DK951236
Clone id TST38A01NGRL0010_N19
Library
Length 597
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_N19. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
CCAACACGTGAAAGAGATGTTGCAACTCTTTTCTCAAGTAAAGGCACAGATGCAAGAGAT
TCAGGCAGAGGAGACTCTTTCAAAAAAGACTTCTCCCAAGCATGACACACATGATTTGCA
TGATGATTTGATGACAATGATATGCATGATCAAGATGTGATTTCTCACAAGTATGATGAT
TTGCATGAAGATGACGTGATTGTTCACAAGGATGATGAGTTAGTTGATGCTTTTTCGAGG
GAAGCTAACCTCGTTGCAGGTTCGATCAATCACGATGGATCGATCTTGGCTCTCGAGACT
AGGTCCAAAGCACCCCTTCAGGAAGAATTGATCTTGGCTCTCGAGCGTAGGTCCCAAAGA
ACTTTTTTTTTTCCCCCCCCCCCCCTCGCATGATTGATACGCACAAAAAAAAAGAGGGGG
GCATTCGTGATCGTTTCCTGTATTTTAATCAGCATCTTTATGTGATCCCTTTTACTAGGC
ATGACATATTGTACGTTGAGCACGTTTCACTCATGAATGAGCACGGATGTATGCAAATTA
TTCATGACAAACTGAAAAGTATGCATTCAAGGAAGTCACATTCCATGTCTCTTCCTT
■■Homology search results ■■ -
sp_hit_id Q8IW03
Definition sp|Q8IW03|SIAHL_HUMAN Seven in absentia-like protein FLJ39203 OS=Homo sapiens
Align length 31
Score (bit) 31.6
E-value 3.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK951236|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_N19, 5'
(597 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8IW03|SIAHL_HUMAN Seven in absentia-like protein FLJ39203 OS... 32 3.2
sp|Q09446|DNJ5_CAEEL DnaJ homolog dnj-5 OS=Caenorhabditis elegan... 31 4.1
sp|Q8NEC5|CTSR1_HUMAN Cation channel sperm-associated protein 1 ... 31 4.1
sp|Q8MP30|Y7791_DICDI Uncharacterized histidine-rich protein DDB... 31 5.4
sp|A1TNU7|MUTS_ACIAC DNA mismatch repair protein mutS OS=Acidovo... 31 5.5
sp|Q7Z417|NUFP2_HUMAN Nuclear fragile X mental retardation-inter... 30 7.1
sp|P04929|HRPX_PLALO Histidine-rich glycoprotein OS=Plasmodium l... 30 7.1
sp|A6UUK5|RRMJ_META3 Ribosomal RNA large subunit methyltransfera... 30 7.1
sp|Q9VP48|RAB26_DROME Ras-related protein Rab-26 OS=Drosophila m... 30 9.2

>sp|Q8IW03|SIAHL_HUMAN Seven in absentia-like protein FLJ39203
OS=Homo sapiens PE=2 SV=3
Length = 269

Score = 31.6 bits (70), Expect = 3.2
Identities = 12/31 (38%), Positives = 15/31 (48%)
Frame = -3

Query: 229 HQLTHHPCEQSRHLHANHHTCEKSHLDHAYH 137
H L+HH C H H HH +H H +H
Sbjct: 66 HHLSHHHCHHRHHHHLRHH----AHPHHLHH 92


>sp|Q09446|DNJ5_CAEEL DnaJ homolog dnj-5 OS=Caenorhabditis elegans
GN=dnj-5 PE=2 SV=2
Length = 915

Score = 31.2 bits (69), Expect = 4.1
Identities = 15/43 (34%), Positives = 19/43 (44%)
Frame = -3

Query: 244 LPSKKHQLTHHPCEQSRHLHANHHTCEKSHLDHAYHCHQIIMQ 116
LPS ++ HHP Q H H N H H H H + +Q
Sbjct: 128 LPSTPSRVPHHPSSQVHHFHHNLH--------HHTHTHNVQVQ 162


>sp|Q8NEC5|CTSR1_HUMAN Cation channel sperm-associated protein 1
OS=Homo sapiens GN=CATSPER1 PE=1 SV=2
Length = 780

Score = 31.2 bits (69), Expect = 4.1
Identities = 21/59 (35%), Positives = 25/59 (42%), Gaps = 4/59 (6%)
Frame = -3

Query: 292 EPRSIHRD*SNLQRG*LP--SKKHQLTHHPCEQSR--HLHANHHTCEKSHLDHAYHCHQ 128
E S H + QRG S+ HQ HHP E H H H ++H YH HQ
Sbjct: 245 ETISPHSSVGSYQRGISDYHSEYHQGDHHPSEYHHGDHPHHTQHHYHQTHRHRDYHQHQ 303


>sp|Q8MP30|Y7791_DICDI Uncharacterized histidine-rich protein
DDB0167791 OS=Dictyostelium discoideum GN=DDB_G0274557
PE=4 SV=1
Length = 233

Score = 30.8 bits (68), Expect = 5.4
Identities = 12/33 (36%), Positives = 14/33 (42%)
Frame = -3

Query: 229 HQLTHHPCEQSRHLHANHHTCEKSHLDHAYHCH 131
H HHP H H +HH H H +H H
Sbjct: 91 HHHHHHPHHPHHHPHHHHHPHHHHHHHHHHHHH 123



Score = 30.0 bits (66), Expect = 9.2
Identities = 12/33 (36%), Positives = 13/33 (39%)
Frame = -3

Query: 229 HQLTHHPCEQSRHLHANHHTCEKSHLDHAYHCH 131
H HHP H H HH H H +H H
Sbjct: 94 HHHPHHPHHHPHHHHHPHHHHHHHHHHHHHHHH 126


>sp|A1TNU7|MUTS_ACIAC DNA mismatch repair protein mutS OS=Acidovorax
avenae subsp. citrulli (strain AAC00-1) GN=mutS PE=3
SV=1
Length = 890

Score = 30.8 bits (68), Expect = 5.5
Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 1/45 (2%)
Frame = +1

Query: 181 LHEDDVIVHKDDELVDAFSREANLVAGSINH-DGSILALETRSKA 312
L E +V + D F E + + G NH D +LALETR KA
Sbjct: 443 LEEPSALVRDGGVIADGFDAELDELRGIQNHCDDFLLALETREKA 487


>sp|Q7Z417|NUFP2_HUMAN Nuclear fragile X mental
retardation-interacting protein 2 OS=Homo sapiens
GN=NUFIP2 PE=1 SV=1
Length = 695

Score = 30.4 bits (67), Expect = 7.1
Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 2/36 (5%)
Frame = -3

Query: 229 HQLTHHPCEQSRHLHANHH--TCEKSHLDHAYHCHQ 128
H HHP +Q + H +HH SH H +H HQ
Sbjct: 17 HHPHHHPQQQQQQPHHHHHYYFYNHSHNHHHHHHHQ 52


>sp|P04929|HRPX_PLALO Histidine-rich glycoprotein OS=Plasmodium
lophurae PE=4 SV=1
Length = 351

Score = 30.4 bits (67), Expect = 7.1
Identities = 13/37 (35%), Positives = 14/37 (37%)
Frame = -3

Query: 241 PSKKHQLTHHPCEQSRHLHANHHTCEKSHLDHAYHCH 131
P H H P H HA HH H H +H H
Sbjct: 174 PHHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHH 210



Score = 30.4 bits (67), Expect = 7.1
Identities = 13/37 (35%), Positives = 14/37 (37%)
Frame = -3

Query: 241 PSKKHQLTHHPCEQSRHLHANHHTCEKSHLDHAYHCH 131
P H H P H HA HH H H +H H
Sbjct: 184 PHHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHH 220


>sp|A6UUK5|RRMJ_META3 Ribosomal RNA large subunit methyltransferase
J OS=Methanococcus aeolicus (strain Nankai-3 / ATCC
BAA-1280) GN=rrmJ PE=3 SV=1
Length = 269

Score = 30.4 bits (67), Expect = 7.1
Identities = 17/64 (26%), Positives = 34/64 (53%), Gaps = 3/64 (4%)
Frame = +1

Query: 163 SHKYDDLHEDDVIVHKDDELVDAFSREANLVAGS---INHDGSILALETRSKAPLQEELI 333
S+K L+E I+++ D +VD + S + DG ++ ++ + PL+EE I
Sbjct: 31 SYKLLQLNEKFEIIYEGDNVVDLGCAPGGWLQASYDLVGEDGFVIGVDLQKVKPLREENI 90

Query: 334 LALE 345
+A++
Sbjct: 91 VAIQ 94


>sp|Q9VP48|RAB26_DROME Ras-related protein Rab-26 OS=Drosophila
melanogaster GN=Rab26 PE=1 SV=2
Length = 388

Score = 30.0 bits (66), Expect = 9.2
Identities = 15/43 (34%), Positives = 21/43 (48%)
Frame = -3

Query: 241 PSKKHQLTHHPCEQSRHLHANHHTCEKSHLDHAYHCHQIIMQI 113
PS HQ +HH + S H H +HH+ H YH I+ +
Sbjct: 88 PSHHHQSSHH--QPSHHHHHHHHSQLSLTGSHHYHDDAIMAPV 128


tr_hit_id Q7S140
Definition tr|Q7S140|Q7S140_NEUCR Putative uncharacterized protein OS=Neurospora crassa
Align length 32
Score (bit) 35.8
E-value 1.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK951236|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_N19, 5'
(597 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q7S140|Q7S140_NEUCR Putative uncharacterized protein OS=Neuro... 36 1.9
tr|B4MTN1|B4MTN1_DROWI GK23797 OS=Drosophila willistoni GN=GK237... 35 2.5
tr|B4Q2C3|B4Q2C3_DROYA GE17080 OS=Drosophila yakuba GN=GE17080 P... 35 3.3
tr|Q9VE69|Q9VE69_DROME CG31122 OS=Drosophila melanogaster GN=CG3... 35 4.3
tr|Q5DAV3|Q5DAV3_SCHJA Putative uncharacterized protein OS=Schis... 35 4.3
tr|B4NPW2|B4NPW2_DROWI GK16696 OS=Drosophila willistoni GN=GK166... 34 5.6
tr|Q6YUX3|Q6YUX3_ORYSJ Putative uncharacterized protein OSJNBa00... 34 7.3
tr|B4QUE2|B4QUE2_DROSI GD20168 (Fragment) OS=Drosophila simulans... 34 7.3
tr|B3NRL7|B3NRL7_DROER GG22497 OS=Drosophila erecta GN=GG22497 P... 34 7.4
tr|B4MU36|B4MU36_DROWI GK23965 OS=Drosophila willistoni GN=GK239... 33 9.5

>tr|Q7S140|Q7S140_NEUCR Putative uncharacterized protein
OS=Neurospora crassa GN=NCU09986 PE=4 SV=2
Length = 138

Score = 35.8 bits (81), Expect = 1.9
Identities = 13/32 (40%), Positives = 17/32 (53%)
Frame = -3

Query: 232 KHQLTHHPCEQSRHLHANHHTCEKSHLDHAYH 137
+HQ THH + H H HHT H+ H +H
Sbjct: 97 QHQHTHHHPQLQHHHHYQHHTVHHPHVAHTHH 128


>tr|B4MTN1|B4MTN1_DROWI GK23797 OS=Drosophila willistoni GN=GK23797
PE=4 SV=1
Length = 105

Score = 35.4 bits (80), Expect = 2.5
Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%)
Frame = -3

Query: 229 HQL-THHPCEQSRHLHANHHTCEKSHLDHAYHCHQ 128
HQL THH H H +HH ++ H + YHCHQ
Sbjct: 15 HQLATHHRHRHHHHHHHHHHNHQQQH--YHYHCHQ 47


>tr|B4Q2C3|B4Q2C3_DROYA GE17080 OS=Drosophila yakuba GN=GE17080 PE=4
SV=1
Length = 275

Score = 35.0 bits (79), Expect = 3.3
Identities = 13/38 (34%), Positives = 20/38 (52%)
Frame = -3

Query: 229 HQLTHHPCEQSRHLHANHHTCEKSHLDHAYHCHQIIMQ 116
HQ TH H H + HT +H+ +AYHC +++
Sbjct: 217 HQPTHTHTHTHTHTHTHTHTHSYTHIRYAYHCTHCVLK 254


>tr|Q9VE69|Q9VE69_DROME CG31122 OS=Drosophila melanogaster
GN=CG31122 PE=1 SV=3
Length = 642

Score = 34.7 bits (78), Expect = 4.3
Identities = 16/38 (42%), Positives = 19/38 (50%)
Frame = -3

Query: 241 PSKKHQLTHHPCEQSRHLHANHHTCEKSHLDHAYHCHQ 128
P +H HHP RH H HH+ SH H +H HQ
Sbjct: 593 PQARHH--HHPATSHRHHHHQHHSHHHSH--HHHHHHQ 626


>tr|Q5DAV3|Q5DAV3_SCHJA Putative uncharacterized protein
OS=Schistosoma japonicum PE=2 SV=1
Length = 230

Score = 34.7 bits (78), Expect = 4.3
Identities = 15/37 (40%), Positives = 20/37 (54%)
Frame = -3

Query: 238 SKKHQLTHHPCEQSRHLHANHHTCEKSHLDHAYHCHQ 128
S+ H HH C RH H +HH ++LDH H H+
Sbjct: 89 SRVHHHNHHHCNH-RHHHFHHHYRHHNNLDHHIHHHR 124


>tr|B4NPW2|B4NPW2_DROWI GK16696 OS=Drosophila willistoni GN=GK16696
PE=4 SV=1
Length = 508

Score = 34.3 bits (77), Expect = 5.6
Identities = 12/30 (40%), Positives = 18/30 (60%)
Frame = -3

Query: 217 HHPCEQSRHLHANHHTCEKSHLDHAYHCHQ 128
HH +Q +H H +HH ++ H H +H HQ
Sbjct: 320 HHQQQQQQHHHHHHHQQQQQHHHHHHHHHQ 349


>tr|Q6YUX3|Q6YUX3_ORYSJ Putative uncharacterized protein
OSJNBa0078N11.20 (Putative uncharacterized protein
OSJNBb0024K03.32) OS=Oryza sativa subsp. japonica
GN=OSJNBa0078N11.20 PE=4 SV=1
Length = 93

Score = 33.9 bits (76), Expect = 7.3
Identities = 17/42 (40%), Positives = 24/42 (57%)
Frame = +3

Query: 303 VQSTPSGRIDLGSRA*VPKNFFFSPPPPRMIDTHKKKEGGIR 428
VQS R+++GS P+ F F+PPPP T+ K+ G R
Sbjct: 8 VQSGGGARLEIGSLGCSPRTFQFTPPPP----TNAKRRGSAR 45


>tr|B4QUE2|B4QUE2_DROSI GD20168 (Fragment) OS=Drosophila simulans
GN=GD20168 PE=4 SV=1
Length = 220

Score = 33.9 bits (76), Expect = 7.3
Identities = 15/37 (40%), Positives = 19/37 (51%)
Frame = -3

Query: 241 PSKKHQLTHHPCEQSRHLHANHHTCEKSHLDHAYHCH 131
P +H HHP RH H HH+ SH H++H H
Sbjct: 167 PQARHH--HHPATSHRHHHHQHHSNHHSH-HHSHHHH 200


>tr|B3NRL7|B3NRL7_DROER GG22497 OS=Drosophila erecta GN=GG22497 PE=4
SV=1
Length = 1474

Score = 33.9 bits (76), Expect = 7.4
Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 5/71 (7%)
Frame = +1

Query: 160 ISHKYDDLHEDDVIVHKDDELVDAFSREA-----NLVAGSINHDGSILALETRSKAPLQE 324
I K++D E DV +++L+ REA N + + +DGS L ++ ++APL+
Sbjct: 534 IEGKFEDRSEVDV----ENKLLGPVKREAKKELTNQIGAKLKYDGSALDAKSNAEAPLKG 589

Query: 325 ELILALERRSQ 357
+ L L R+S+
Sbjct: 590 AVPLNLARKSE 600


>tr|B4MU36|B4MU36_DROWI GK23965 OS=Drosophila willistoni GN=GK23965
PE=4 SV=1
Length = 967

Score = 33.5 bits (75), Expect = 9.5
Identities = 13/38 (34%), Positives = 19/38 (50%)
Frame = -3

Query: 244 LPSKKHQLTHHPCEQSRHLHANHHTCEKSHLDHAYHCH 131
LP+ H HHP + H H HH ++ H H ++ H
Sbjct: 383 LPAHPHHHHHHPSLGAPHHHHQHHNQQQQHQHHHHNHH 420