DK955076
Clone id TST39A01NGRL0022_C05
Library
Length 611
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_C05. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID
Sequence
CGTGTTTCTTAGTATTCGCGTGCATGAATCATCAGCATAAGCATCAGCCCTAAAGTTCGA
ATTACTGGCCCTCTGACATTCTGTCGTGCATCATGTGTAGCCCTGCACCAGCTCTGTAGC
ACTGCGTTTTCAATTCTGCGTTCTTGCTGTGCTGCATGTTGTGGTACAGCGTAGTACTGC
AGCACTGCGTCTTTCCATTGGGGGACACAGGCGGGGCGGTGCAGCGATTGGCTGCTGGCT
GGGTGGGCGGAGAGTCTAATAACGCGAGCGCCAAACTAGTTGTCTGCTAATAATTGTCGA
CGATTCCAAGAAAGCGACATCTGGAGCGCTCTGAGTACTGTCTTTTGCCTGTGCAGAGCT
GAATTATGGCAAAGGTGAACAGTGCCACAGGTGCCGACAGGGATGAGCACGATGAGCAGG
GCGGGTTGATGGAATCACCAGAGCGGCGGCGCATCAGCATCCCTGAGAAAGGCTCTCCCC
TCAAAGGGCTGGAGTTGGCCGTCCGCGAGACCTTCTTCCCCGATGACCCCCTCCGCCCCT
TCAAGAACCAGACCCGCTCCCGCCGCTTCCACCTTGGCCTAGCCTATCTCTTCCCTCCCC
TGCAATGGGCC
■■Homology search results ■■ -
sp_hit_id Q9SV13
Definition sp|Q9SV13|SUT31_ARATH Sulfate transporter 3.1 OS=Arabidopsis thaliana
Align length 53
Score (bit) 60.8
E-value 5.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955076|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_C05, 5'
(611 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9SV13|SUT31_ARATH Sulfate transporter 3.1 OS=Arabidopsis tha... 61 5e-09
sp|Q9MAX3|SUT12_ARATH Sulfate transporter 1.2 OS=Arabidopsis tha... 60 9e-09
sp|P53392|SUT2_STYHA High affinity sulfate transporter 2 OS=Styl... 56 1e-07
sp|P53391|SUT1_STYHA High affinity sulfate transporter 1 OS=Styl... 56 1e-07
sp|Q9SAY1|SUT11_ARATH Sulfate transporter 1.1 OS=Arabidopsis tha... 53 1e-06
sp|Q9FEP7|SUT13_ARATH Sulfate transporter 1.3 OS=Arabidopsis tha... 52 3e-06
sp|Q9LW86|SUT34_ARATH Probable sulfate transporter 3.4 OS=Arabid... 49 2e-05
sp|Q9SXS2|SUT33_ARATH Probable sulfate transporter 3.3 OS=Arabid... 49 3e-05
sp|O04289|SUT32_ARATH Sulfate transporter 3.2 OS=Arabidopsis tha... 45 3e-04
sp|Q9Z0L2|ARTN_MOUSE Artemin OS=Mus musculus GN=Artn PE=2 SV=1 33 1.5
sp|Q94LW6|SUT35_ARATH Probable sulfate transporter 3.5 OS=Arabid... 31 4.4
sp|O35973|PER1_MOUSE Period circadian protein homolog 1 OS=Mus m... 31 4.4
sp|Q07968|F13B_MOUSE Coagulation factor XIII B chain OS=Mus musc... 31 5.7
sp|P05160|F13B_HUMAN Coagulation factor XIII B chain OS=Homo sap... 30 7.5
sp|O95900|TRUB2_HUMAN Probable tRNA pseudouridine synthase 2 OS=... 30 9.7
sp|P56165|MPA52_PHAAQ Major pollen allergen Pha a 5.2 OS=Phalari... 30 9.7
sp|O14019|HAL4_SCHPO Serine/threonine-protein kinase hal4 OS=Sch... 30 9.7

>sp|Q9SV13|SUT31_ARATH Sulfate transporter 3.1 OS=Arabidopsis
thaliana GN=SULTR3;1 PE=2 SV=1
Length = 658

Score = 60.8 bits (146), Expect = 5e-09
Identities = 27/53 (50%), Positives = 34/53 (64%)
Frame = +3

Query: 453 ISIPEKGSPLKGLELAVRETFFPDDPLRPFKNQTRSRRFHLGLAYLFPPLQWA 611
+ P+ LK L+ +V+ET FPDDP R FKNQ SR+F LGL Y P +WA
Sbjct: 22 VEAPQPQPFLKSLQYSVKETLFPDDPFRQFKNQNASRKFVLGLKYFLPIFEWA 74


>sp|Q9MAX3|SUT12_ARATH Sulfate transporter 1.2 OS=Arabidopsis
thaliana GN=SULTR1;2 PE=1 SV=1
Length = 653

Score = 60.1 bits (144), Expect = 9e-09
Identities = 27/58 (46%), Positives = 36/58 (62%)
Frame = +3

Query: 435 SPERRRISIPEKGSPLKGLELAVRETFFPDDPLRPFKNQTRSRRFHLGLAYLFPPLQW 608
SP R ++ IP K + K +ETFF DDPLR FK+Q +S++F LGL +FP W
Sbjct: 24 SPTRHKVGIPPKQNMFKDFMYTFKETFFHDDPLRDFKDQPKSKQFMLGLQSVFPVFDW 81


>sp|P53392|SUT2_STYHA High affinity sulfate transporter 2
OS=Stylosanthes hamata GN=ST2 PE=2 SV=1
Length = 662

Score = 56.2 bits (134), Expect = 1e-07
Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 2/83 (2%)
Frame = +3

Query: 366 MAKVNSATGADRDEHDEQGG--LMESPERRRISIPEKGSPLKGLELAVRETFFPDDPLRP 539
MA+V + T + GG P ++ P K + + ++ + ETFFPD P
Sbjct: 10 MAEVIAETRTNSSSRRHGGGDDTPSLPYMHKVGAPPKQTLFQEIKHSFNETFFPDKPFGN 69

Query: 540 FKNQTRSRRFHLGLAYLFPPLQW 608
FK+Q+ SR+F LGL Y+FP L+W
Sbjct: 70 FKDQSGSRKFVLGLQYIFPILEW 92


>sp|P53391|SUT1_STYHA High affinity sulfate transporter 1
OS=Stylosanthes hamata GN=ST1 PE=2 SV=1
Length = 667

Score = 56.2 bits (134), Expect = 1e-07
Identities = 29/87 (33%), Positives = 45/87 (51%), Gaps = 5/87 (5%)
Frame = +3

Query: 363 IMAKVNSATGADRDEHDEQGG-----LMESPERRRISIPEKGSPLKGLELAVRETFFPDD 527
+MA V + T ++ H GG P ++ P K + + ++ + ETFFPD
Sbjct: 9 VMADVIAETRSNSSSHRHGGGGGGDDTTSLPYMHKVGTPPKQTLFQEIKHSFNETFFPDK 68

Query: 528 PLRPFKNQTRSRRFHLGLAYLFPPLQW 608
P FK+Q+ R+ LGL Y+FP L+W
Sbjct: 69 PFGKFKDQSGFRKLELGLQYIFPILEW 95


>sp|Q9SAY1|SUT11_ARATH Sulfate transporter 1.1 OS=Arabidopsis
thaliana GN=SULTR1;1 PE=2 SV=2
Length = 649

Score = 52.8 bits (125), Expect = 1e-06
Identities = 25/56 (44%), Positives = 35/56 (62%)
Frame = +3

Query: 444 RRRISIPEKGSPLKGLELAVRETFFPDDPLRPFKNQTRSRRFHLGLAYLFPPLQWA 611
R+R+ P K LK ++ V ETFF D PLR FK QT +++ LG+ +FP + WA
Sbjct: 22 RQRVLAPPKAGLLKDIKSVVEETFFHDAPLRDFKGQTPAKKALLGIQAVFPIIGWA 77


>sp|Q9FEP7|SUT13_ARATH Sulfate transporter 1.3 OS=Arabidopsis
thaliana GN=SULTR1;3 PE=2 SV=1
Length = 656

Score = 51.6 bits (122), Expect = 3e-06
Identities = 21/58 (36%), Positives = 36/58 (62%)
Frame = +3

Query: 435 SPERRRISIPEKGSPLKGLELAVRETFFPDDPLRPFKNQTRSRRFHLGLAYLFPPLQW 608
+P ++ +P K + +ETFF DDPLR FK+Q++S++ LG+ +FP ++W
Sbjct: 27 TPYVHKVEVPPKQNLFNEFMYTFKETFFHDDPLRHFKDQSKSKKLMLGIQSVFPVIEW 84


>sp|Q9LW86|SUT34_ARATH Probable sulfate transporter 3.4
OS=Arabidopsis thaliana GN=SULTR3;4 PE=2 SV=1
Length = 653

Score = 49.3 bits (116), Expect = 2e-05
Identities = 24/56 (42%), Positives = 32/56 (57%)
Frame = +3

Query: 441 ERRRISIPEKGSPLKGLELAVRETFFPDDPLRPFKNQTRSRRFHLGLAYLFPPLQW 608
E + +P K + + L+ V + FFPDDPL+ F+NQT R LGL LFP W
Sbjct: 25 EIHSVCLPPKKTAFQKLKKRVGDVFFPDDPLQRFRNQTWRNRVILGLQSLFPIFTW 80


>sp|Q9SXS2|SUT33_ARATH Probable sulfate transporter 3.3
OS=Arabidopsis thaliana GN=SULTR3;3 PE=2 SV=2
Length = 631

Score = 48.5 bits (114), Expect = 3e-05
Identities = 22/56 (39%), Positives = 31/56 (55%)
Frame = +3

Query: 441 ERRRISIPEKGSPLKGLELAVRETFFPDDPLRPFKNQTRSRRFHLGLAYLFPPLQW 608
E ++ P S + L+ ++ETFFPDDPLR F+ Q + Y+FP LQW
Sbjct: 2 EVHKVVAPPHKSTVAKLKTKLKETFFPDDPLRQFRGQPNRTKLIRAAQYIFPILQW 57


>sp|O04289|SUT32_ARATH Sulfate transporter 3.2 OS=Arabidopsis
thaliana GN=SULTR3;2 PE=2 SV=1
Length = 646

Score = 45.1 bits (105), Expect = 3e-04
Identities = 21/55 (38%), Positives = 34/55 (61%), Gaps = 1/55 (1%)
Frame = +3

Query: 450 RISIPEKGSPLKGLELAVRETFFPDDPLRPFKNQTR-SRRFHLGLAYLFPPLQWA 611
++ IP LK L+ + E F DDP R +N+++ S++ LGL ++FP L+WA
Sbjct: 11 QVEIPPPQPFLKSLKNTLNEILFADDPFRRIRNESKTSKKIELGLRHVFPILEWA 65


>sp|Q9Z0L2|ARTN_MOUSE Artemin OS=Mus musculus GN=Artn PE=2 SV=1
Length = 224

Score = 32.7 bits (73), Expect = 1.5
Identities = 27/89 (30%), Positives = 37/89 (41%), Gaps = 22/89 (24%)
Frame = -3

Query: 255 TLRPPSQQPIAAPP-----RLCPPMERRSAAVLRCTTTCSTARTQN*K------------ 127
TLRPP Q P APP PP R A R T S ART + +
Sbjct: 78 TLRPPPQSPQPAPPPPGPALQSPPAALRGARAARAGTRSSRARTTDARGCRLRSQLVPVS 137

Query: 126 -----RSATELVQGYT*CTTECQRASNSN 55
S+ EL++ + C+ C+RA + +
Sbjct: 138 ALGLGHSSDELIR-FRFCSGSCRRARSQH 165


tr_hit_id A7PUE5
Definition tr|A7PUE5|A7PUE5_VITVI Chromosome chr7 scaffold_31, whole genome shotgun sequence OS=Vitis vinifera
Align length 53
Score (bit) 65.9
E-value 2.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955076|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_C05, 5'
(611 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PUE5|A7PUE5_VITVI Chromosome chr7 scaffold_31, whole genome... 66 2e-09
tr|Q70GL1|Q70GL1_BRANA Sulphate transporter OS=Brassica napus GN... 65 4e-09
tr|A7Q6Y1|A7Q6Y1_VITVI Chromosome chr12 scaffold_57, whole genom... 65 4e-09
tr|A7PUE3|A7PUE3_VITVI Chromosome chr7 scaffold_31, whole genome... 64 7e-09
tr|B6SYY9|B6SYY9_MAIZE Sulfate transporter 3.4 OS=Zea mays PE=2 ... 64 9e-09
tr|A7NWS8|A7NWS8_VITVI Chromosome chr5 scaffold_2, whole genome ... 63 2e-08
tr|A5BIX6|A5BIX6_VITVI Putative uncharacterized protein OS=Vitis... 63 2e-08
tr|A7NV21|A7NV21_VITVI Chromosome chr18 scaffold_1, whole genome... 62 3e-08
tr|A5C067|A5C067_VITVI Putative uncharacterized protein OS=Vitis... 62 3e-08
tr|A1Z0J2|A1Z0J2_VITVI Sulfate transporter OS=Vitis vinifera PE=... 62 3e-08
tr|A1Z0J1|A1Z0J1_9MAGN Sulfate transporter OS=Vitis rupestris PE... 62 3e-08
tr|Q5VQ79|Q5VQ79_ORYSJ Os06g0143700 protein OS=Oryza sativa subs... 61 6e-08
tr|B8B2Q8|B8B2Q8_ORYSI Putative uncharacterized protein OS=Oryza... 61 6e-08
tr|A7X2Q1|A7X2Q1_9ROSI Putative sulfate transporter OS=Populus t... 61 6e-08
tr|A7YGI3|A7YGI3_9ROSI Sulfate transporter OS=Populus tremula x ... 60 8e-08
tr|A7NWS7|A7NWS7_VITVI Chromosome chr5 scaffold_2, whole genome ... 60 8e-08
tr|Q9AT47|Q9AT47_SOLLC Sulfate transporter 2 OS=Solanum lycopers... 60 1e-07
tr|Q0WTN0|Q0WTN0_ARATH Sulfate transporter OS=Arabidopsis thalia... 60 1e-07
tr|Q8H0K6|Q8H0K6_WHEAT Sulphate transporter OS=Triticum aestivum... 59 3e-07
tr|Q8H0J8|Q8H0J8_9POAL Sulphate transporter OS=Triticum urartu G... 59 3e-07
tr|A9P1C0|A9P1C0_PICSI Putative uncharacterized protein OS=Picea... 58 4e-07
tr|Q9AT48|Q9AT48_SOLLC Sulfate transporter 1 OS=Solanum lycopers... 57 6e-07
tr|Q94FU2|Q94FU2_SOLLC High affinity sulfate transporter (Fragme... 57 6e-07
tr|A9NVQ1|A9NVQ1_PICSI Putative uncharacterized protein OS=Picea... 57 6e-07
tr|Q9AT12|Q9AT12_MAIZE Sulfate transporter ST1 OS=Zea mays PE=2 ... 57 8e-07
tr|A7YF68|A7YF68_MAIZE Sulfate transporter OS=Zea mays PE=2 SV=2 57 8e-07
tr|A5BPP2|A5BPP2_VITVI Putative uncharacterized protein OS=Vitis... 57 8e-07
tr|Q93YK6|Q93YK6_BRANA Sulfate transporter OS=Brassica napus GN=... 56 1e-06
tr|Q9FPQ4|Q9FPQ4_SOLTU High affinity sulfate transporter type 1 ... 56 2e-06
tr|A1YKF8|A1YKF8_BRASY Sulfate transporter OS=Brachypodium sylva... 55 2e-06

>tr|A7PUE5|A7PUE5_VITVI Chromosome chr7 scaffold_31, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023771001
PE=3 SV=1
Length = 652

Score = 65.9 bits (159), Expect = 2e-09
Identities = 29/53 (54%), Positives = 38/53 (71%)
Frame = +3

Query: 450 RISIPEKGSPLKGLELAVRETFFPDDPLRPFKNQTRSRRFHLGLAYLFPPLQW 608
R+++P K L+ +++ETFFPDDPLR FKNQ SR+F LGL Y FP L+W
Sbjct: 18 RVAVPPPQPFTKSLKTSLKETFFPDDPLRQFKNQPASRKFILGLQYFFPILEW 70


>tr|Q70GL1|Q70GL1_BRANA Sulphate transporter OS=Brassica napus
GN=bst3.1 PE=2 SV=1
Length = 658

Score = 64.7 bits (156), Expect = 4e-09
Identities = 32/62 (51%), Positives = 39/62 (62%), Gaps = 2/62 (3%)
Frame = +3

Query: 432 ESPERRR--ISIPEKGSPLKGLELAVRETFFPDDPLRPFKNQTRSRRFHLGLAYLFPPLQ 605
E P RR + P+ LK L+ +V+ET FPDDP R FKNQT SR+ LGL Y P L+
Sbjct: 13 EEPHRRHHAVEAPDPQPFLKSLQYSVKETLFPDDPFRQFKNQTTSRQVVLGLKYFLPILE 72

Query: 606 WA 611
WA
Sbjct: 73 WA 74


>tr|A7Q6Y1|A7Q6Y1_VITVI Chromosome chr12 scaffold_57, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00031585001
PE=3 SV=1
Length = 639

Score = 64.7 bits (156), Expect = 4e-09
Identities = 31/57 (54%), Positives = 38/57 (66%)
Frame = +3

Query: 438 PERRRISIPEKGSPLKGLELAVRETFFPDDPLRPFKNQTRSRRFHLGLAYLFPPLQW 608
P ++ +P K LK V+ETFF DDPLRPFK+Q RSR+F LGL LFP L+W
Sbjct: 12 PYVHKVGVPPKQDLLKEFTDTVKETFFADDPLRPFKDQPRSRQFVLGLQSLFPILEW 68


>tr|A7PUE3|A7PUE3_VITVI Chromosome chr7 scaffold_31, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023768001
PE=3 SV=1
Length = 649

Score = 63.9 bits (154), Expect = 7e-09
Identities = 29/53 (54%), Positives = 37/53 (69%)
Frame = +3

Query: 450 RISIPEKGSPLKGLELAVRETFFPDDPLRPFKNQTRSRRFHLGLAYLFPPLQW 608
R+++P K L+ +++ETF PDDPLR FKNQ SR F LGL YLFP L+W
Sbjct: 18 RVAVPPPQPFTKSLKTSLKETFVPDDPLRQFKNQPASRIFRLGLQYLFPILEW 70


>tr|B6SYY9|B6SYY9_MAIZE Sulfate transporter 3.4 OS=Zea mays PE=2
SV=1
Length = 681

Score = 63.5 bits (153), Expect = 9e-09
Identities = 29/64 (45%), Positives = 38/64 (59%)
Frame = +3

Query: 417 QGGLMESPERRRISIPEKGSPLKGLELAVRETFFPDDPLRPFKNQTRSRRFHLGLAYLFP 596
+GG E ++S+PE+ + K L + E FFPDDPL FKNQ+ +RR L L Y FP
Sbjct: 50 EGGAASVLELHKVSLPERRTTAKALRQRLAEVFFPDDPLHQFKNQSSARRLVLALHYFFP 109

Query: 597 PLQW 608
QW
Sbjct: 110 IFQW 113


>tr|A7NWS8|A7NWS8_VITVI Chromosome chr5 scaffold_2, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00020043001
PE=3 SV=1
Length = 654

Score = 62.8 bits (151), Expect = 2e-08
Identities = 29/55 (52%), Positives = 36/55 (65%)
Frame = +3

Query: 447 RRISIPEKGSPLKGLELAVRETFFPDDPLRPFKNQTRSRRFHLGLAYLFPPLQWA 611
RR+++P K S L +ET FPDDP R FKNQ+ SR+F LGL YL P +WA
Sbjct: 10 RRVAVPPKKSFSASLSSTFKETIFPDDPFRQFKNQSPSRKFVLGLQYLVPIFEWA 64


>tr|A5BIX6|A5BIX6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_011489 PE=3 SV=1
Length = 654

Score = 62.8 bits (151), Expect = 2e-08
Identities = 29/55 (52%), Positives = 36/55 (65%)
Frame = +3

Query: 447 RRISIPEKGSPLKGLELAVRETFFPDDPLRPFKNQTRSRRFHLGLAYLFPPLQWA 611
RR+++P K S L +ET FPDDP R FKNQ+ SR+F LGL YL P +WA
Sbjct: 10 RRVAVPPKKSFSDSLSSTFKETIFPDDPFRQFKNQSPSRKFVLGLQYLVPIFEWA 64


>tr|A7NV21|A7NV21_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015271001
PE=3 SV=1
Length = 658

Score = 61.6 bits (148), Expect = 3e-08
Identities = 26/57 (45%), Positives = 39/57 (68%)
Frame = +3

Query: 438 PERRRISIPEKGSPLKGLELAVRETFFPDDPLRPFKNQTRSRRFHLGLAYLFPPLQW 608
P ++ +P K + K + V+ETFF DDPLR FK+Q++SR+F LG+ +FP L+W
Sbjct: 30 PYMHKVGVPPKQNLFKEFKTTVKETFFADDPLRSFKDQSKSRKFILGIQAIFPILEW 86


>tr|A5C067|A5C067_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_041032 PE=3 SV=1
Length = 646

Score = 61.6 bits (148), Expect = 3e-08
Identities = 26/57 (45%), Positives = 39/57 (68%)
Frame = +3

Query: 438 PERRRISIPEKGSPLKGLELAVRETFFPDDPLRPFKNQTRSRRFHLGLAYLFPPLQW 608
P ++ +P K + K + V+ETFF DDPLR FK+Q++SR+F LG+ +FP L+W
Sbjct: 30 PYMHKVGVPPKQNLFKEFKTTVKETFFADDPLRSFKDQSKSRKFILGIQAIFPILEW 86


>tr|A1Z0J2|A1Z0J2_VITVI Sulfate transporter OS=Vitis vinifera PE=2
SV=2
Length = 655

Score = 61.6 bits (148), Expect = 3e-08
Identities = 26/57 (45%), Positives = 39/57 (68%)
Frame = +3

Query: 438 PERRRISIPEKGSPLKGLELAVRETFFPDDPLRPFKNQTRSRRFHLGLAYLFPPLQW 608
P ++ +P K + K + V+ETFF DDPLR FK+Q++SR+F LG+ +FP L+W
Sbjct: 30 PYMHKVGVPPKQNLFKEFKTTVKETFFADDPLRSFKDQSKSRKFILGIQAIFPILEW 86