DK951131
Clone id TST38A01NGRL0010_J06
Library
Length 667
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_J06. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
AACTACCATGACTAGTTTGCAAATTATGCAAAGTTTTTTATCCACGCAGTAGCGTGAGAT
GACGGACGAGGTGCTGATGGCGATAGAGAGAAGTCAGATGCAGGAGGCGATTACCAGCAG
CTGGAAAGCGGGGCGGCATCAGCAGCAGGCCTGGAGCGCTGGAACGCAGCCATCGCCAAC
ATGGGCGAGATCCAGAATGGTGTTGACATGTTGCAGCGCCTCCTTCTCAAGCAGACAGTC
TACAAGGACGAAGAGGCCTTCTCAATCGCTTCTTCTAATGCCAACCAAGCTCGTCATATT
ATGGCTCAGGAAAGGCGAATTCGTGCCCTGGAAAAGGAGCTTGATGCTGCGATTGCCTCA
GCTGGGCTCTTTTTATCAGAGAACAGACTGGCTGAAATAGCCCAACGTGAAAAAGAGGGG
GGTGCCCAGGAAGTGCTTCAAGAGCTTGATAACACCACAAAGGTTTTTAAGTTGCACATG
GAAGAGCTGCGAGCTAAGCAAGAAGAACTGCTGAATAAGGATGAAGAAATTAAGGCTTTA
AAGGCAGTGGAGGAACTTCGTGGTAGCTCTTTCCCACCCAGGACAGAGGAAAGCTAGTTC
TATGTGCAATCTTGCACTATGGTTTTTCAACAGAGTCGACAGCTGCTAGTGTGCTTGCGG
GCAGGTT
■■Homology search results ■■ -
sp_hit_id Q835H3
Definition sp|Q835H3|MUTS2_ENTFA MutS2 protein OS=Enterococcus faecalis
Align length 141
Score (bit) 42.0
E-value 0.003
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK951131|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_J06, 5'
(667 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q835H3|MUTS2_ENTFA MutS2 protein OS=Enterococcus faecalis GN=... 42 0.003
sp|Q29GR8|MOEH_DROPS Moesin/ezrin/radixin homolog 1 OS=Drosophil... 40 0.015
sp|Q170J7|MOEH_AEDAE Moesin/ezrin/radixin homolog 1 OS=Aedes aeg... 39 0.019
sp|A3KNA5|FIL1L_DANRE Filamin A-interacting protein 1-like OS=Da... 39 0.025
sp|Q6IRU2|TPM4_MOUSE Tropomyosin alpha-4 chain OS=Mus musculus G... 39 0.033
sp|Q4V7C8|CEP55_RAT Centrosomal protein of 55 kDa OS=Rattus norv... 39 0.033
sp|P67937|TPM4_PIG Tropomyosin alpha-4 chain OS=Sus scrofa GN=TP... 38 0.043
sp|P67936|TPM4_HUMAN Tropomyosin alpha-4 chain OS=Homo sapiens G... 38 0.043
sp|P02561|TPM4_HORSE Tropomyosin alpha-4 chain OS=Equus caballus... 38 0.043
sp|P58775|TPM2_RAT Tropomyosin beta chain OS=Rattus norvegicus G... 38 0.043
sp|P58776|TPM2_RABIT Tropomyosin beta chain OS=Oryctolagus cunic... 38 0.043
sp|P58774|TPM2_MOUSE Tropomyosin beta chain OS=Mus musculus GN=T... 38 0.043
sp|P07951|TPM2_HUMAN Tropomyosin beta chain OS=Homo sapiens GN=T... 38 0.043
sp|P19352|TPM2_CHICK Tropomyosin beta chain OS=Gallus gallus GN=... 38 0.043
sp|Q5KR48|TPM2_BOVIN Tropomyosin beta chain OS=Bos taurus GN=TPM... 38 0.043
sp|Q01173|TPM1_XENLA Tropomyosin alpha-1 chain OS=Xenopus laevis... 38 0.056
sp|P09495|TPM4_RAT Tropomyosin alpha-4 chain OS=Rattus norvegicu... 37 0.073
sp|Q9Y2K3|MYH15_HUMAN Myosin-15 OS=Homo sapiens GN=MYH15 PE=1 SV=4 37 0.073
sp|P05661|MYSA_DROME Myosin heavy chain, muscle OS=Drosophila me... 37 0.095
sp|P13105|TPM1_RANTE Tropomyosin alpha-1 chain OS=Rana temporari... 37 0.12
sp|P58773|TPM1_COTJA Tropomyosin alpha-1 chain OS=Coturnix cotur... 37 0.12
sp|P04268|TPM1_CHICK Tropomyosin alpha-1 chain OS=Gallus gallus ... 37 0.12
sp|Q9Z221|PMFBP_RAT Polyamine-modulated factor 1-binding protein... 37 0.12
sp|Q5E7L5|IF2_VIBF1 Translation initiation factor IF-2 OS=Vibrio... 37 0.12
sp|P21107|TPM3_MOUSE Tropomyosin alpha-3 chain OS=Mus musculus G... 36 0.16
sp|P06753|TPM3_HUMAN Tropomyosin alpha-3 chain OS=Homo sapiens G... 36 0.16
sp|Q5KR47|TPM3_BOVIN Tropomyosin alpha-3 chain OS=Bos taurus GN=... 36 0.16
sp|P04692|TPM1_RAT Tropomyosin alpha-1 chain OS=Rattus norvegicu... 36 0.16
sp|P58772|TPM1_RABIT Tropomyosin alpha-1 chain OS=Oryctolagus cu... 36 0.16
sp|P42639|TPM1_PIG Tropomyosin alpha-1 chain OS=Sus scrofa GN=TP... 36 0.16

>sp|Q835H3|MUTS2_ENTFA MutS2 protein OS=Enterococcus faecalis
GN=mutS2 PE=3 SV=1
Length = 788

Score = 42.0 bits (97), Expect = 0.003
Identities = 37/141 (26%), Positives = 68/141 (48%), Gaps = 9/141 (6%)
Frame = +1

Query: 187 EIQNGVDMLQRLLLKQTVYKDEEAFSIASSNANQARHIMAQERRIRALEKELDAAIASAG 366
+++N M + L+ Y DE A +A + +ER EKEL A A
Sbjct: 524 DLENRRKMAETEYLEARHYVDESA--ALHKELKEAYQVFFEER-----EKELQKARKEAN 576

Query: 367 LFLSENR------LAEIAQREKEGGAQEVLQE---LDNTTKVFKLHMEELRAKQEELLNK 519
++E +++I + + E G Q ++E +D T++ +LH EE + + ++L K
Sbjct: 577 KIIAEAEENAETIISDIRKMQLESGQQGGVKEHQLIDAKTQLSQLHHEETKLAKNKVLKK 636

Query: 520 DEEIKALKAVEELRGSSFPPR 582
+E K LKA +E+ +++ R
Sbjct: 637 AKEQKKLKAGDEVIVNTYGQR 657


>sp|Q29GR8|MOEH_DROPS Moesin/ezrin/radixin homolog 1 OS=Drosophila
pseudoobscura pseudoobscura GN=Moe PE=3 SV=3
Length = 593

Score = 39.7 bits (91), Expect = 0.015
Identities = 42/153 (27%), Positives = 68/153 (44%), Gaps = 2/153 (1%)
Frame = +1

Query: 109 DYQQLESGAASAAGLERWNAAIANMGEIQNGVDMLQRLLLKQTVYKDEEAFSIASSNANQ 288
D QQ+++ A E NA ++Q + +R KQ Y+D +
Sbjct: 320 DVQQMKAQAR-----EEKNAKQQEREKLQLALAARERAEKKQQEYED-RLKQMQEEMERS 373

Query: 289 ARHIMAQERRIRALEKEL-DAAIASAGLFLSENRLAEIAQREKEGGAQEVLQELDNTTKV 465
R ++ + IR LE++L A L L + L + QR +E E ++++ ++
Sbjct: 374 QRDLLEAQEMIRRLEEQLKQLQAAKDELELRQKELQSMLQRLEEAKNMEAVEKIKLEEEI 433

Query: 466 FKLHMEELRAKQEELLNKDEEIKALK-AVEELR 561
ME R Q+E+ KDEE K L+ VEE R
Sbjct: 434 MAKQMEVQRI-QDEVNAKDEETKRLQDEVEEAR 465


>sp|Q170J7|MOEH_AEDAE Moesin/ezrin/radixin homolog 1 OS=Aedes
aegypti GN=Moe PE=3 SV=1
Length = 583

Score = 39.3 bits (90), Expect = 0.019
Identities = 47/153 (30%), Positives = 66/153 (43%), Gaps = 2/153 (1%)
Frame = +1

Query: 109 DYQQLESGAASAAGLERWNAAIANMGEIQNGVDMLQRLLLKQTVYKDEEAFSIASSNANQ 288
D QQ+++ A E NA ++Q + +R KQ Y+D +Q
Sbjct: 307 DVQQMKAQAR-----EEKNAKQQEREKLQLALAARERAEKKQQEYEDRLRTMQEEMERSQ 361

Query: 289 ARHIMAQERRIRALEKEL-DAAIASAGLFLSENRLAEIAQREKEGGAQEVLQELDNTTKV 465
A I AQE IR LE +L A L +N L + +R +E EV E
Sbjct: 362 ANLIEAQE-MIRRLEDQLKQLQFAKDELEARQNELQVMIKRLEESKNMEV-AERQKLEDE 419

Query: 466 FKLHMEELRAKQEELLNKDEEIKAL-KAVEELR 561
+ EE++ QEE+ KD E K L + VEE R
Sbjct: 420 IRAKQEEVQKIQEEVSVKDTETKRLQEEVEEAR 452


>sp|A3KNA5|FIL1L_DANRE Filamin A-interacting protein 1-like OS=Danio
rerio GN=filip1l PE=2 SV=1
Length = 1129

Score = 38.9 bits (89), Expect = 0.025
Identities = 36/140 (25%), Positives = 67/140 (47%), Gaps = 1/140 (0%)
Frame = +1

Query: 115 QQLESGAASAAGLERWNAAIANMGEIQNGVDMLQRLLLKQTVYKDEEAFSIASSNANQAR 294
Q+L++ A A E N+A + + +N V L+ L KQT + +E ++ + N+
Sbjct: 253 QELQNSAGQAQ--EELNSAQTRLQDEENKVLRLEEELRKQTCHFHQEQDAMTAKLTNEDA 310

Query: 295 HIMAQERRIRALEKELD-AAIASAGLFLSENRLAEIAQREKEGGAQEVLQELDNTTKVFK 471
+++ +L ++LD + L +E L E+ + G E N++ V +
Sbjct: 311 QNRQLRQKLSSLSRQLDELEEINKTLHRAEEELQELRDKISRG-------ECGNSSLVSE 363

Query: 472 LHMEELRAKQEELLNKDEEI 531
+EELR + E+ KDEE+
Sbjct: 364 --VEELRKRVLEMEGKDEEL 381


>sp|Q6IRU2|TPM4_MOUSE Tropomyosin alpha-4 chain OS=Mus musculus
GN=Tpm4 PE=2 SV=3
Length = 248

Score = 38.5 bits (88), Expect = 0.033
Identities = 40/149 (26%), Positives = 70/149 (46%), Gaps = 5/149 (3%)
Frame = +1

Query: 154 ERWNAAIANMGEIQNGVDMLQR--LLLKQTVYKDEEAFSIASSNANQARHIMAQ-ERRIR 324
E+ A+ N+ E + D +R +++ KDEE I +A+HI + +R+
Sbjct: 68 EQLATALQNLEEAEKAADESERGMKVIENRAMKDEEKMEILEMQLKEAKHITDEADRKYE 127

Query: 325 ALEKELDAAIASAGLFLSENRLAEIAQREKEGGAQEVLQELDNTTKVFKLHMEELRAKQE 504
+ ++L I L +E R AE+++ K G +E L+ + N K + E+ K++
Sbjct: 128 EVARKL--VILEGELKRAEER-AEVSEL-KCGDLEEELKNVTNNLKSLEAASEKYSEKED 183

Query: 505 ELLNKDEEIKAL--KAVEELRGSSFPPRT 585
+ +EEIK L K E + F RT
Sbjct: 184 KY---EEEIKLLSDKLKEAETRAEFAERT 209


>sp|Q4V7C8|CEP55_RAT Centrosomal protein of 55 kDa OS=Rattus
norvegicus GN=Cep55 PE=2 SV=1
Length = 462

Score = 38.5 bits (88), Expect = 0.033
Identities = 37/144 (25%), Positives = 60/144 (41%), Gaps = 6/144 (4%)
Frame = +1

Query: 226 LKQTVYKDEEAFSIASSNANQARHIMAQER----RIRALEKELDAAIASAGLFLSENRLA 393
L++ K + A + R + Q R R +E + LS R A
Sbjct: 229 LQEEKQKYDHLLENAKKDLEVERQTVTQLRLELDEFRRKYEETQKEVEDLNQLLSSQRKA 288

Query: 394 EIAQREKEGGAQEVLQELDNTTKVFKLHMEELRAKQEELLNKDEEI--KALKAVEELRGS 567
+I E++ E +Q+L + VFK +EE R K EELL++ + LK EE
Sbjct: 289 DIQHLEEDKHKTEKIQKLREESSVFKGKLEEERKKSEELLSQVRILYDSLLKHQEEQSRV 348

Query: 568 SFPPRTEES*FYVQSCTMVFQQSR 639
+ R +Q+CT+ F+ +
Sbjct: 349 ALLER------QMQACTLDFENEK 366


>sp|P67937|TPM4_PIG Tropomyosin alpha-4 chain OS=Sus scrofa GN=TPM4
PE=1 SV=3
Length = 248

Score = 38.1 bits (87), Expect = 0.043
Identities = 40/149 (26%), Positives = 69/149 (46%), Gaps = 5/149 (3%)
Frame = +1

Query: 154 ERWNAAIANMGEIQNGVDMLQR--LLLKQTVYKDEEAFSIASSNANQARHIMAQ-ERRIR 324
ER A+ + E + D +R +++ KDEE I +A+HI + +R+
Sbjct: 68 ERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYE 127

Query: 325 ALEKELDAAIASAGLFLSENRLAEIAQREKEGGAQEVLQELDNTTKVFKLHMEELRAKQE 504
+ ++L I L +E R AE+++ K G +E L+ + N K + E+ K++
Sbjct: 128 EVARKL--VILEGELERAEER-AEVSEL-KCGDLEEELKNVTNNLKSLEAASEKYSEKED 183

Query: 505 ELLNKDEEIKAL--KAVEELRGSSFPPRT 585
+ +EEIK L K E + F RT
Sbjct: 184 KY---EEEIKLLSDKLKEAETRAEFAERT 209


>sp|P67936|TPM4_HUMAN Tropomyosin alpha-4 chain OS=Homo sapiens
GN=TPM4 PE=1 SV=3
Length = 248

Score = 38.1 bits (87), Expect = 0.043
Identities = 40/149 (26%), Positives = 69/149 (46%), Gaps = 5/149 (3%)
Frame = +1

Query: 154 ERWNAAIANMGEIQNGVDMLQR--LLLKQTVYKDEEAFSIASSNANQARHIMAQ-ERRIR 324
ER A+ + E + D +R +++ KDEE I +A+HI + +R+
Sbjct: 68 ERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYE 127

Query: 325 ALEKELDAAIASAGLFLSENRLAEIAQREKEGGAQEVLQELDNTTKVFKLHMEELRAKQE 504
+ ++L I L +E R AE+++ K G +E L+ + N K + E+ K++
Sbjct: 128 EVARKL--VILEGELERAEER-AEVSEL-KCGDLEEELKNVTNNLKSLEAASEKYSEKED 183

Query: 505 ELLNKDEEIKAL--KAVEELRGSSFPPRT 585
+ +EEIK L K E + F RT
Sbjct: 184 KY---EEEIKLLSDKLKEAETRAEFAERT 209


>sp|P02561|TPM4_HORSE Tropomyosin alpha-4 chain OS=Equus caballus
GN=TPM4 PE=1 SV=2
Length = 248

Score = 38.1 bits (87), Expect = 0.043
Identities = 40/149 (26%), Positives = 69/149 (46%), Gaps = 5/149 (3%)
Frame = +1

Query: 154 ERWNAAIANMGEIQNGVDMLQR--LLLKQTVYKDEEAFSIASSNANQARHIMAQ-ERRIR 324
ER A+ + E + D +R +++ KDEE I +A+HI + +R+
Sbjct: 68 ERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYE 127

Query: 325 ALEKELDAAIASAGLFLSENRLAEIAQREKEGGAQEVLQELDNTTKVFKLHMEELRAKQE 504
+ ++L I L +E R AE+++ K G +E L+ + N K + E+ K++
Sbjct: 128 EVARKL--VILEGELERAEER-AEVSEL-KCGDLEEELKNVTNNLKSLEAASEKYSEKED 183

Query: 505 ELLNKDEEIKAL--KAVEELRGSSFPPRT 585
+ +EEIK L K E + F RT
Sbjct: 184 KY---EEEIKLLSDKLKEAETRAEFAERT 209


>sp|P58775|TPM2_RAT Tropomyosin beta chain OS=Rattus norvegicus
GN=Tpm2 PE=2 SV=1
Length = 284

Score = 38.1 bits (87), Expect = 0.043
Identities = 35/133 (26%), Positives = 63/133 (47%), Gaps = 3/133 (2%)
Frame = +1

Query: 154 ERWNAAIANMGEIQNGVDMLQR--LLLKQTVYKDEEAFSIASSNANQARHIMA-QERRIR 324
ER A+ + E + D +R +++ KDEE + +A+HI +R+
Sbjct: 104 ERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYE 163

Query: 325 ALEKELDAAIASAGLFLSENRLAEIAQREKEGGAQEVLQELDNTTKVFKLHMEELRAKQE 504
+ ++L I L SE R AE+A+ K G +E L+ + N K + ++ K++
Sbjct: 164 EVARKL--VILEGELERSEER-AEVAE-SKCGDLEEELKIVTNNLKSLEAQADKYSTKED 219

Query: 505 ELLNKDEEIKALK 543
+ +EEIK L+
Sbjct: 220 KY---EEEIKLLE 229



Score = 31.2 bits (69), Expect = 5.2
Identities = 27/110 (24%), Positives = 50/110 (45%), Gaps = 1/110 (0%)
Frame = +1

Query: 232 QTVYKDEEAFSIASSNANQARHIMAQ-ERRIRALEKELDAAIASAGLFLSENRLAEIAQR 408
++V +E A A A +A RRI+ +E+ELD A L + AE A
Sbjct: 62 ESVKDAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAAD 121

Query: 409 EKEGGAQEVLQELDNTTKVFKLHMEELRAKQEELLNKDEEIKALKAVEEL 558
E E G + + + K+ ++E++ K+ + + +D + K + +L
Sbjct: 122 ESERGMKVIENRAMKDEE--KMELQEMQLKEAKHIAEDSDRKYEEVARKL 169


tr_hit_id A7QGQ3
Definition tr|A7QGQ3|A7QGQ3_VITVI Chromosome chr12 scaffold_93, whole genome shotgun sequence OS=Vitis vinifera
Align length 139
Score (bit) 141.0
E-value 4.0e-32
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK951131|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_J06, 5'
(667 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QGQ3|A7QGQ3_VITVI Chromosome chr12 scaffold_93, whole genom... 141 4e-32
tr|B8Q8A1|B8Q8A1_ORYSI SKIP interacting protein 15 OS=Oryza sati... 140 9e-32
tr|B6SPZ9|B6SPZ9_MAIZE Putative uncharacterized protein OS=Zea m... 133 9e-30
tr|A9TMU1|A9TMU1_PHYPA Predicted protein OS=Physcomitrella paten... 132 3e-29
tr|Q9FMG6|Q9FMG6_ARATH Dbj|BAA96220.1 (Putative uncharacterized ... 131 3e-29
tr|Q8LE21|Q8LE21_ARATH Putative uncharacterized protein OS=Arabi... 131 3e-29
tr|B6U5W3|B6U5W3_MAIZE Putative uncharacterized protein OS=Zea m... 130 6e-29
tr|Q2QQ98|Q2QQ98_ORYSJ Os12g0502100 protein OS=Oryza sativa subs... 125 3e-27
tr|A2ZKT4|A2ZKT4_ORYSI Putative uncharacterized protein OS=Oryza... 102 2e-20
tr|A0DRW8|A0DRW8_PARTE Chromosome undetermined scaffold_61, whol... 47 8e-04
tr|B4KP70|B4KP70_DROMO GI20293 OS=Drosophila mojavensis GN=GI202... 42 0.035
tr|Q805C8|Q805C8_FUGRU Tropomyosin2 OS=Fugu rubripes GN=TPM2 PE=... 42 0.045
tr|Q805C7|Q805C7_FUGRU Tropomyosin2 OS=Fugu rubripes GN=TPM2 PE=... 42 0.045
tr|Q6IQD7|Q6IQD7_DANRE Zgc:86810 OS=Danio rerio GN=zgc:86810 PE=... 42 0.045
tr|Q4T142|Q4T142_TETNG Chromosome undetermined SCAF10725, whole ... 42 0.045
tr|Q6F4C5|Q6F4C5_BABEQ Be158 protein OS=Babesia equi GN=Be158 PE... 41 0.059
tr|Q8ZX55|Q8ZX55_PYRAE Putative uncharacterized protein PAE1451 ... 41 0.077
tr|A1RUU0|A1RUU0_PYRIL Putative uncharacterized protein OS=Pyrob... 41 0.077
tr|Q805D0|Q805D0_FUGRU Tropomyosin1-2 OS=Fugu rubripes GN=TPM1-2... 40 0.10
tr|A4RRB2|A4RRB2_OSTLU Predicted protein OS=Ostreococcus lucimar... 40 0.10
tr|B4DA11|B4DA11_9BACT MCP methyltransferase, CheR-type with PAS... 40 0.13
tr|Q7T3F0|Q7T3F0_DANRE Tropomyosin 4 OS=Danio rerio GN=tpm4 PE=2... 40 0.17
tr|Q5U3J6|Q5U3J6_DANRE Tropomyosin 4 OS=Danio rerio GN=tpm4 PE=2... 40 0.17
tr|Q1LXM2|Q1LXM2_DANRE Novel protein similar to vertebrate tropo... 40 0.17
tr|Q1LXM1|Q1LXM1_DANRE Novel protein similar to vertebrate tropo... 40 0.17
tr|A4RXI9|A4RXI9_OSTLU Predicted protein OS=Ostreococcus lucimar... 40 0.17
tr|B4GVJ0|B4GVJ0_DROPE GL13033 OS=Drosophila persimilis GN=GL130... 40 0.17
tr|B0EUK2|B0EUK2_ENTDI Putative uncharacterized protein OS=Entam... 40 0.17
tr|B1YCM4|B1YCM4_THENV Putative uncharacterized protein OS=Therm... 40 0.17
tr|A4WIH7|A4WIH7_PYRAR Putative uncharacterized protein OS=Pyrob... 40 0.17

>tr|A7QGQ3|A7QGQ3_VITVI Chromosome chr12 scaffold_93, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00038432001
PE=4 SV=1
Length = 156

Score = 141 bits (355), Expect = 4e-32
Identities = 72/139 (51%), Positives = 101/139 (72%)
Frame = +1

Query: 148 GLERWNAAIANMGEIQNGVDMLQRLLLKQTVYKDEEAFSIASSNANQARHIMAQERRIRA 327
G ERW+AAI N+ E+ + ++ LQ+LLLK+ V+ DEE F+ AS ++ QAR I E+R+
Sbjct: 7 GSERWSAAIGNLSEMTSNLESLQKLLLKKAVFVDEETFAKASLSSEQARIIKVLEQRVET 66

Query: 328 LEKELDAAIASAGLFLSENRLAEIAQREKEGGAQEVLQELDNTTKVFKLHMEELRAKQEE 507
LE+ELDAAI +A SE R AE AQ+ E +QE+ +EL+NTTKVF+LHMEELRAKQ+E
Sbjct: 67 LERELDAAITAAARARSEKRQAEAAQKAAELRSQEITKELENTTKVFELHMEELRAKQQE 126

Query: 508 LLNKDEEIKALKAVEELRG 564
+ +D +IK L+A+ + G
Sbjct: 127 IAKRDSDIKVLEAIIQTLG 145


>tr|B8Q8A1|B8Q8A1_ORYSI SKIP interacting protein 15 OS=Oryza sativa
subsp. indica GN=SIP15 PE=2 SV=1
Length = 173

Score = 140 bits (352), Expect = 9e-32
Identities = 77/154 (50%), Positives = 103/154 (66%)
Frame = +1

Query: 88 EKSDAGGDYQQLESGAASAAGLERWNAAIANMGEIQNGVDMLQRLLLKQTVYKDEEAFSI 267
EKS A A + G +RW AA+ N+ E+ V LQRLL K+ V+ DE+ FS
Sbjct: 6 EKSAAATSSAAAADAAGAGGGGDRWGAAVGNLTELGANVAALQRLLAKKAVFVDEDIFSK 65

Query: 268 ASSNANQARHIMAQERRIRALEKELDAAIASAGLFLSENRLAEIAQREKEGGAQEVLQEL 447
AS A+QAR I ++R+++LE+ELDAAI++A +E R AE AQR E AQEV +EL
Sbjct: 66 ASLAADQARTIKILDQRVQSLERELDAAISAAARARTEKRQAEAAQRAAELRAQEVTKEL 125

Query: 448 DNTTKVFKLHMEELRAKQEELLNKDEEIKALKAV 549
+NT KVF+LHMEELRAKQEE+ K+ +IK L+A+
Sbjct: 126 ENTAKVFQLHMEELRAKQEEIAKKESDIKVLEAI 159


>tr|B6SPZ9|B6SPZ9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 186

Score = 133 bits (335), Expect = 9e-30
Identities = 70/139 (50%), Positives = 103/139 (74%)
Frame = +1

Query: 133 AASAAGLERWNAAIANMGEIQNGVDMLQRLLLKQTVYKDEEAFSIASSNANQARHIMAQE 312
+AS++G +RW+AAI N+GE+ VD LQ+LL ++ V+ D++ FS AS A+QAR I +
Sbjct: 35 SASSSG-DRWSAAIGNLGELGANVDALQKLLGRKAVFVDDDIFSKASLAADQARTIKVLD 93

Query: 313 RRIRALEKELDAAIASAGLFLSENRLAEIAQREKEGGAQEVLQELDNTTKVFKLHMEELR 492
+R+++LE+ELDAAI++A +E R AE AQR E +EV +EL+NT +VF+LHMEELR
Sbjct: 94 QRVQSLERELDAAISAAARARAEKRQAEAAQRAAELRTREVTEELENTARVFELHMEELR 153

Query: 493 AKQEELLNKDEEIKALKAV 549
KQE++ KD +IK L+A+
Sbjct: 154 LKQEDIAKKDSDIKVLEAI 172


>tr|A9TMU1|A9TMU1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_196508 PE=4 SV=1
Length = 165

Score = 132 bits (331), Expect = 3e-29
Identities = 72/132 (54%), Positives = 98/132 (74%)
Frame = +1

Query: 154 ERWNAAIANMGEIQNGVDMLQRLLLKQTVYKDEEAFSIASSNANQARHIMAQERRIRALE 333
+R+ AA+AN+ ++ ++ LQ +L K VY DE+ F+ AS+ +NQ+R + AQERRI+ALE
Sbjct: 21 DRFAAALANVNDMGQSLESLQSMLRK-AVYLDEDVFANASAVSNQSRTLKAQERRIKALE 79

Query: 334 KELDAAIASAGLFLSENRLAEIAQREKEGGAQEVLQELDNTTKVFKLHMEELRAKQEELL 513
+ELDAAIA+AG +E + AE QR E QEVL+EL+NT VFKLH EELRAKQEE+
Sbjct: 80 RELDAAIAAAGHARAEKKQAEAGQRAAEARVQEVLRELENTAVVFKLHAEELRAKQEEVG 139

Query: 514 NKDEEIKALKAV 549
K+EEI+ LKA+
Sbjct: 140 KKNEEIQVLKAI 151


>tr|Q9FMG6|Q9FMG6_ARATH Dbj|BAA96220.1 (Putative uncharacterized
protein At5g64180) OS=Arabidopsis thaliana GN=At5g64180
PE=2 SV=1
Length = 158

Score = 131 bits (330), Expect = 3e-29
Identities = 68/137 (49%), Positives = 96/137 (70%)
Frame = +1

Query: 154 ERWNAAIANMGEIQNGVDMLQRLLLKQTVYKDEEAFSIASSNANQARHIMAQERRIRALE 333
ERW ++ N+ E+ + +D LQ+LLLK+ V+ +E+ FS AS + QAR I E+R++ LE
Sbjct: 10 ERWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSEQARTIKVLEQRVQTLE 69

Query: 334 KELDAAIASAGLFLSENRLAEIAQREKEGGAQEVLQELDNTTKVFKLHMEELRAKQEELL 513
+ELDAAI +A SE R AE +Q+ E AQ+V +EL+NTTKVFKLHMEELR QE++
Sbjct: 70 RELDAAITAAAHARSEKRQAESSQKAAESRAQDVTKELENTTKVFKLHMEELRGMQEQIS 129

Query: 514 NKDEEIKALKAVEELRG 564
+D EIK L+A+ + G
Sbjct: 130 KRDNEIKLLEAIIQTLG 146


>tr|Q8LE21|Q8LE21_ARATH Putative uncharacterized protein
OS=Arabidopsis thaliana PE=2 SV=1
Length = 158

Score = 131 bits (330), Expect = 3e-29
Identities = 69/137 (50%), Positives = 95/137 (69%)
Frame = +1

Query: 154 ERWNAAIANMGEIQNGVDMLQRLLLKQTVYKDEEAFSIASSNANQARHIMAQERRIRALE 333
ERW ++ N+ E+ + +D LQ+LLLK+ V+ +E+ FS AS + QAR I E R++ LE
Sbjct: 10 ERWKGSLENITEMASNLDSLQKLLLKKAVFVEEDTFSRASLVSEQARTIKVLELRVQTLE 69

Query: 334 KELDAAIASAGLFLSENRLAEIAQREKEGGAQEVLQELDNTTKVFKLHMEELRAKQEELL 513
+ELDAAI +A SE R AE +Q+ E AQEV +EL+NTTKVFKLHMEELR QE++
Sbjct: 70 RELDAAITAAAHARSEKRQAESSQKAAESRAQEVTKELENTTKVFKLHMEELRGMQEQIS 129

Query: 514 NKDEEIKALKAVEELRG 564
+D EIK L+A+ + G
Sbjct: 130 KRDNEIKLLEAIIQTLG 146


>tr|B6U5W3|B6U5W3_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 188

Score = 130 bits (328), Expect = 6e-29
Identities = 70/139 (50%), Positives = 101/139 (72%)
Frame = +1

Query: 133 AASAAGLERWNAAIANMGEIQNGVDMLQRLLLKQTVYKDEEAFSIASSNANQARHIMAQE 312
+AS++G +RW AAI N+GE+ VD LQ+LL ++ V+ D++ FS AS A+QAR I +
Sbjct: 37 SASSSG-DRWCAAIGNLGELGANVDALQKLLGRKAVFVDDDIFSKASLAADQARTIKVLD 95

Query: 313 RRIRALEKELDAAIASAGLFLSENRLAEIAQREKEGGAQEVLQELDNTTKVFKLHMEELR 492
+R+++LE+ELDAAI++A E R AE AQR E +EV +EL+NT +VF+LHMEELR
Sbjct: 96 QRVQSLERELDAAISAAARARVEKRQAEAAQRAAELRTREVTEELENTARVFELHMEELR 155

Query: 493 AKQEELLNKDEEIKALKAV 549
KQE++ KD +IK L+A+
Sbjct: 156 LKQEDIAKKDSDIKVLEAI 174


>tr|Q2QQ98|Q2QQ98_ORYSJ Os12g0502100 protein OS=Oryza sativa subsp.
japonica GN=Os12g0502100 PE=4 SV=1
Length = 208

Score = 125 bits (313), Expect = 3e-27
Identities = 78/189 (41%), Positives = 104/189 (55%), Gaps = 35/189 (18%)
Frame = +1

Query: 88 EKSDAGGDYQQLESGAASAAGLERWNAAIANMGEIQNGVDMLQRLLLKQTVYKDEEAFSI 267
EKS A A + G +RW AA+ N+ E+ V LQRLL K+ V+ DE+ FS
Sbjct: 6 EKSAAATSSAAAADAAGAGGGGDRWGAAVGNLTELGANVAALQRLLAKKAVFVDEDIFSK 65

Query: 268 ASSNANQARHI-----------------------------------MAQERRIRALEKEL 342
AS A+QAR I + ++R+++LE+EL
Sbjct: 66 ASLAADQARTIKVILLCFALLVAGAPDSPPIPSPVSSAMLFCQLVDLILDQRVQSLEREL 125

Query: 343 DAAIASAGLFLSENRLAEIAQREKEGGAQEVLQELDNTTKVFKLHMEELRAKQEELLNKD 522
DAAI++A +E R AE AQR E AQEV +EL+NT KVFKLHMEELRAKQEE+ K+
Sbjct: 126 DAAISAAARARTEKRQAEAAQRAAELRAQEVTKELENTAKVFKLHMEELRAKQEEIAKKE 185

Query: 523 EEIKALKAV 549
+IK L+A+
Sbjct: 186 SDIKVLEAI 194


>tr|A2ZKT4|A2ZKT4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_38427 PE=4 SV=1
Length = 242

Score = 102 bits (255), Expect = 2e-20
Identities = 78/223 (34%), Positives = 100/223 (44%), Gaps = 69/223 (30%)
Frame = +1

Query: 88 EKSDAGGDYQQLESGAASAAGLERWNAAIANMGEIQNGVDMLQRLLLKQTVYKDEEAFSI 267
EKS A A + G +RW AA+ N+ E+ V LQRLL K+ V+ DE+ FS
Sbjct: 6 EKSAAATSSAAAADAAGAGGGGDRWGAAVGNLTELGANVAALQRLLAKKAVFVDEDIFSK 65

Query: 268 ASSNANQAR-----------------------------------------HIM-----AQ 309
AS A+QAR HIM
Sbjct: 66 ASLAADQARTIKVIFLCFALLVAGAPDSPPIPSPVSSAMLFCHLFLPYEVHIMINGKTTY 125

Query: 310 ERRIRALEKELD-----------------------AAIASAGLFLSENRLAEIAQREKEG 420
E +R + KE D AAI++A +E R AE AQR E
Sbjct: 126 ETILRTMRKEFDHVLSELPNTILDQRVQSLERELDAAISAAARARTEKRQAEAAQRAAEL 185

Query: 421 GAQEVLQELDNTTKVFKLHMEELRAKQEELLNKDEEIKALKAV 549
AQEV +EL+NT KVF+LHMEELRAKQEE+ K+ +IK L+A+
Sbjct: 186 RAQEVTKELENTAKVFQLHMEELRAKQEEIAKKESDIKVLEAI 228


>tr|A0DRW8|A0DRW8_PARTE Chromosome undetermined scaffold_61, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00019489001 PE=4 SV=1
Length = 995

Score = 47.4 bits (111), Expect = 8e-04
Identities = 38/150 (25%), Positives = 69/150 (46%), Gaps = 5/150 (3%)
Frame = +1

Query: 226 LKQTVYKDEEAFSIASSNANQARHIMAQERRIRALEKELDAAIASAGLFLSENRLAEIAQ 405
LKQ+ + E+ + N + + Q + I +LE+E+ + ++ Q
Sbjct: 713 LKQSYVQQEK------ESQNLKKQVDNQSQMIESLEEEI------------QRSKEQLEQ 754

Query: 406 REKEGGAQEVLQELDNTTKVFKLHMEELRAKQEELLNKDEEIKALKAVEELRGSSFPPRT 585
+++E E +NT V + + +R KQ+EL NKDEEIK LK + S +
Sbjct: 755 KKQEIIRLEAFSNKENTNDVIDGYKQVVRNKQQELNNKDEEIKQLKQRNKQLESEYKEEQ 814

Query: 586 EES*FYVQSCTM-----VFQQSRQLLVCLR 660
E + VQ + + +QS+QL+ ++
Sbjct: 815 ENNQIMVQQLNLQLKQIITRQSKQLITVVK 844