DK953008
Clone id TST38A01NGRL0015_K03
Library
Length 647
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0015_K03. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID
Sequence
CGAGTGCTCTCTGTGTTTCGGCTCGTCGTCCTCGCGAGCTTGACAAGATGAAGTACAACC
CCAGAGTCAGCTGCTCCAGGAGGAAATCTAGAAAGGCCCATTTTACTGCGCCTTCTAGCG
TGAGGCGTGTGCTCATGAGCTCCCCCCTCTCGTCTGCATTGAAGCACAAATATAATGTGC
GATCTGTTCCCGTTCGCAAGGACGATGAAGTGCAAGTGATCAGGGGTACTTACAAGGGAA
GGGAGGGCAAGGTCGTGCAGGTCTACAGGAGAAAATGGGTGATTCACATTGAGAGGATCA
CAAGAGAGAAAGTGAATGGTGCTACTGTGAATGTAGGGATTGACCCCTCTAAGGTGGTGA
TCACGAAGCTCAAGCTTGACAAGGATAGGAAGGCGCTGCTTGATAGGAAAGGAAAGGGTA
GAGCTGCAGAGAAGGGCAAAGGGAAATTCACAAGCGAGGAGGTGGCTGCTCCTCTGCAGG
AAGTAGATTAATCTTGTAGCGGACTCCTTTTGCCATGTACATGTCTGGCAGAATTTTGCG
ATGGTGAGAAACTTCCTAATTTAACTGATTTACCCAGTTACATTGAGAAAATTCTGAATA
CAGATTATGATTACGTGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id P51414
Definition sp|P51414|RL261_ARATH 60S ribosomal protein L26-1 OS=Arabidopsis thaliana
Align length 106
Score (bit) 186.0
E-value 1.0e-46
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK953008|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0015_K03, 5'
(618 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P51414|RL261_ARATH 60S ribosomal protein L26-1 OS=Arabidopsis... 186 1e-46
sp|Q9FJX2|RL262_ARATH 60S ribosomal protein L26-2 OS=Arabidopsis... 181 2e-45
sp|Q39411|RL26_BRARA 60S ribosomal protein L26 OS=Brassica rapa ... 169 8e-42
sp|Q9UNX3|RL26L_HUMAN 60S ribosomal protein L26-like 1 OS=Homo s... 151 2e-36
sp|P61255|RL26_MOUSE 60S ribosomal protein L26 OS=Mus musculus G... 151 3e-36
sp|P61256|RL26_MACFA 60S ribosomal protein L26 OS=Macaca fascicu... 151 3e-36
sp|P61254|RL26_HUMAN 60S ribosomal protein L26 OS=Homo sapiens G... 151 3e-36
sp|P61257|RL26_BOVIN 60S ribosomal protein L26 OS=Bos taurus GN=... 151 3e-36
sp|P12749|RL26_RAT 60S ribosomal protein L26 OS=Rattus norvegicu... 150 4e-36
sp|Q95WA0|RL26_LITLI 60S ribosomal protein L26 OS=Littorina litt... 144 5e-34
sp|Q2I0I6|RL26_AILME 60S ribosomal protein L26 OS=Ailuropoda mel... 144 5e-34
sp|P78946|RL26_SCHPO 60S ribosomal protein L26 OS=Schizosaccharo... 142 1e-33
sp|P47832|RL26_CHICK 60S ribosomal protein L26 (Fragment) OS=Gal... 133 6e-31
sp|Q19869|RL26_CAEEL 60S ribosomal protein L26 OS=Caenorhabditis... 131 2e-30
sp|Q54QM8|RL26_DICDI 60S ribosomal protein L26 OS=Dictyostelium ... 129 2e-29
sp|P53221|RL26B_YEAST 60S ribosomal protein L26-B OS=Saccharomyc... 125 2e-28
sp|P05743|RL26A_YEAST 60S ribosomal protein L26-A OS=Saccharomyc... 125 2e-28
sp|O59429|RL24_PYRHO 50S ribosomal protein L24P OS=Pyrococcus ho... 92 2e-18
sp|Q8U010|RL24_PYRFU 50S ribosomal protein L24P OS=Pyrococcus fu... 92 3e-18
sp|B1L777|RL24_KORCO 50S ribosomal protein L24P OS=Korarchaeum c... 92 3e-18
sp|Q5JJF9|RL24_PYRKO 50S ribosomal protein L24P OS=Pyrococcus ko... 90 1e-17
sp|Q9V1U7|RL24_PYRAB 50S ribosomal protein L24P OS=Pyrococcus ab... 87 7e-17
sp|Q9YF83|RL24_AERPE 50S ribosomal protein L24P OS=Aeropyrum per... 86 2e-16
sp|Q8TW19|RL24_METKA 50S ribosomal protein L24P OS=Methanopyrus ... 84 6e-16
sp|A3DNB8|RL24_STAMF 50S ribosomal protein L24P OS=Staphylotherm... 82 2e-15
sp|O26122|RL24_METTH 50S ribosomal protein L24P OS=Methanobacter... 80 1e-14
sp|A2BMD0|RL24_HYPBU 50S ribosomal protein L24P OS=Hyperthermus ... 79 2e-14
sp|P54038|RL24_METJA 50S ribosomal protein L24P OS=Methanocaldoc... 78 3e-14
sp|A5UL77|RL24_METS3 50S ribosomal protein L24P OS=Methanobrevib... 77 5e-14
sp|A6UQ55|RL24_METVS 50S ribosomal protein L24P OS=Methanococcus... 77 7e-14

>sp|P51414|RL261_ARATH 60S ribosomal protein L26-1 OS=Arabidopsis
thaliana GN=RPL26A PE=2 SV=2
Length = 146

Score = 186 bits (471), Expect = 1e-46
Identities = 90/106 (84%), Positives = 99/106 (93%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MKYNPRV+ SRRK+RKAHFTA SS RRV+MSSPLS+ L+ KYNVRS+P+RKDDEVQ++RG
Sbjct: 1 MKYNPRVTSSRRKNRKAHFTASSSERRVIMSSPLSTDLRQKYNVRSMPIRKDDEVQIVRG 60

Query: 228 TYKGREGKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVIT 365
TYKGREGKVVQVYRRKWVIHIERITREKVNG TVNVGI PSKVVIT
Sbjct: 61 TYKGREGKVVQVYRRKWVIHIERITREKVNGTTVNVGIQPSKVVIT 106


>sp|Q9FJX2|RL262_ARATH 60S ribosomal protein L26-2 OS=Arabidopsis
thaliana GN=RPL26B PE=2 SV=1
Length = 146

Score = 181 bits (460), Expect = 2e-45
Identities = 87/106 (82%), Positives = 101/106 (95%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MK+NPRVS SRRK+RKAHFTAPSSVRRVLMSSPLS L++K+NVRS+P+RKDDEVQV+RG
Sbjct: 1 MKFNPRVSSSRRKNRKAHFTAPSSVRRVLMSSPLSKDLRNKHNVRSMPIRKDDEVQVVRG 60

Query: 228 TYKGREGKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVIT 365
T+KGREGKV+QVYRRKWVIHIERITREKVNG+TVNVG++ S V+IT
Sbjct: 61 TFKGREGKVMQVYRRKWVIHIERITREKVNGSTVNVGVNASNVMIT 106


>sp|Q39411|RL26_BRARA 60S ribosomal protein L26 OS=Brassica rapa
GN=RPL26 PE=2 SV=1
Length = 146

Score = 169 bits (429), Expect = 8e-42
Identities = 81/106 (76%), Positives = 94/106 (88%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MKYNPRV+ SRR++RK HFTA SS RRV MSSPLS+ L+ KYNVRS+P+RKDDE Q++RG
Sbjct: 1 MKYNPRVTSSRRRNRKPHFTASSSERRVXMSSPLSTDLRQKYNVRSMPIRKDDEXQIVRG 60

Query: 228 TYKGREGKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVIT 365
TYKGREGK+ QVYRRK VIHIER+TREKVNG TVNVG+ P+KVVIT
Sbjct: 61 TYKGREGKLXQVYRRKXVIHIERLTREKVNGTTVNVGVQPTKVVIT 106


>sp|Q9UNX3|RL26L_HUMAN 60S ribosomal protein L26-like 1 OS=Homo
sapiens GN=RPL26L1 PE=1 SV=1
Length = 145

Score = 151 bits (382), Expect = 2e-36
Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 1/107 (0%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MK+NP V+ R K+RK HF APS VRR +MSSPLS L+ KYNVRS+P+RKDDEVQV+RG
Sbjct: 1 MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRG 60

Query: 228 TYKGRE-GKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVIT 365
YKG++ GKVVQVYR+K+VI+IER+ REK NG TV+VGI PSKVVIT
Sbjct: 61 HYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVIT 107


>sp|P61255|RL26_MOUSE 60S ribosomal protein L26 OS=Mus musculus
GN=Rpl26 PE=2 SV=1
Length = 145

Score = 151 bits (381), Expect = 3e-36
Identities = 74/107 (69%), Positives = 90/107 (84%), Gaps = 1/107 (0%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MK+NP V+ R K+RK HF APS +RR +MSSPLS L+ KYNVRS+P+RKDDEVQV+RG
Sbjct: 1 MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRG 60

Query: 228 TYKGRE-GKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVIT 365
YKG++ GKVVQVYR+K+VI+IER+ REK NG TV+VGI PSKVVIT
Sbjct: 61 HYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVIT 107


>sp|P61256|RL26_MACFA 60S ribosomal protein L26 OS=Macaca
fascicularis GN=RPL26 PE=2 SV=1
Length = 145

Score = 151 bits (381), Expect = 3e-36
Identities = 74/107 (69%), Positives = 90/107 (84%), Gaps = 1/107 (0%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MK+NP V+ R K+RK HF APS +RR +MSSPLS L+ KYNVRS+P+RKDDEVQV+RG
Sbjct: 1 MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRG 60

Query: 228 TYKGRE-GKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVIT 365
YKG++ GKVVQVYR+K+VI+IER+ REK NG TV+VGI PSKVVIT
Sbjct: 61 HYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVIT 107


>sp|P61254|RL26_HUMAN 60S ribosomal protein L26 OS=Homo sapiens
GN=RPL26 PE=1 SV=1
Length = 145

Score = 151 bits (381), Expect = 3e-36
Identities = 74/107 (69%), Positives = 90/107 (84%), Gaps = 1/107 (0%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MK+NP V+ R K+RK HF APS +RR +MSSPLS L+ KYNVRS+P+RKDDEVQV+RG
Sbjct: 1 MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRG 60

Query: 228 TYKGRE-GKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVIT 365
YKG++ GKVVQVYR+K+VI+IER+ REK NG TV+VGI PSKVVIT
Sbjct: 61 HYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVIT 107


>sp|P61257|RL26_BOVIN 60S ribosomal protein L26 OS=Bos taurus
GN=RPL26 PE=2 SV=1
Length = 145

Score = 151 bits (381), Expect = 3e-36
Identities = 74/107 (69%), Positives = 90/107 (84%), Gaps = 1/107 (0%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MK+NP V+ R K+RK HF APS +RR +MSSPLS L+ KYNVRS+P+RKDDEVQV+RG
Sbjct: 1 MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRG 60

Query: 228 TYKGRE-GKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVIT 365
YKG++ GKVVQVYR+K+VI+IER+ REK NG TV+VGI PSKVVIT
Sbjct: 61 HYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVIT 107


>sp|P12749|RL26_RAT 60S ribosomal protein L26 OS=Rattus norvegicus
GN=Rpl26 PE=1 SV=1
Length = 145

Score = 150 bits (380), Expect = 4e-36
Identities = 74/107 (69%), Positives = 90/107 (84%), Gaps = 1/107 (0%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MK+NP V+ R K+RK HF APS +RR +MSSPLS L+ KYNVRS+P+RKDDEVQV+RG
Sbjct: 1 MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRG 60

Query: 228 TYKGRE-GKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVIT 365
YKG++ GKVVQVYR+K+VI+IER+ REK NG TV+VGI PSKVVIT
Sbjct: 61 HYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIRPSKVVIT 107


>sp|Q95WA0|RL26_LITLI 60S ribosomal protein L26 OS=Littorina
littorea GN=RPL26 PE=2 SV=1
Length = 144

Score = 144 bits (362), Expect = 5e-34
Identities = 71/106 (66%), Positives = 87/106 (82%), Gaps = 1/106 (0%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MK+N VS R K+RK HF APS +RR +MSSP+S L+ KYN RS+P+RKDDEVQV+RG
Sbjct: 1 MKFNKMVSSDRGKNRKRHFNAPSHMRRKIMSSPMSKELRQKYNCRSMPIRKDDEVQVVRG 60

Query: 228 TYKGRE-GKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVI 362
+KG++ GKVVQVYR+K+V+HIERI REK NGATV VGI PSKV+I
Sbjct: 61 HFKGQQVGKVVQVYRKKFVVHIERIQREKANGATVYVGIHPSKVLI 106


tr_hit_id A9NUP7
Definition tr|A9NUP7|A9NUP7_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 147
Score (bit) 197.0
E-value 3.0e-49
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK953008|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0015_K03, 5'
(618 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NUP7|A9NUP7_PICSI Putative uncharacterized protein OS=Picea... 197 3e-49
tr|A9NXB2|A9NXB2_PICSI Putative uncharacterized protein OS=Picea... 196 1e-48
tr|A5AD03|A5AD03_VITVI Putative uncharacterized protein (Chromos... 193 6e-48
tr|B4UWB3|B4UWB3_ARAHY Putative L24 ribosomal protein OS=Arachis... 192 2e-47
tr|A9PBY3|A9PBY3_POPTR Putative uncharacterized protein OS=Popul... 190 5e-47
tr|A5AQ64|A5AQ64_VITVI Putative uncharacterized protein (Chromos... 190 5e-47
tr|Q4U3E9|Q4U3E9_IPOBA Putative L24 ribosomal protein OS=Ipomoea... 190 7e-47
tr|A9PB00|A9PB00_POPTR Putative uncharacterized protein OS=Popul... 190 7e-47
tr|Q2QXN5|Q2QXN5_ORYSJ Os12g0150100 protein OS=Oryza sativa subs... 189 1e-46
tr|A2ZI36|A2ZI36_ORYSI Putative uncharacterized protein OS=Oryza... 189 1e-46
tr|Q53Q51|Q53Q51_ORYSJ Ribosomal protein L24, putative (Putative... 188 2e-46
tr|A9P8G8|A9P8G8_POPTR Putative uncharacterized protein OS=Popul... 188 2e-46
tr|A2ZBI3|A2ZBI3_ORYSI Putative uncharacterized protein OS=Oryza... 188 2e-46
tr|A9RJP0|A9RJP0_PHYPA Predicted protein OS=Physcomitrella paten... 188 2e-46
tr|Q9AWS9|Q9AWS9_ORYSJ Putative ribosomal protein L26 OS=Oryza s... 186 7e-46
tr|A2WKH0|A2WKH0_ORYSI Putative uncharacterized protein OS=Oryza... 186 7e-46
tr|A9PDH4|A9PDH4_POPTR Putative uncharacterized protein OS=Popul... 186 9e-46
tr|B6TPG2|B6TPG2_MAIZE 60S ribosomal protein L26-1 OS=Zea mays P... 186 1e-45
tr|O82579|O82579_MAIZE Ribosomal protein L26 (Fragment) OS=Zea m... 185 2e-45
tr|A9RV92|A9RV92_PHYPA Predicted protein (Fragment) OS=Physcomit... 184 3e-45
tr|A9SE51|A9SE51_PHYPA Predicted protein (Fragment) OS=Physcomit... 183 8e-45
tr|A9S9V3|A9S9V3_PHYPA Predicted protein OS=Physcomitrella paten... 182 2e-44
tr|A9SUH7|A9SUH7_PHYPA Predicted protein (Fragment) OS=Physcomit... 180 5e-44
tr|A8HMG7|A8HMG7_CHLRE Ribosomal protein L26 OS=Chlamydomonas re... 167 5e-40
tr|A9T3L6|A9T3L6_PHYPA Predicted protein (Fragment) OS=Physcomit... 162 2e-38
tr|A8NES4|A8NES4_COPC7 Putative uncharacterized protein OS=Copri... 157 6e-37
tr|A7YXM0|A7YXM0_9ALVE Ribosomal protein L24 OS=Perkinsus chesap... 156 8e-37
tr|A7RGT2|A7RGT2_NEMVE Predicted protein OS=Nematostella vectens... 155 2e-36
tr|Q53PZ2|Q53PZ2_ORYSJ 60S ribosomal protein L26-1, putative, ex... 155 2e-36
tr|B6KH63|B6KH63_TOXGO 60S ribosomal protein L26, putative OS=To... 155 2e-36

>tr|A9NUP7|A9NUP7_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 147

Score = 197 bits (502), Expect = 3e-49
Identities = 97/147 (65%), Positives = 115/147 (78%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MKYNPRVS SRRKSRKAHFTAPSSVRR+LMS+PLSS L++K+NVRS+P+RKDDEVQV+RG
Sbjct: 1 MKYNPRVSSSRRKSRKAHFTAPSSVRRILMSAPLSSDLRNKHNVRSIPIRKDDEVQVVRG 60

Query: 228 TYKGREGKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVITXXXXXXXXXXXXXX 407
T+KGREGKVVQVYR+KWVIH+ERITREKVNG TVNVG+ PSKV++T
Sbjct: 61 TFKGREGKVVQVYRKKWVIHVERITREKVNGQTVNVGVHPSKVIVTKLKIDKDRKDLLER 120

Query: 408 XXXXXXXXXXXXXFTSEEVAAPLQEVD 488
FT+++VA PLQ+VD
Sbjct: 121 KGKGRAAEKGKGKFTADDVAQPLQDVD 147


>tr|A9NXB2|A9NXB2_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 147

Score = 196 bits (497), Expect = 1e-48
Identities = 95/147 (64%), Positives = 115/147 (78%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MKYNPRVS SRRKSRKAHFTAPSSVRR+LMS+PL+ L++KYNVRS+P+RKDDEVQV+RG
Sbjct: 1 MKYNPRVSSSRRKSRKAHFTAPSSVRRILMSAPLNPDLRNKYNVRSIPIRKDDEVQVVRG 60

Query: 228 TYKGREGKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVITXXXXXXXXXXXXXX 407
++KGREGKVVQVYR+KWVIH+ERITR+KVNG+TVNVG+ PSKV++T
Sbjct: 61 SFKGREGKVVQVYRKKWVIHVERITRDKVNGSTVNVGVHPSKVIVTKLKLDKDRKSLLER 120

Query: 408 XXXXXXXXXXXXXFTSEEVAAPLQEVD 488
FT+E+VA PLQ+VD
Sbjct: 121 KGKGRAAEKGKGKFTAEDVAQPLQDVD 147


>tr|A5AD03|A5AD03_VITVI Putative uncharacterized protein (Chromosome
chr14 scaffold_9, whole genome shotgun sequence)
OS=Vitis vinifera GN=GSVIVT00038278001 PE=4 SV=1
Length = 151

Score = 193 bits (491), Expect = 6e-48
Identities = 102/151 (67%), Positives = 115/151 (76%), Gaps = 4/151 (2%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MKYNPRV+ SRRK RKAHFTAPSSVRRVLMS+PLS+ L++KYNVRSVP+RKDDEVQV+RG
Sbjct: 1 MKYNPRVTSSRRKCRKAHFTAPSSVRRVLMSAPLSTDLRNKYNVRSVPIRKDDEVQVVRG 60

Query: 228 TYKGREGKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVITXXXXXXXXXXXXXX 407
T+KGREGKVVQVYRRKWVIHIERITREKVNG+TVNVGI+PSKVVI
Sbjct: 61 TFKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVINKLKLDKDRKSLLDR 120

Query: 408 XXXXXXXXXXXXXFTSEEVAA----PLQEVD 488
FT+E+VAA LQE+D
Sbjct: 121 KAKGRAADKAKGKFTAEDVAAAAAPSLQEID 151


>tr|B4UWB3|B4UWB3_ARAHY Putative L24 ribosomal protein OS=Arachis
hypogaea PE=2 SV=1
Length = 146

Score = 192 bits (487), Expect = 2e-47
Identities = 94/106 (88%), Positives = 102/106 (96%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MKYNPRVS SRRKSRKAHFTAPSSVRRVLMS+PL++ L+ KYNVRS+P+RKDDEVQV+RG
Sbjct: 1 MKYNPRVSSSRRKSRKAHFTAPSSVRRVLMSAPLTTDLRSKYNVRSMPIRKDDEVQVVRG 60

Query: 228 TYKGREGKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVIT 365
TYKGREGKVVQVYRRKWVIHIERITREKVNG+TVNVGI PSKVVIT
Sbjct: 61 TYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGIHPSKVVIT 106


>tr|A9PBY3|A9PBY3_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 146

Score = 190 bits (483), Expect = 5e-47
Identities = 90/106 (84%), Positives = 103/106 (97%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MKYNPRVS SRRK+RKAHF+APSSVRR+LMS+PLS+ L+ KYNVRS+P+RKDDE+QV+RG
Sbjct: 1 MKYNPRVSSSRRKNRKAHFSAPSSVRRILMSAPLSTDLRQKYNVRSMPIRKDDEIQVVRG 60

Query: 228 TYKGREGKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVIT 365
TYKGREGKVVQVYRRKWVIH+ERITREKVNG+TVNVGI+PSKVVIT
Sbjct: 61 TYKGREGKVVQVYRRKWVIHVERITREKVNGSTVNVGINPSKVVIT 106


>tr|A5AQ64|A5AQ64_VITVI Putative uncharacterized protein (Chromosome
chr7 scaffold_20, whole genome shotgun sequence)
OS=Vitis vinifera GN=GSVIVT00019661001 PE=4 SV=1
Length = 146

Score = 190 bits (483), Expect = 5e-47
Identities = 92/106 (86%), Positives = 102/106 (96%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MKYNPRVS SRRKSRKAHFTAPSSVRRVLMS+PLS+ L+ KYN RS+P+RKDDEVQV+RG
Sbjct: 1 MKYNPRVSSSRRKSRKAHFTAPSSVRRVLMSAPLSTDLRSKYNARSMPIRKDDEVQVVRG 60

Query: 228 TYKGREGKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVIT 365
T+KGREGKVVQVYRRKWVIH+ERITREKVNG+TVNVGI+PSKVVIT
Sbjct: 61 TFKGREGKVVQVYRRKWVIHVERITREKVNGSTVNVGINPSKVVIT 106


>tr|Q4U3E9|Q4U3E9_IPOBA Putative L24 ribosomal protein OS=Ipomoea
batatas PE=2 SV=1
Length = 146

Score = 190 bits (482), Expect = 7e-47
Identities = 94/106 (88%), Positives = 101/106 (95%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MKYNPRVS SRRKSRKAHFTAPSSVRRVLMS+PLS+ + KYNVRS+PVRKDDEVQV+RG
Sbjct: 1 MKYNPRVSSSRRKSRKAHFTAPSSVRRVLMSAPLSADQRSKYNVRSMPVRKDDEVQVVRG 60

Query: 228 TYKGREGKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVIT 365
TYKGREGKVVQVYR+KWVIHIERITREKVNG+TVNVGI PSKVVIT
Sbjct: 61 TYKGREGKVVQVYRKKWVIHIERITREKVNGSTVNVGIHPSKVVIT 106


>tr|A9PB00|A9PB00_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 146

Score = 190 bits (482), Expect = 7e-47
Identities = 91/106 (85%), Positives = 103/106 (97%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MKYNPRVS SRRK+RKAHF+APSS+RR+LMS+PLS+ L+ KYNVRS+P+RKDDEVQV+RG
Sbjct: 1 MKYNPRVSSSRRKNRKAHFSAPSSLRRILMSAPLSTDLRQKYNVRSMPIRKDDEVQVVRG 60

Query: 228 TYKGREGKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVIT 365
TYKGREGKVVQVYRRKWVIHIERITREKVNG+TVNVGI+PSKVVIT
Sbjct: 61 TYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 106


>tr|Q2QXN5|Q2QXN5_ORYSJ Os12g0150100 protein OS=Oryza sativa subsp.
japonica GN=Os12g0150100 PE=2 SV=1
Length = 150

Score = 189 bits (480), Expect = 1e-46
Identities = 98/150 (65%), Positives = 113/150 (75%), Gaps = 3/150 (2%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MK NPRV+ SRRK RKAHFTAPSSVRRVLMS+ LS+ L+HKYNVRS+P+RKDDEVQV+RG
Sbjct: 1 MKRNPRVTSSRRKCRKAHFTAPSSVRRVLMSAALSTELRHKYNVRSIPIRKDDEVQVVRG 60

Query: 228 TYKGREGKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVITXXXXXXXXXXXXXX 407
+YKGREGKVVQVYRR+WVIH+ERITREKVNG+TVNVGI PSKVV+T
Sbjct: 61 SYKGREGKVVQVYRRRWVIHVERITREKVNGSTVNVGIHPSKVVVTKLKLDKDRKAILDR 120

Query: 408 XXXXXXXXXXXXXFTSEEVA---APLQEVD 488
FT+E+VA A LQE+D
Sbjct: 121 KASGRAADKAKGKFTAEDVAAAGASLQEID 150


>tr|A2ZI36|A2ZI36_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_37478 PE=4 SV=1
Length = 150

Score = 189 bits (480), Expect = 1e-46
Identities = 98/150 (65%), Positives = 113/150 (75%), Gaps = 3/150 (2%)
Frame = +3

Query: 48 MKYNPRVSCSRRKSRKAHFTAPSSVRRVLMSSPLSSALKHKYNVRSVPVRKDDEVQVIRG 227
MK NPRV+ SRRK RKAHFTAPSSVRRVLMS+ LS+ L+HKYNVRS+P+RKDDEVQV+RG
Sbjct: 1 MKRNPRVTSSRRKCRKAHFTAPSSVRRVLMSAALSTELRHKYNVRSIPIRKDDEVQVVRG 60

Query: 228 TYKGREGKVVQVYRRKWVIHIERITREKVNGATVNVGIDPSKVVITXXXXXXXXXXXXXX 407
+YKGREGKVVQVYRR+WVIH+ERITREKVNG+TVNVGI PSKVV+T
Sbjct: 61 SYKGREGKVVQVYRRRWVIHVERITREKVNGSTVNVGIHPSKVVVTKLKLDKDRKAILDR 120

Query: 408 XXXXXXXXXXXXXFTSEEVA---APLQEVD 488
FT+E+VA A LQE+D
Sbjct: 121 KASGRAADKAKGKFTAEDVAAAGASLQEID 150