DK951167
Clone id TST38A01NGRL0010_K20
Library
Length 625
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_K20. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID
Sequence
GAGTTGCTGCTGTGGTGTGTGTGTGTGTGTGTGTCTGAGAGAGAGAGAGAGAGAGAGAGA
GAGAGAGAGAGATCGCCCTCATAGATGCCTCATTTTGATGAAAGCGCCCATCCGCAGCAT
CTGCCTAGCGCCCAATCTTCACGCAGAATGCAAACTGGATCCACCAGCAGGATGGCTGCC
CTGTCGCGGCTGCCCAGTATGCACGATCGGGTGCAGGGCTGCTTGAGCCAACACCCAAAT
GAGCTGGTCTCTCTTTTCTCTGCATATGTCGCCTTTGGGAAGCACATTTTGCAGCCCCAT
GAGATTCGTCGTGAGCTTGAAAAGCTTACACAATCATTTGACCAGAACGTCATCAAGGAG
GAATTTGTTTTTGTGCTCCAGGCTGCCCAGGAAGCAATAGTTTATCCACCATGGGTTGCG
CTGGCTATTCGCCCAAAACCTGGACTCTGGGAATATGTTCGGGTCAATGTGGATGAGTTA
ACACTGGATGAGCTCACTGTTTCAGAGTACCTTCAGTTCAAGGAGCAACTTGTTGAAGAA
GAAAGGGTGACAGATCCATATGTTCTTGAGCTAGACTTTGGACCCTTCAATTCGTCCTTT
CCCCGTCTATCGAGGGCCTCTTCCA
■■Homology search results ■■ -
sp_hit_id P49036
Definition sp|P49036|SUS2_MAIZE Sucrose synthase 2 OS=Zea mays
Align length 149
Score (bit) 159.0
E-value 1.0e-38
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK951167|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_K20, 5'
(625 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P49036|SUS2_MAIZE Sucrose synthase 2 OS=Zea mays GN=SUS1 PE=1... 159 1e-38
sp|P31922|SUS1_HORVU Sucrose synthase 1 OS=Hordeum vulgare GN=SS... 157 3e-38
sp|Q41607|SUS2_TULGE Sucrose synthase 2 OS=Tulipa gesneriana PE=... 157 4e-38
sp|P04712|SUS1_MAIZE Sucrose synthase 1 OS=Zea mays GN=SH-1 PE=2... 157 5e-38
sp|P30298|SUS1_ORYSJ Sucrose synthase 1 OS=Oryza sativa subsp. j... 155 1e-37
sp|P31924|SUS2_ORYSJ Sucrose synthase 2 OS=Oryza sativa subsp. j... 155 2e-37
sp|P31923|SUS2_HORVU Sucrose synthase 2 OS=Hordeum vulgare GN=SS... 154 5e-37
sp|Q43009|SUS3_ORYSJ Sucrose synthase 3 OS=Oryza sativa subsp. j... 153 6e-37
sp|O24301|SUS2_PEA Sucrose synthase 2 OS=Pisum sativum GN=SUS2 P... 153 6e-37
sp|Q41608|SUS1_TULGE Sucrose synthase 1 OS=Tulipa gesneriana PE=... 141 3e-33
sp|P49034|SUSY_ALNGL Sucrose synthase OS=Alnus glutinosa GN=SUS1... 136 1e-31
sp|P10691|SUS1_SOLTU Sucrose synthase OS=Solanum tuberosum PE=2 ... 135 2e-31
sp|P49039|SUS2_SOLTU Sucrose synthase OS=Solanum tuberosum PE=3 ... 135 2e-31
sp|P13708|SUSY_SOYBN Sucrose synthase OS=Glycine max GN=SS PE=1 ... 133 6e-31
sp|P49037|SUSY_SOLLC Sucrose synthase OS=Solanum lycopersicum PE... 133 8e-31
sp|Q01390|SUSY_PHAAU Sucrose synthase OS=Phaseolus aureus GN=SS1... 130 7e-30
sp|O65026|SUSY_MEDSA Sucrose synthase OS=Medicago sativa PE=2 SV=1 130 7e-30
sp|P31926|SUSY_VICFA Sucrose synthase OS=Vicia faba GN=SUCS PE=2... 129 9e-30
sp|P49035|SUS1_DAUCA Sucrose synthase isoform 1 OS=Daucus carota... 128 3e-29
sp|P49040|SUS1_ARATH Sucrose synthase 1 OS=Arabidopsis thaliana ... 120 4e-27
sp|Q42652|SUSY_BETVU Sucrose synthase (Fragment) OS=Beta vulgari... 115 2e-25
sp|Q00917|SUS2_ARATH Sucrose synthase 2 OS=Arabidopsis thaliana ... 114 5e-25
sp|O49845|SUS2_DAUCA Sucrose synthase isoform 2 OS=Daucus carota... 113 7e-25
sp|P32434|PGTB1_SCHPO Geranylgeranyl transferase type-1 subunit ... 33 1.2
sp|P19332|TAU_RAT Microtubule-associated protein tau OS=Rattus n... 32 2.7
sp|Q7UA71|MURC_SYNPX UDP-N-acetylmuramate--L-alanine ligase OS=S... 32 2.7
sp|Q75VW3|DNAJ_HYDTH Chaperone protein dnaJ OS=Hydrogenobacter t... 31 4.5
sp|O75095|MEGF6_HUMAN Multiple epidermal growth factor-like doma... 31 5.9
sp|Q7VBS7|ISPG_PROMA 4-hydroxy-3-methylbut-2-en-1-yl diphosphate... 31 5.9
sp|P11931|SYV_BACST Valyl-tRNA synthetase OS=Bacillus stearother... 30 7.7

>sp|P49036|SUS2_MAIZE Sucrose synthase 2 OS=Zea mays GN=SUS1 PE=1
SV=1
Length = 816

Score = 159 bits (402), Expect = 1e-38
Identities = 86/149 (57%), Positives = 107/149 (71%), Gaps = 1/149 (0%)
Frame = +1

Query: 181 LSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQSFDQNVIKE 360
LSRL S+ +R+ LS HPNELV++F+ GK +LQPH+I E ++ +K+
Sbjct: 10 LSRLHSVRERIGDSLSAHPNELVAVFTRLKNLGKGMLQPHQIIAEYNNAIPEAEREKLKD 69

Query: 361 -EFVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYLQFKEQLVE 537
F VL+AAQEAIV PPWVALAIRP+PG+WEYVRVNV EL ++EL V EYLQFKEQLV
Sbjct: 70 GAFEDVLRAAQEAIVIPPWVALAIRPRPGVWEYVRVNVSELAVEELRVPEYLQFKEQLV- 128

Query: 538 EERVTDPYVLELDFGPFNSSFPRLSRASS 624
EE + +VLELDF PFN+SFPR S + S
Sbjct: 129 EEGPNNNFVLELDFEPFNASFPRPSLSKS 157


>sp|P31922|SUS1_HORVU Sucrose synthase 1 OS=Hordeum vulgare GN=SS1
PE=1 SV=1
Length = 807

Score = 157 bits (398), Expect = 3e-38
Identities = 83/150 (55%), Positives = 108/150 (72%)
Frame = +1

Query: 175 AALSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQSFDQNVI 354
A L+RL S+ +R+ S HPNEL++LFS YV GK +LQ H++ E + L +S +
Sbjct: 3 AKLTRLHSLRERLGATFSSHPNELIALFSRYVHQGKGMLQRHQLLAEFDALFESDKEKYA 62

Query: 355 KEEFVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYLQFKEQLV 534
F +L+AAQEAIV PPWVALAIRP+ G+W+Y+RVNV EL ++ELTVSEYL FKEQLV
Sbjct: 63 P--FEDILRAAQEAIVLPPWVALAIRPRTGVWDYIRVNVSELAVEELTVSEYLAFKEQLV 120

Query: 535 EEERVTDPYVLELDFGPFNSSFPRLSRASS 624
+E + +VLELDF PFN+SFPR S + S
Sbjct: 121 -DEHASRKFVLELDFEPFNASFPRPSMSKS 149


>sp|Q41607|SUS2_TULGE Sucrose synthase 2 OS=Tulipa gesneriana PE=2
SV=1
Length = 820

Score = 157 bits (397), Expect = 4e-38
Identities = 82/150 (54%), Positives = 112/150 (74%), Gaps = 1/150 (0%)
Frame = +1

Query: 178 ALSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQSFDQNVIK 357
A++R+ S+ +R+ LS H NEL++LFS +V G+ +LQPH++ E E + + D+ +K
Sbjct: 5 AMTRVHSVRERLTDTLSAHKNELLALFSRFVKQGQGMLQPHQLLTEYEAVIPAADREKLK 64

Query: 358 EE-FVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYLQFKEQLV 534
+ F VL+AAQEAIV PPWVALAIRP+PG+WEYVRVNV EL ++ELTV EYLQFKE+LV
Sbjct: 65 DGVFEDVLKAAQEAIVIPPWVALAIRPRPGVWEYVRVNVSELAVEELTVPEYLQFKEELV 124

Query: 535 EEERVTDPYVLELDFGPFNSSFPRLSRASS 624
+ ++ + LELDF PFN+SFPR S + S
Sbjct: 125 DGSGQSN-FTLELDFEPFNASFPRPSLSKS 153


>sp|P04712|SUS1_MAIZE Sucrose synthase 1 OS=Zea mays GN=SH-1 PE=2
SV=1
Length = 802

Score = 157 bits (396), Expect = 5e-38
Identities = 84/151 (55%), Positives = 111/151 (73%), Gaps = 1/151 (0%)
Frame = +1

Query: 175 AALSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQSFDQNVI 354
A L+RL S+ +R+ S HPNEL++LFS YV GK +LQ H++ E + L FD +
Sbjct: 3 AKLTRLHSLRERLGATFSSHPNELIALFSRYVHQGKGMLQRHQLLAEFDAL---FDSDKE 59

Query: 355 K-EEFVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYLQFKEQL 531
K F +L+AAQEAIV PPWVALAIRP+PG+W+Y+RVNV EL ++EL+VSEYL FKEQL
Sbjct: 60 KYAPFEDILRAAQEAIVLPPWVALAIRPRPGVWDYIRVNVSELAVEELSVSEYLAFKEQL 119

Query: 532 VEEERVTDPYVLELDFGPFNSSFPRLSRASS 624
V+ + ++ +VLELDF PFN+SFPR S + S
Sbjct: 120 VDGQSNSN-FVLELDFEPFNASFPRPSMSKS 149


>sp|P30298|SUS1_ORYSJ Sucrose synthase 1 OS=Oryza sativa subsp.
japonica GN=SS1 PE=2 SV=2
Length = 808

Score = 155 bits (393), Expect = 1e-37
Identities = 81/150 (54%), Positives = 107/150 (71%)
Frame = +1

Query: 175 AALSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQSFDQNVI 354
A L+RL S+ +R+ S HPNEL++LFS YV GK +LQ H++ E + L ++ +
Sbjct: 3 AKLARLHSLRERLGATFSSHPNELIALFSRYVNQGKGMLQRHQLLAEFDALIEADKEKYA 62

Query: 355 KEEFVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYLQFKEQLV 534
F +L+AAQEAIV PPWVALAIRP+PG+W+Y+RVNV EL ++EL+VSEYL FKEQLV
Sbjct: 63 P--FEDILRAAQEAIVLPPWVALAIRPRPGVWDYIRVNVSELAVEELSVSEYLAFKEQLV 120

Query: 535 EEERVTDPYVLELDFGPFNSSFPRLSRASS 624
+ +VLELDF PFN+SFPR S + S
Sbjct: 121 -DGHTNSNFVLELDFEPFNASFPRPSMSKS 149


>sp|P31924|SUS2_ORYSJ Sucrose synthase 2 OS=Oryza sativa subsp.
japonica GN=SS2 PE=3 SV=1
Length = 816

Score = 155 bits (391), Expect = 2e-37
Identities = 85/157 (54%), Positives = 107/157 (68%), Gaps = 1/157 (0%)
Frame = +1

Query: 157 GSTSRMAALSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQS 336
G + LSRL S+ +R+ LS HPNELV++F+ V GK +LQ H+I E
Sbjct: 2 GEAAGDRVLSRLHSVRERIGDSLSAHPNELVAVFTRLVNLGKGMLQAHQIIAEYNNAISE 61

Query: 337 FDQNVIKE-EFVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYL 513
D+ +K+ F VL++AQE IV PWVALAIRP+PG+WEYVRVNV EL ++ LTV EYL
Sbjct: 62 ADREKLKDGAFEDVLRSAQEGIVISPWVALAIRPRPGVWEYVRVNVSELAVELLTVPEYL 121

Query: 514 QFKEQLVEEERVTDPYVLELDFGPFNSSFPRLSRASS 624
QFKEQLV EE + +VLELDF PFN+SFPR S + S
Sbjct: 122 QFKEQLV-EEGTNNNFVLELDFEPFNASFPRPSLSKS 157


>sp|P31923|SUS2_HORVU Sucrose synthase 2 OS=Hordeum vulgare GN=SS2
PE=1 SV=1
Length = 816

Score = 154 bits (388), Expect = 5e-37
Identities = 84/157 (53%), Positives = 107/157 (68%), Gaps = 1/157 (0%)
Frame = +1

Query: 157 GSTSRMAALSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQS 336
G T+ ALSR+ S+ +R+ LS H NELV++FS V GK +LQPH+I E
Sbjct: 2 GETAGERALSRVHSVRERIGHSLSAHTNELVAVFSRLVNQGKGMLQPHQITAEYNAAIPE 61

Query: 337 FDQNVIKEE-FVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYL 513
++ +K F +L+ AQEAIV PPWVALAIRP+PG+WEYVRVNV EL ++EL+V YL
Sbjct: 62 AEREKLKNTPFEDLLRGAQEAIVIPPWVALAIRPRPGVWEYVRVNVSELGVEELSVLRYL 121

Query: 514 QFKEQLVEEERVTDPYVLELDFGPFNSSFPRLSRASS 624
QFKEQL + +VLELDFGPFN+SFPR S + S
Sbjct: 122 QFKEQLANGS-TDNNFVLELDFGPFNASFPRPSLSKS 157


>sp|Q43009|SUS3_ORYSJ Sucrose synthase 3 OS=Oryza sativa subsp.
japonica GN=SS3 PE=3 SV=2
Length = 816

Score = 153 bits (387), Expect = 6e-37
Identities = 82/157 (52%), Positives = 110/157 (70%), Gaps = 1/157 (0%)
Frame = +1

Query: 157 GSTSRMAALSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQS 336
G T+ AL+RL SM +R+ LS H NELV++FS V GK +LQPH+I E
Sbjct: 2 GETTGERALTRLHSMRERIGDSLSAHTNELVAVFSRLVNQGKGMLQPHQIIAEYNAAIPE 61

Query: 337 FDQNVIKEEFVF-VLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYL 513
++ +K+ + VL+ AQEAIV PPW+ALAIRP+PG+WEY+R+NV +L ++EL+V EYL
Sbjct: 62 GEREKLKDSALEDVLRGAQEAIVIPPWIALAIRPRPGVWEYLRINVSQLGVEELSVPEYL 121

Query: 514 QFKEQLVEEERVTDPYVLELDFGPFNSSFPRLSRASS 624
QFKEQLV+ + +VLELDF PFN+SFPR S + S
Sbjct: 122 QFKEQLVDGS-TQNNFVLELDFEPFNASFPRPSLSKS 157


>sp|O24301|SUS2_PEA Sucrose synthase 2 OS=Pisum sativum GN=SUS2 PE=2
SV=1
Length = 809

Score = 153 bits (387), Expect = 6e-37
Identities = 81/149 (54%), Positives = 109/149 (73%), Gaps = 2/149 (1%)
Frame = +1

Query: 184 SRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQSFDQNVIKEE 363
+R+PS+ DRVQ LS H NEL+SL S YVA GK ILQPH + EL+ + + +
Sbjct: 8 TRVPSIRDRVQDTLSAHRNELISLLSRYVAQGKGILQPHNLIDELDNILGEDHATLDLKN 67

Query: 364 FVF--VLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYLQFKEQLVE 537
F ++ +AQEAIV PP+VA+A+RP+PG+WEYVRVNV EL++++L+VSEYL FKE+LV
Sbjct: 68 GPFGQIINSAQEAIVLPPFVAIAVRPRPGVWEYVRVNVFELSVEQLSVSEYLSFKEELV- 126

Query: 538 EERVTDPYVLELDFGPFNSSFPRLSRASS 624
E + D +LELD PFN+SFPR +R+SS
Sbjct: 127 EGKSNDNIILELDLEPFNASFPRPTRSSS 155


>sp|Q41608|SUS1_TULGE Sucrose synthase 1 OS=Tulipa gesneriana PE=2
SV=1
Length = 805

Score = 141 bits (355), Expect = 3e-33
Identities = 74/149 (49%), Positives = 107/149 (71%), Gaps = 1/149 (0%)
Frame = +1

Query: 181 LSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQSFDQNVIKE 360
L+R+ S+ +R+ LS HPNEL++LFS ++ GK +L+ H++ E E + D+ +K+
Sbjct: 6 LTRIHSIKERLGDSLSHHPNELLALFSRFIKQGKGMLERHQLLTEYESVIPEADREKLKD 65

Query: 361 E-FVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYLQFKEQLVE 537
F L+A+QEAIV PPWVALAIRP+PG+WEYVRVNV+EL ++E SEYL+FKE LV+
Sbjct: 66 GVFEDTLRASQEAIVIPPWVALAIRPRPGVWEYVRVNVNELAVEE--CSEYLKFKEDLVD 123

Query: 538 EERVTDPYVLELDFGPFNSSFPRLSRASS 624
++ +VLE+DF PFN++ PR S + S
Sbjct: 124 RSSQSN-FVLEMDFEPFNANVPRPSLSKS 151


tr_hit_id Q10LP5
Definition tr|Q10LP5|Q10LP5_ORYSJ Os03g0340500 protein OS=Oryza sativa subsp. japonica
Align length 148
Score (bit) 167.0
E-value 4.0e-40
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK951167|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_K20, 5'
(625 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q10LP5|Q10LP5_ORYSJ Os03g0340500 protein OS=Oryza sativa subs... 167 4e-40
tr|Q10LP3|Q10LP3_ORYSJ Sucrose synthase 2, putative, expressed O... 167 4e-40
tr|B8APD5|B8APD5_ORYSI Putative uncharacterized protein OS=Oryza... 167 4e-40
tr|Q7X9B7|Q7X9B7_ACTDE Sucrose synthase (Fragment) OS=Actinidia ... 166 1e-39
tr|Q8W1W4|Q8W1W4_BAMOL Sucrose synthase OS=Bambusa oldhamii PE=2... 163 9e-39
tr|Q8L5H0|Q8L5H0_MAIZE Sucrose synthase 3 OS=Zea mays PE=2 SV=1 163 9e-39
tr|O82073|O82073_WHEAT Sucrose synthase type I OS=Triticum aesti... 162 2e-38
tr|A6N837|A6N837_PINTA Sucrose synthase OS=Pinus taeda GN=SuSy1 ... 160 8e-38
tr|A9SUG0|A9SUG0_PHYPA Predicted protein OS=Physcomitrella paten... 159 1e-37
tr|Q43706|Q43706_MAIZE Sus1 protein OS=Zea mays GN=sus1 PE=4 SV=1 159 1e-37
tr|B2ZG28|B2ZG28_MAIZE Trehalose-6-phosphate synthase OS=Zea may... 159 1e-37
tr|A7Q8G2|A7Q8G2_VITVI Chromosome chr5 scaffold_64, whole genome... 159 1e-37
tr|Q9SLV8|Q9SLV8_CITUN Sucrose synthase OS=Citrus unshiu GN=CitS... 158 2e-37
tr|Q94G60|Q94G60_BETVU Sucrose synthase OS=Beta vulgaris PE=4 SV=1 158 2e-37
tr|Q5TK93|Q5TK93_BAMOL Sucrose synthase OS=Bambusa oldhamii PE=2... 158 2e-37
tr|A6ZEA3|A6ZEA3_BETVU Sucrose synthase 1 OS=Beta vulgaris GN=SB... 158 2e-37
tr|Q9SLY2|Q9SLY2_CITUN Sucrose synthase OS=Citrus unshiu GN=CitS... 158 3e-37
tr|Q9ZPC5|Q9ZPC5_CRAPL Sucrose synthase OS=Craterostigma plantag... 157 6e-37
tr|B6U1D7|B6U1D7_MAIZE Sucrose synthase 1 OS=Zea mays PE=2 SV=1 157 6e-37
tr|Q8W1W3|Q8W1W3_BAMOL Sucrose synthase OS=Bambusa oldhamii PE=2... 156 8e-37
tr|Q93WS3|Q93WS3_MAIZE Sucrose synthase (Fragment) OS=Zea mays P... 156 1e-36
tr|A5C6H7|A5C6H7_VITVI Putative uncharacterized protein (Chromos... 156 1e-36
tr|Q0DDW2|Q0DDW2_ORYSJ Os06g0194900 protein OS=Oryza sativa subs... 155 1e-36
tr|A2XHR1|A2XHR1_ORYSI Putative uncharacterized protein OS=Oryza... 155 2e-36
tr|Q8W1W2|Q8W1W2_BAMOL Sucrose synthase OS=Bambusa oldhamii PE=2... 155 2e-36
tr|Q10K08|Q10K08_ORYSJ Os03g0401300 protein OS=Oryza sativa subs... 155 2e-36
tr|Q10K07|Q10K07_ORYSJ Sucrose synthase 2, putative, expressed O... 155 2e-36
tr|Q9LKR0|Q9LKR0_SACOF Sucrose synthase-2 OS=Saccharum officinar... 154 3e-36
tr|Q9FRX3|Q9FRX3_PYRPY Sucrose synthase 1 OS=Pyrus pyrifolia GN=... 154 4e-36
tr|Q8LJT4|Q8LJT4_9ASPA Sucrose synthase OS=x Mokara cv. 'Yellow'... 154 4e-36

>tr|Q10LP5|Q10LP5_ORYSJ Os03g0340500 protein OS=Oryza sativa subsp.
japonica GN=Os03g0340500 PE=2 SV=1
Length = 809

Score = 167 bits (424), Expect = 4e-40
Identities = 84/148 (56%), Positives = 115/148 (77%)
Frame = +1

Query: 181 LSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQSFDQNVIKE 360
L R PS+ DRV+ L H NELV+L S YV+ GK ILQPH I L+++ S + +++
Sbjct: 6 LDRTPSIRDRVEDTLHAHRNELVALLSKYVSQGKGILQPHHILDALDEVQSSGGRALVEG 65

Query: 361 EFVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYLQFKEQLVEE 540
F+ VL++AQEAIV PP+VA+A+RP+PG+WEYVRVNV EL++++LTVSEYL+FKE+LV+
Sbjct: 66 PFLDVLRSAQEAIVLPPFVAIAVRPRPGVWEYVRVNVHELSVEQLTVSEYLRFKEELVDG 125

Query: 541 ERVTDPYVLELDFGPFNSSFPRLSRASS 624
+ DPY+LELDF PFN+S PR +R+SS
Sbjct: 126 Q-YNDPYILELDFEPFNASVPRPNRSSS 152


>tr|Q10LP3|Q10LP3_ORYSJ Sucrose synthase 2, putative, expressed
OS=Oryza sativa subsp. japonica GN=LOC_Os03g22120 PE=4
SV=1
Length = 677

Score = 167 bits (424), Expect = 4e-40
Identities = 84/148 (56%), Positives = 115/148 (77%)
Frame = +1

Query: 181 LSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQSFDQNVIKE 360
L R PS+ DRV+ L H NELV+L S YV+ GK ILQPH I L+++ S + +++
Sbjct: 6 LDRTPSIRDRVEDTLHAHRNELVALLSKYVSQGKGILQPHHILDALDEVQSSGGRALVEG 65

Query: 361 EFVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYLQFKEQLVEE 540
F+ VL++AQEAIV PP+VA+A+RP+PG+WEYVRVNV EL++++LTVSEYL+FKE+LV+
Sbjct: 66 PFLDVLRSAQEAIVLPPFVAIAVRPRPGVWEYVRVNVHELSVEQLTVSEYLRFKEELVDG 125

Query: 541 ERVTDPYVLELDFGPFNSSFPRLSRASS 624
+ DPY+LELDF PFN+S PR +R+SS
Sbjct: 126 Q-YNDPYILELDFEPFNASVPRPNRSSS 152


>tr|B8APD5|B8APD5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_11498 PE=4 SV=1
Length = 809

Score = 167 bits (424), Expect = 4e-40
Identities = 84/148 (56%), Positives = 115/148 (77%)
Frame = +1

Query: 181 LSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQSFDQNVIKE 360
L R PS+ DRV+ L H NELV+L S YV+ GK ILQPH I L+++ S + +++
Sbjct: 6 LDRTPSIRDRVEDTLHAHRNELVALLSKYVSQGKGILQPHHILDALDEVQSSGGRALVEG 65

Query: 361 EFVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYLQFKEQLVEE 540
F+ VL++AQEAIV PP+VA+A+RP+PG+WEYVRVNV EL++++LTVSEYL+FKE+LV+
Sbjct: 66 PFLDVLRSAQEAIVLPPFVAIAVRPRPGVWEYVRVNVHELSVEQLTVSEYLRFKEELVDG 125

Query: 541 ERVTDPYVLELDFGPFNSSFPRLSRASS 624
+ DPY+LELDF PFN+S PR +R+SS
Sbjct: 126 Q-YNDPYILELDFEPFNASVPRPNRSSS 152


>tr|Q7X9B7|Q7X9B7_ACTDE Sucrose synthase (Fragment) OS=Actinidia
deliciosa GN=SusA PE=2 SV=1
Length = 184

Score = 166 bits (419), Expect = 1e-39
Identities = 88/152 (57%), Positives = 116/152 (76%), Gaps = 2/152 (1%)
Frame = +1

Query: 175 AALSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQSFDQNV- 351
A L+R+PSM +RV+ LS H NELVSL S YV GK ILQPH + EL+K+ + N+
Sbjct: 4 AKLARIPSMRERVEDTLSAHRNELVSLLSRYVEQGKGILQPHHLIDELDKIVGDDEANLT 63

Query: 352 -IKEEFVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYLQFKEQ 528
I F VL++AQEAIV PP+VA+AIRP+PG+WEYVRVNV EL++++L+V+EYL+FKE+
Sbjct: 64 LIDGPFGDVLKSAQEAIVLPPFVAMAIRPRPGVWEYVRVNVYELSVEQLSVAEYLRFKEE 123

Query: 529 LVEEERVTDPYVLELDFGPFNSSFPRLSRASS 624
LV+ + D YVLELDF PFN++FPR +R SS
Sbjct: 124 LVDGQS-NDQYVLELDFEPFNATFPRPTRTSS 154


>tr|Q8W1W4|Q8W1W4_BAMOL Sucrose synthase OS=Bambusa oldhamii PE=2
SV=1
Length = 816

Score = 163 bits (412), Expect = 9e-39
Identities = 88/157 (56%), Positives = 111/157 (70%), Gaps = 1/157 (0%)
Frame = +1

Query: 157 GSTSRMAALSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQS 336
G T+ LSRL S+ +R+ LS HPNELV++F+ V GK +LQPH+I E
Sbjct: 2 GETAGDRVLSRLHSVRERIGDSLSAHPNELVAVFTRLVNLGKGMLQPHQIIAEYNNAIPE 61

Query: 337 FDQNVIKE-EFVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYL 513
+++ +K+ F VL+AAQEAIV PPWVALAIRP+PG+WEYVRVNV EL ++EL V EYL
Sbjct: 62 AERDKLKDGAFEDVLRAAQEAIVIPPWVALAIRPRPGVWEYVRVNVSELAVEELRVPEYL 121

Query: 514 QFKEQLVEEERVTDPYVLELDFGPFNSSFPRLSRASS 624
QFKEQLVE + +VLELDF PFN+SFPR S + S
Sbjct: 122 QFKEQLVEGS-TNNNFVLELDFEPFNASFPRPSLSKS 157


>tr|Q8L5H0|Q8L5H0_MAIZE Sucrose synthase 3 OS=Zea mays PE=2 SV=1
Length = 809

Score = 163 bits (412), Expect = 9e-39
Identities = 85/148 (57%), Positives = 112/148 (75%)
Frame = +1

Query: 181 LSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQSFDQNVIKE 360
L R PS+ DRV+ L H NELV+L S YV GK ILQPH I L+++ S + + +
Sbjct: 6 LDRNPSIRDRVEDTLHAHRNELVALLSKYVNKGKGILQPHHILDALDEVQGSGGRALAEG 65

Query: 361 EFVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYLQFKEQLVEE 540
F+ VL++AQEAIV PP+VA+A+RP+PG+WEYVRVNV EL++++LTVSEYL+FKE+LV+
Sbjct: 66 PFLDVLRSAQEAIVLPPFVAIAVRPRPGVWEYVRVNVHELSVEQLTVSEYLRFKEELVDG 125

Query: 541 ERVTDPYVLELDFGPFNSSFPRLSRASS 624
+ DPYVLELDF PFN S PR +R+SS
Sbjct: 126 QH-NDPYVLELDFEPFNVSVPRPNRSSS 152


>tr|O82073|O82073_WHEAT Sucrose synthase type I OS=Triticum aestivum
GN=Ss1 PE=2 SV=1
Length = 808

Score = 162 bits (409), Expect = 2e-38
Identities = 84/150 (56%), Positives = 110/150 (73%)
Frame = +1

Query: 175 AALSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQSFDQNVI 354
A L+RL S+ +R+ S HPNEL++LFS YV GK +LQ H++ E + L +S +
Sbjct: 3 AKLTRLHSLRERLGATFSSHPNELIALFSRYVHQGKGMLQRHQLLAEFDALFESDKEKYA 62

Query: 355 KEEFVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYLQFKEQLV 534
F +L+AAQEAIV PPWVALAIRP+PG+W+Y+RVNV EL ++ELTVSEYL FKEQLV
Sbjct: 63 P--FEDILRAAQEAIVLPPWVALAIRPRPGVWDYIRVNVSELAVEELTVSEYLAFKEQLV 120

Query: 535 EEERVTDPYVLELDFGPFNSSFPRLSRASS 624
+E + +VLELDF PFN+SFPR S ++S
Sbjct: 121 -DEHASSKFVLELDFEPFNASFPRPSMSNS 149


>tr|A6N837|A6N837_PINTA Sucrose synthase OS=Pinus taeda GN=SuSy1
PE=2 SV=1
Length = 833

Score = 160 bits (404), Expect = 8e-38
Identities = 87/155 (56%), Positives = 111/155 (71%), Gaps = 5/155 (3%)
Frame = +1

Query: 175 AALSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQSFDQNVI 354
AA++ S +RV+ LS+H NE+VSL S YVA GK ILQPH++ L+ L + +NV
Sbjct: 4 AAITHALSSRERVEDMLSEHRNEIVSLLSRYVAEGKKILQPHQL---LDGLEEVIGKNVE 60

Query: 355 KEE-----FVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYLQF 519
E F VL++ QEAIV PPW+ALA+RP+PG+WEYVRVNVDEL ++L+V+EYL+F
Sbjct: 61 LESLRHGLFGEVLRSTQEAIVLPPWIALAVRPRPGVWEYVRVNVDELAAEQLSVAEYLEF 120

Query: 520 KEQLVEEERVTDPYVLELDFGPFNSSFPRLSRASS 624
KE LV V D YVLELDF PFN+SFPR +R SS
Sbjct: 121 KEHLVNGS-VKDDYVLELDFEPFNASFPRPTRPSS 154


>tr|A9SUG0|A9SUG0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_188513 PE=4 SV=1
Length = 834

Score = 159 bits (403), Expect = 1e-37
Identities = 80/157 (50%), Positives = 106/157 (67%), Gaps = 1/157 (0%)
Frame = +1

Query: 157 GSTSRMAALSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQS 336
G + L RL S+ +RVQ + +H N ++ L S YV G+ LQPH I EL LT++
Sbjct: 5 GVAPKKPVLQRLNSIQERVQSAVQEHRNVIIDLLSRYVKQGRTHLQPHHIVDELNSLTEA 64

Query: 337 FDQNVIKEE-FVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYL 513
IK+ F +L QEAIV PPW+ LA+RP+PG+WEY+R+NV+EL L+EL+VSEYL
Sbjct: 65 DRVTEIKDSAFGLLLLNCQEAIVLPPWLGLAVRPRPGIWEYLRINVEELILEELSVSEYL 124

Query: 514 QFKEQLVEEERVTDPYVLELDFGPFNSSFPRLSRASS 624
FKEQL V DP++LELD PFNS+FPR++R SS
Sbjct: 125 GFKEQLANSTDVRDPFLLELDMAPFNSNFPRMTRPSS 161


>tr|Q43706|Q43706_MAIZE Sus1 protein OS=Zea mays GN=sus1 PE=4 SV=1
Length = 816

Score = 159 bits (402), Expect = 1e-37
Identities = 86/149 (57%), Positives = 107/149 (71%), Gaps = 1/149 (0%)
Frame = +1

Query: 181 LSRLPSMHDRVQGCLSQHPNELVSLFSAYVAFGKHILQPHEIRRELEKLTQSFDQNVIKE 360
LSRL S+ +R+ LS HPNELV++F+ GK +LQPH+I E ++ +K+
Sbjct: 10 LSRLHSVRERIGDSLSAHPNELVAVFTRLKNLGKGMLQPHQIIAEYNNAIPEAEREKLKD 69

Query: 361 -EFVFVLQAAQEAIVYPPWVALAIRPKPGLWEYVRVNVDELTLDELTVSEYLQFKEQLVE 537
F VL+AAQEAIV PPWVALAIRP+PG+WEYVRVNV EL ++EL V EYLQFKEQLV
Sbjct: 70 GAFEDVLRAAQEAIVIPPWVALAIRPRPGVWEYVRVNVSELAVEELRVPEYLQFKEQLV- 128

Query: 538 EERVTDPYVLELDFGPFNSSFPRLSRASS 624
EE + +VLELDF PFN+SFPR S + S
Sbjct: 129 EEGPNNNFVLELDFEPFNASFPRPSLSKS 157