++ K E + IK+ D+
Sbjct: 876 ELQNSRLESEQVGSDLSAAEEQYADAENTLKAQMEEIQSMKREQAR-IKDAHDI 928



Score = 42.4 bits (98), Expect = 0.023
Identities = 37/173 (21%), Positives = 76/173 (43%), Gaps = 7/173 (4%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQS 185
++E K+I A + S +++K ++ + E + ++SLK++L +
Sbjct: 809 NIEQLKKDISDAKTRQSEATKDIKRIEKDMSEFNNNKDSKLAELQASLDSLKKSLAKNSN 868

Query: 186 VSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASL-------EQLKKELAKSENSARA 344
L+KEL+ + E + S EQ D E +L + +K+E A+ +++
Sbjct: 869 SVKALQKELQNSRLESEQVGSDLSAAEEQYADAENTLKAQMEEIQSMKREQARIKDAHDI 928

Query: 345 METALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKE 503
+ LE+ER ++L +++ I +++K + EKL KE
Sbjct: 929 AQAQLEDERAKLTGFDEELRELEEAMHSKNSRITEEGLEMQKLGHQLEKLQKE 981


>tr|Q5AFC4|Q5AFC4_CANAL Putative uncharacterized protein SLK19
OS=Candida albicans GN=SLK19 PE=4 SV=1
Length = 811

Score = 67.8 bits (164), Expect = 5e-10
Identities = 56/198 (28%), Positives = 92/198 (46%), Gaps = 28/198 (14%)
Frame = +3

Query: 18 SSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSN 197
SS + D + L E + + N++LE + + + + ++ + LK + + + N
Sbjct: 526 SSSKYDKLKDEYEDLSERNQTLVDDNKRLETEKFELEDRTKKL-ETVNQKLKDDNTNNEN 584

Query: 198 LRKELEKVTSDL--ELSKKEASLLNEQSK------DLEASLEQLKKELAKSENSARAMET 353
L KE EKV + EL + S + E SK DLE +E LK++ E + + +E+
Sbjct: 585 LIKEYEKVATSRIEELESERDSTIEEISKHKQIVHDLETQVENLKQQYNDKEKTNKELES 644

Query: 354 ALEEEREVSASNKKQLEASRKSIAEAK--------------------DNIKLLRQDVEKA 473
+EE S SN + E RK A+ K D+IK L+++ E
Sbjct: 645 RIEELESKSVSNDELQELKRKIDAKDKEIETKEKTIEDYLSKMDDLVDHIKPLKKENEDL 704

Query: 474 KLESEKLIKEVKDLERKL 527
K E +KLI+EV L+ KL
Sbjct: 705 KQEQQKLIQEVSSLKDKL 722



Score = 34.3 bits (77), Expect = 6.4
Identities = 31/138 (22%), Positives = 58/138 (42%), Gaps = 26/138 (18%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKE------ 164
+++E K I+ +++ L + +K K+ NE L+++ +E S+ + L++
Sbjct: 671 KEIETKEKTIEDYLSKMDDLVDHIKPLKKENEDLKQEQQKLIQEVSSLKDKLEKSKIQAD 730

Query: 165 --------------ALKHEQSV------SSNLRKELEKVTSDLELSKKEASLLNEQSKDL 284
A KH + + + L +ELE LE + KEA LL+E+
Sbjct: 731 EDLDKLSKYLYAEYAAKHIKKLEGIIKENKKLERELEFYKMKLEKANKEAELLSERKVSS 790

Query: 285 EASLEQLKKELAKSENSA 338
+ K A +N A
Sbjct: 791 SSKTALSPKITAAPKNRA 808


>tr|A2DDX5|A2DDX5_TRIVA Viral A-type inclusion protein, putative
OS=Trichomonas vaginalis G3 GN=TVAG_199400 PE=4 SV=1
Length = 1794

Score = 67.4 bits (163), Expect = 7e-10
Identities = 48/177 (27%), Positives = 89/177 (50%), Gaps = 5/177 (2%)
Frame = +3

Query: 12 EASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVS 191
E + KE+ + Q+STL EEL +K+ E LE+KI + +K V SL+E LK ++
Sbjct: 967 EQNEKELQS---QLSTLNEELSTSKKMIETLEEKISNNEKSDNEKVLSLEEQLKESKNSI 1023

Query: 192 SNLRKELEKVTSDLELSKKEAS----LLNEQSKDLEASLEQLKKELAKSENSARAMETAL 359
S+L+++L+ +E +K S NE+ K L L ++ + +N ++++ L
Sbjct: 1024 SSLQEQLKSSQQTIENLEKNISEKSETYNEKIKSLTDELSTIQNKNENLQNEIKSLQEKL 1083

Query: 360 EEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLES-EKLIKEVKDLERKL 527
+ K E S+ + DN+K D++K+ E+ E ++K++ + L
Sbjct: 1084 SNNEKNDNEKVKLYEEQLNSLKKENDNLKQEMSDIQKSDNETFENYQNQIKEMMQNL 1140



Score = 59.7 bits (143), Expect = 1e-07
Identities = 46/179 (25%), Positives = 92/179 (51%), Gaps = 5/179 (2%)
Frame = +3

Query: 12 EASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVS 191
E + KE+ + Q+STL EEL +K+ E LE+KI + +K V S +E L +
Sbjct: 772 EQNEKELQS---QLSTLNEELSTSKKMIETLEEKISNNEKNGDEKVKSYEEQLNSYR--- 825

Query: 192 SNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEER 371
N EL+++T + ++++ L Q+KDL+ + +K + E S A L+++
Sbjct: 826 -NTINELQQIT---QSNEEKIKSLESQNKDLQEKISLSEKSESDKEKSYEAQLNNLKQQA 881

Query: 372 EVSASN-KKQLEASRKSIAEAKDN----IKLLRQDVEKAKLESEKLIKEVKDLERKLGV 533
+ S+ +Q+E+ ++ I+ + N + +++ + +E L EV+ L+ K+ +
Sbjct: 882 QNHISSLNQQIESLKQEISSIQQNDNETFTNYQNQIKEMMINNENLQNEVQSLQEKISL 940



Score = 55.5 bits (132), Expect = 3e-06
Identities = 48/183 (26%), Positives = 92/183 (50%), Gaps = 17/183 (9%)
Frame = +3

Query: 24 KEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNL- 200
++I++ Q+S EEL+ +KE E L K+ + E + L++ L +S+ L
Sbjct: 1205 EKINSLTKQVSDKDEELQKSKEEIESLNHKVTSNEAEKQKVAEDLQQKLSEIESLKQKLT 1264

Query: 201 --RKELEKVT------SDL--ELSKKEASLLNEQS--KDLEASLEQLKKELAKSENSARA 344
+++KVT DL ++S+KE + + Q ++L L +LK++ SE
Sbjct: 1265 EKENDVQKVTEQNKSIEDLKQQISEKEKVITDNQKTIENLSFELTELKQKKDDSEKDKEI 1324

Query: 345 METALEEEREVSA---SNKKQLEASRKSI-AEAKDNIKLLRQDVEKAKLESEKLIKEVKD 512
++ ++ ++ A S +K+ + R + E +DN + L + VE AK+ SE+ K K
Sbjct: 1325 IQNLTKDLEKMKADLDSKQKENDEIRSRLNREIEDNKQALAKAVETAKILSEENEKLTKQ 1384

Query: 513 LER 521
+E+
Sbjct: 1385 MEQ 1387



Score = 49.7 bits (117), Expect = 1e-04
Identities = 45/201 (22%), Positives = 96/201 (47%), Gaps = 26/201 (12%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLF----EELKVTKESNEQLEKKILDAQ-------KEAGSIV 149
+ +E+ +EI + + F ++K +NE L+ ++ Q K V
Sbjct: 890 QQIESLKQEISSIQQNDNETFTNYQNQIKEMMINNENLQNEVQSLQEKISLNEKSDNEKV 949

Query: 150 NSLKEALKHEQSVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSE 329
SL+E L + +++ +N + +++ S L S LNE+ + +E L+++++ +E
Sbjct: 950 LSLEEQLNNSKNMITNYEQNEKELQSQL-------STLNEELSTSKKMIETLEEKISNNE 1002

Query: 330 NS----ARAMETALEEEREVSASNKKQLEASRKSIAEAKDN-----------IKLLRQDV 464
S ++E L+E + +S ++QL++S+++I + N IK L ++
Sbjct: 1003 KSDNEKVLSLEEQLKESKNSISSLQEQLKSSQQTIENLEKNISEKSETYNEKIKSLTDEL 1062

Query: 465 EKAKLESEKLIKEVKDLERKL 527
+ ++E L E+K L+ KL
Sbjct: 1063 STIQNKNENLQNEIKSLQEKL 1083



Score = 48.5 bits (114), Expect = 3e-04
Identities = 42/197 (21%), Positives = 95/197 (48%), Gaps = 31/197 (15%)
Frame = +3

Query: 24 KEIDAANAQISTLFEELKVTKESNEQ----LEKKILDAQKE----------AGSIVNSLK 161
+ ++ A ++STL E++ + ++S+ + E KI +E A IV++ +
Sbjct: 1138 QNLEEAENKVSTLQEQISMNEKSDSEKVTSYEAKIAQMHQEKKELEKKFTAAKQIVSNNR 1197

Query: 162 EALKHEQSVSSNLRKELEKVTSDLELSKKEASLLNEQ-----------SKDLEASL---E 299
+ K + ++L K++ +L+ SK+E LN + ++DL+ L E
Sbjct: 1198 QEKKEMEEKINSLTKQVSDKDEELQKSKEEIESLNHKVTSNEAEKQKVAEDLQQKLSEIE 1257

Query: 300 QLKKELAKSENSARAM---ETALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEK 470
LK++L + EN + + ++E+ ++ + +K + ++K+I + L+Q +
Sbjct: 1258 SLKQKLTEKENDVQKVTEQNKSIEDLKQQISEKEKVITDNQKTIENLSFELTELKQKKDD 1317

Query: 471 AKLESEKLIKEVKDLER 521
++ + E + KDLE+
Sbjct: 1318 SEKDKEIIQNLTKDLEK 1334



Score = 46.6 bits (109), Expect = 0.001
Identities = 37/179 (20%), Positives = 83/179 (46%), Gaps = 6/179 (3%)
Frame = +3

Query: 9 LEASSKEIDAANAQISTLFEELKVTKES-NEQLEKKILDAQKEAGSIVNSLKEALKHEQS 185
L +++E + +S ++L+ K+ N+ E KI + Q+ + + +K
Sbjct: 509 LNQTNQEKEKQFEDLSQKLKQLEAEKQKLNDDYESKINEIQQNDNETFTNYQNQIKEMMI 568

Query: 186 VSSNLRKELEKVTSDLELSKKEAS----LLNEQSKDLEASLEQLKKELAKSENSARAMET 353
+ NL+ E + + + L++K + L EQ K+ + S+ L+++L S+ + +E
Sbjct: 569 NNENLQNENKSLQEKISLNEKSDNEKVLSLEEQLKESKNSISSLQEQLKSSQQTIENLEK 628

Query: 354 ALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKE-VKDLERKL 527
+ E+ E K L +I +N++ + +++ +EK E + +LE +L
Sbjct: 629 NISEKSETYNEKIKSLTDELSTIQNTNENLQNEIKSLQEKLSNNEKNDNEKILNLEEQL 687



Score = 46.6 bits (109), Expect = 0.001
Identities = 44/191 (23%), Positives = 87/191 (45%), Gaps = 32/191 (16%)
Frame = +3

Query: 42 NAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIV----NSLKEALKH----------- 176
N ++ E+L K+ N+ L++++ D QK N +KE +++
Sbjct: 1091 NEKVKLYEEQLNSLKKENDNLKQEMSDIQKSDNETFENYQNQIKEMMQNLEEAENKVSTL 1150

Query: 177 EQSVSSNLRKELEKVTS------DLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSA 338
++ +S N + + EKVTS + KKE +K + ++ Q KKE+ + NS
Sbjct: 1151 QEQISMNEKSDSEKVTSYEAKIAQMHQEKKELEKKFTAAKQIVSNNRQEKKEMEEKINSL 1210

Query: 339 RAMETALEEE-----REVSASNKK--QLEASRKSIAE----AKDNIKLLRQDVEKAKLES 485
+ +EE E+ + N K EA ++ +AE I+ L+Q + + + +
Sbjct: 1211 TKQVSDKDEELQKSKEEIESLNHKVTSNEAEKQKVAEDLQQKLSEIESLKQKLTEKENDV 1270

Query: 486 EKLIKEVKDLE 518
+K+ ++ K +E
Sbjct: 1271 QKVTEQNKSIE 1281



Score = 43.5 bits (101), Expect = 0.011
Identities = 42/206 (20%), Positives = 93/206 (45%), Gaps = 30/206 (14%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFE----ELKVTKES----NEQLEKKILDAQKEAGSIVNSLK 161
D E+ EI + + T ++ E+ + E+ N+ L++KI +K V SL+
Sbjct: 540 DYESKINEIQQNDNETFTNYQNQIKEMMINNENLQNENKSLQEKISLNEKSDNEKVLSLE 599

Query: 162 EALKHEQSVSSNLRKELEKVTSDLELSKKEAS----LLNEQSKDLEASLEQLKKELAKSE 329
E LK ++ S+L+++L+ +E +K S NE+ K L L ++ +
Sbjct: 600 EQLKESKNSISSLQEQLKSSQQTIENLEKNISEKSETYNEKIKSLTDELSTIQNTNENLQ 659

Query: 330 NSARAMETAL----EEEREVSASNKKQLEASRKSIA--------------EAKDNIKLLR 455
N ++++ L + + E + ++QL+ S+ + + + + L+
Sbjct: 660 NEIKSLQEKLSNNEKNDNEKILNLEEQLKNSQNEVRIGQEKLSKFENEYDQMRSKLSLME 719

Query: 456 QDVEKAKLESEKLIKEVKDLERKLGV 533
+++ ++ E L KE + L+ K+ +
Sbjct: 720 KELSTSQKMKESLQKEKESLQEKISL 745



Score = 43.5 bits (101), Expect = 0.011
Identities = 36/168 (21%), Positives = 80/168 (47%), Gaps = 7/168 (4%)
Frame = +3

Query: 9 LEASSKEIDAANAQISTLFEELKVTKESNEQLEK-------KILDAQKEAGSIVNSLKEA 167
L E D +++S + +EL +++ E L+K KI ++K V SL+E
Sbjct: 701 LSKFENEYDQMRSKLSLMEKELSTSQKMKESLQKEKESLQEKISLSEKSDNEKVLSLEEQ 760

Query: 168 LKHEQSVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAM 347
L + +++ +N + +++ S L S LNE+ + +E L+++++ +E +
Sbjct: 761 LNNSKNMITNYEQNEKELQSQL-------STLNEELSTSKKMIETLEEKISNNEKNGDEK 813

Query: 348 ETALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEK 491
+ EE+ + +L+ +S E +++ +D+++ SEK
Sbjct: 814 VKSYEEQLNSYRNTINELQQITQSNEEKIKSLESQNKDLQEKISLSEK 861



Score = 43.1 bits (100), Expect = 0.014
Identities = 43/202 (21%), Positives = 92/202 (45%), Gaps = 29/202 (14%)
Frame = +3

Query: 9 LEASSKEIDAANAQISTLFEELKVTKE--------SNEQL---EKKILDAQKEAGSIVNS 155
+++ + E+ + L E+K +E NE++ E+++ +KE ++
Sbjct: 1055 IKSLTDELSTIQNKNENLQNEIKSLQEKLSNNEKNDNEKVKLYEEQLNSLKKENDNLKQE 1114

Query: 156 LKEALKHEQSVSSNLRKELEKVTSDLELSKKEASLLNEQ-----SKDLE---------AS 293
+ + K + N + +++++ +LE ++ + S L EQ D E A
Sbjct: 1115 MSDIQKSDNETFENYQNQIKEMMQNLEEAENKVSTLQEQISMNEKSDSEKVTSYEAKIAQ 1174

Query: 294 LEQLKKELAKSENSARAMETALEEER----EVSASNKKQLEASRKSIAEAKDNIKLLRQD 461
+ Q KKEL K +A+ + + +E+ E S KQ+ + + ++K+ I+ L
Sbjct: 1175 MHQEKKELEKKFTAAKQIVSNNRQEKKEMEEKINSLTKQVSDKDEELQKSKEEIESLNHK 1234

Query: 462 VEKAKLESEKLIKEVKDLERKL 527
V + E +K+ +DL++KL
Sbjct: 1235 VTSNEAEKQKV---AEDLQQKL 1253



Score = 42.4 bits (98), Expect = 0.023
Identities = 33/155 (21%), Positives = 72/155 (46%), Gaps = 2/155 (1%)
Frame = +3

Query: 69 ELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNLRKELEKVTSDLELSKK 248
ELK K+ +E+ ++ I + K+ + L K + S L +E+E L + +
Sbjct: 1310 ELKQKKDDSEKDKEIIQNLTKDLEKMKADLDSKQKENDEIRSRLNREIEDNKQALAKAVE 1369

Query: 249 EASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSASNKKQLEASRKSIAE 428
A +L+E+++ L +EQ+ + + + LE + S + + R ++
Sbjct: 1370 TAKILSEENEKLTKQMEQVSSSETEKCQVLSSKISTLESRLQSSETRATSVLEDRNRLSS 1429

Query: 429 AKDNIKLLR--QDVEKAKLESEKLIKEVKDLERKL 527
+LLR +++++K E +K+ +E D ++L
Sbjct: 1430 -----ELLRTMSELKESKNEKDKITQEFNDKIKEL 1459



Score = 40.8 bits (94), Expect = 0.068
Identities = 40/188 (21%), Positives = 77/188 (40%), Gaps = 11/188 (5%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQK----EAGSIVNSLKEAL 170
+DLE ++D+ + + L E N+Q K ++ K E + +++
Sbjct: 1330 KDLEKMKADLDSKQKENDEIRSRLNREIEDNKQALAKAVETAKILSEENEKLTKQMEQVS 1389

Query: 171 KHEQSVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAME 350
E L ++ + S L+ S+ A+ + E L + L + EL +S+N +
Sbjct: 1390 SSETEKCQVLSSKISTLESRLQSSETRATSVLEDRNRLSSELLRTMSELKESKNEKDKIT 1449

Query: 351 TALEEEREVSASNKKQLEASRKSIAEAKDNIKLLRQD-------VEKAKLESEKLIKEVK 509
++ + SN SR+ A + IKLL + + + +L+ L K V+
Sbjct: 1450 QEFNDKIKELESN------SREQTANYEGKIKLLESEKSSLETKINEDQLKISNLEKNVQ 1503

Query: 510 DLERKLGV 533
+L K V
Sbjct: 1504 NLSNKNSV 1511



Score = 35.0 bits (79), Expect = 3.7
Identities = 33/181 (18%), Positives = 78/181 (43%), Gaps = 7/181 (3%)
Frame = +3

Query: 6 DLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQS 185
D E SK D + + + NE L++++ ++ +++ +
Sbjct: 166 DAEQISKPKDDI---VDDFLQRIDELMRENESLKEQLASKPAQSQDLLDFSSNQNNSNFN 222

Query: 186 VSSNLRKELEKVTSDLELSKKEASLL-NEQSKDLEASLEQLKKELAKSENSARAMETALE 362
SSN + + + DL ++ A+ N + L + QL+KELA+ ++ + +E
Sbjct: 223 QSSNQQNSQQNMLLDLFGEQQPANQSQNTDIQRLNDKISQLEKELAEKDDQINELANLIE 282

Query: 363 EEREVSAS------NKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERK 524
E + + N+ +A + + + ++ I ++++ + E E LI ++ +L+
Sbjct: 283 ENDKKQGTQQNQNLNQNDEDAIQSLVTKYEEEIDDIKKNNQN---EKENLINQINELKNS 339

Query: 525 L 527
L
Sbjct: 340 L 340


>tr|B6LMK0|B6LMK0_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_72348 PE=4 SV=1
Length = 840

Score = 67.0 bits (162), Expect = 9e-10
Identities = 47/171 (27%), Positives = 88/171 (51%), Gaps = 4/171 (2%)
Frame = +3

Query: 24 KEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNLR 203
K + + TL +E K+ +E E L K + +AQ++ LKE KH + L+
Sbjct: 470 KTVQEEQEKQKTLEKEKKLIEEEREGLRKSLKEAQEKE----EMLKEEKKHVEDEREGLQ 525

Query: 204 KELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSA 383
K L++ E+ +KE + E++++L++SL KE + + + + +E+ERE +
Sbjct: 526 KSLKEKQEKQEMLEKEKKQVEEENEELQSSL----KETQEQQEMLKEEKKHVEDEREGAE 581

Query: 384 SNKKQLEASRKSIAEAKDNI-KLLRQDVEK---AKLESEKLIKEVKDLERK 524
+K LE ++ + E + + KL R+ VE+ AK E + + +D E+K
Sbjct: 582 EKQKSLEEEKRQVEEEGEELRKLNRRQVEEISAAKAEVIETARRAEDAEKK 632



Score = 65.9 bits (159), Expect = 2e-09
Identities = 43/178 (24%), Positives = 91/178 (51%), Gaps = 4/178 (2%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQ 182
RDL A+S+E++ + + +L E K ++ E L++ + +AQ++ LKE K +
Sbjct: 389 RDLSAASEELEESQEKQESLEREKKNVEDEREGLKRSLKEAQEKQAM----LKEETKQVE 444

Query: 183 SVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALE 362
L+K LE+ LE K + ++ ++ + +LE+ KK + + R +
Sbjct: 445 EKKEELQKSLEEEKKLLENEKDQLQKTVQEEQEKQKTLEKEKKLIEEEREGLRKSLKEAQ 504

Query: 363 EEREVSASNKKQLEASR----KSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERK 524
E+ E+ KK +E R KS+ E ++ ++L ++ ++ + E+E+L +K+ + +
Sbjct: 505 EKEEMLKEEKKHVEDEREGLQKSLKEKQEKQEMLEKEKKQVEEENEELQSSLKETQEQ 562



Score = 57.0 bits (136), Expect = 9e-07
Identities = 43/163 (26%), Positives = 85/163 (52%), Gaps = 10/163 (6%)
Frame = +3

Query: 69 ELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNLR---KELEKVTSDLEL 239
E ++ +E Q+ +++ + +A I+ LK+ +V+ LR EL+ DL++
Sbjct: 55 ECEILREGGRQIREELNYQKAQADEIIRRLKDEKAELSAVAEELRIREGELQTRAEDLQM 114

Query: 240 SKKEASLLNEQSKDLEASLEQLKK-------ELAKSENSARAMETALEEEREVSASNKKQ 398
AS +++++ + +LE+ KK E+ KS ++ + LEEE++ N+++
Sbjct: 115 DLSAASEELKEAQEKQETLEREKKNVEDEREEMQKSLKESQDNQKTLEEEKK---RNEEE 171

Query: 399 LEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERKL 527
+E RKS+ E +D K L Q+ E E +KL+K ++ + L
Sbjct: 172 IEELRKSLKEEEDRGKTLEQERE----ELQKLLKVAQEKQETL 210



Score = 53.1 bits (126), Expect = 1e-05
Identities = 46/166 (27%), Positives = 83/166 (50%), Gaps = 14/166 (8%)
Frame = +3

Query: 69 ELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNLRKELEKVTSDLELSKK 248
E ++ +E Q+ +++ + +A I+ LK+ +V+ L+ E + DL + +
Sbjct: 337 ECEILREGGRQIREELNYQKAQADEIIRRLKDEKAELSAVAEELQTRAEDLQRDLSAASE 396

Query: 249 EASLLNEQSKDLEASLEQLKKE-------LAKSENSARAMETALEEE----REVSASNKK 395
E E+S++ + SLE+ KK L +S A+ + L+EE E +K
Sbjct: 397 EL----EESQEKQESLEREKKNVEDEREGLKRSLKEAQEKQAMLKEETKQVEEKKEELQK 452

Query: 396 QLEASRKSIAEAKDNI-KLLRQDVEKAK-LESE-KLIKEVKDLERK 524
LE +K + KD + K ++++ EK K LE E KLI+E ++ RK
Sbjct: 453 SLEEEKKLLENEKDQLQKTVQEEQEKQKTLEKEKKLIEEEREGLRK 498



Score = 50.4 bits (119), Expect = 9e-05
Identities = 38/132 (28%), Positives = 70/132 (53%)
Frame = +3

Query: 51 ISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQSVSSNLRKELEKVTSD 230
+S EELK +E E LE++ + + E + SLKE+ +++++ E EK ++
Sbjct: 116 LSAASEELKEAQEKQETLEREKKNVEDEREEMQKSLKESQDNQKTL------EEEKKRNE 169

Query: 231 LELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALEEEREVSASNKKQLEAS 410
E+ + SL E+ D +LEQ ++EL K A+ + LEEE++ +++L+
Sbjct: 170 EEIEELRKSLKEEE--DRGKTLEQEREELQKLLKVAQEKQETLEEEKKHVQEEREELQ-- 225

Query: 411 RKSIAEAKDNIK 446
KS+ E ++ K
Sbjct: 226 -KSVKEGQEKQK 236


>tr|B8YGH5|B8YGH5_STRSG M protein (Fragment) OS=Streptococcus sp.
group G GN=emm PE=4 SV=1
Length = 442

Score = 66.2 bits (160), Expect = 2e-09
Identities = 49/180 (27%), Positives = 92/180 (51%), Gaps = 7/180 (3%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQ 182
RDL+AS + A+ L EE +++ S + L + LDA +EA + + + L+ +
Sbjct: 252 RDLDASREAKKQLEAEYQKLEEEKQISDASRQSLRRD-LDASREAKKQLEAEYQKLEEQN 310

Query: 183 SVSSNLRKELEKVTSDLELSKK----EASLLNEQSKDLEASLEQLKKELAKSENSARAME 350
+S RK L + + +KK E L EQ+K EAS + L+++L S + + +E
Sbjct: 311 KISEASRKGLRRDLNASREAKKQLEAEHQKLEEQNKISEASRKGLRRDLDASREAKKQLE 370

Query: 351 TALE---EEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLER 521
L+ EE+++S +++K L + EAK ++ ++ EKL KE+++ ++
Sbjct: 371 AELDKVKEEKQISDASRKGLRRDLDASREAKKQVEKALEEANSKLAALEKLNKELEESKK 430



Score = 55.1 bits (131), Expect = 3e-06
Identities = 51/212 (24%), Positives = 94/212 (44%), Gaps = 39/212 (18%)
Frame = +3

Query: 9 LEASSKEIDAANAQISTLFEELKVTKES---------------------NEQLEKKILDA 125
++ S+ I+ A ++LF+++KV +S N+ LE+K+ D
Sbjct: 124 IKKQSETIEKEVADYNSLFDKMKVVNDSYQNTKREYDLIEEELGKKLKENQDLEEKLKDK 183

Query: 126 QKEAGSIVNSLKEA-------------LKHEQSVSSNLRKELEKVTSDLELSKKEASLLN 266
+ G + + E LKHE L +E +K +D + + E + L
Sbjct: 184 EFYLGETLRYINELDLKLGQLNIDNIDLKHE------LEQEKQKAEADRQTLEAEKAKLE 237

Query: 267 EQSKDLEASLEQLKKELAKSENSARAMETA---LEEEREVSASNKKQLEASRKSIAEAKD 437
E+ + +AS + L+++L S + + +E LEEE+++S ++++ L + EAK
Sbjct: 238 EEKQISDASRQSLRRDLDASREAKKQLEAEYQKLEEEKQISDASRQSLRRDLDASREAKK 297

Query: 438 NIKLLRQDVEKAKLESEKLIKEV--KDLERKL 527
+ + E KLE + I E K L R L
Sbjct: 298 QL-----EAEYQKLEEQNKISEASRKGLRRDL 324



Score = 48.1 bits (113), Expect = 4e-04
Identities = 34/120 (28%), Positives = 60/120 (50%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQ 182
RDL AS + A+ L E+ K+++ S + L + LDA +EA + + + +K E+
Sbjct: 322 RDLNASREAKKQLEAEHQKLEEQNKISEASRKGLRRD-LDASREAKKQLEAELDKVKEEK 380

Query: 183 SVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALE 362
+S RK L + +KK+ E++ A+LE+L KEL +S+ + L+
Sbjct: 381 QISDASRKGLRRDLDASREAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAELQ 440



Score = 37.4 bits (85), Expect = 0.76
Identities = 42/175 (24%), Positives = 74/175 (42%)
Frame = +3

Query: 3 RDLEASSKEIDAANAQISTLFEELKVTKESNEQLEKKILDAQKEAGSIVNSLKEALKHEQ 182
RDL S + N +I L L T N +LE N LKE +
Sbjct: 30 RDLYVSGNIWEWQNQRIKELQSLLGKTNLDNIELE--------------NRLKEEKLRSE 75

Query: 183 SVSSNLRKELEKVTSDLELSKKEASLLNEQSKDLEASLEQLKKELAKSENSARAMETALE 362
+L + +K+ +LE KK+ L + + ++++ K E+AK + + +E
Sbjct: 76 KGLKDLSDKNQKIQEELENKKKDYQLAVDGHAN---TVKRYKAEIAKLDEIIKKQSETIE 132

Query: 363 EEREVSASNKKQLEASRKSIAEAKDNIKLLRQDVEKAKLESEKLIKEVKDLERKL 527
+E ++ L K + ++ N K ++ + + E K +KE +DLE KL
Sbjct: 133 KE----VADYNSLFDKMKVVNDSYQNTK---REYDLIEEELGKKLKENQDLEEKL 180