DK955080
Clone id TST39A01NGRL0022_C09
Library
Length 541
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_C09. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
ACAGGATCTACCAATGAGTCGGCCCAAGTGCAAAATCTTGCTTTCCCGTCCGATCCCACT
GATTTTCTTCTCCGCAACTGGACCAAATATGCTGGCAACCCTGTATTGGTGCCTCCCACA
GGTATCCTTTCTACTGATTTTAGAGACCCTACAACTGCATGGATTGGGACAGATGGGTTG
TGGAGGCTTGGAATTGGCTCAAAGCTGGAACAGAAAGGTATTGCAATGGTCTATTCAAGT
TCTGACTTCATCAACTGGACAATGCATGAGAACTACTTGCATGAAGTAGAAGGTACTGGT
ATGTGGGAGTGTCTTGATTTCTTCCCTGTAAACATGTCTGGTTCTGCAATGGGAGTCGAT
ACTTCCATCTATGGTGAGGATGTAAAGCATGTGCTGAAATCTAGCATGGACAACTCAAAG
CTGGATTTCTATGTAAATCGGGACCTATGATTATGAGAACTACACATTTATCCCCGACGA
TCCCTCTGCTGATCTTGGGCTAGGGCTGCGATATGATTATGGGAAGTTTTATGCATCAAA
G
■■Homology search results ■■ -
sp_hit_id P29001
Definition sp|P29001|INVA_PHAAU Acid beta-fructofuranosidase OS=Phaseolus aureus
Align length 144
Score (bit) 182.0
E-value 6.0e-55
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955080|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_C09, 5'
(541 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P29001|INVA_PHAAU Acid beta-fructofuranosidase OS=Phaseolus a... 182 6e-55
sp|P80065|INVB_DAUCA Beta-fructofuranosidase, soluble isoenzyme ... 182 1e-54
sp|Q43857|INVA_VICFA Acid beta-fructofuranosidase OS=Vicia faba ... 177 7e-53
sp|O24509|INVA_PHAVU Acid beta-fructofuranosidase OS=Phaseolus v... 173 2e-52
sp|P29000|INVA_SOLLC Acid beta-fructofuranosidase OS=Solanum lyc... 160 6e-48
sp|P93761|INV1_CAPAN Acid beta-fructofuranosidase AIV-18 OS=Caps... 158 4e-47
sp|P49175|INV1_MAIZE Beta-fructofuranosidase 1 OS=Zea mays GN=IV... 146 4e-44
sp|Q43089|INV1_PEA Beta-fructofuranosidase, cell wall isozyme OS... 145 2e-41
sp|P26792|INV1_DAUCA Beta-fructofuranosidase, insoluble isoenzym... 142 5e-41
sp|Q5FC15|GFT_ASPOF 6(G)-fructosyltransferase OS=Asparagus offic... 136 9e-41
sp|Q43866|INV1_ARATH Beta-fructofuranosidase, insoluble isoenzym... 141 2e-39
sp|Q8W413|INV4_ARATH Beta-fructofuranosidase, insoluble isoenzym... 140 3e-39
sp|Q0JDC5|INV2_ORYSJ Beta-fructofuranosidase, insoluble isoenzym... 135 2e-38
sp|Q01IS7|INV2_ORYSI Beta-fructofuranosidase, insoluble isoenzym... 135 2e-38
sp|Q0JDC6|INV3_ORYSJ Beta-fructofuranosidase, insoluble isoenzym... 133 1e-37
sp|Q01IS8|INV3_ORYSI Beta-fructofuranosidase, insoluble isoenzym... 133 1e-37
sp|Q1PEF8|INV2_ARATH Beta-fructofuranosidase, insoluble isoenzym... 135 9e-37
sp|Q39692|INV2_DAUCA Beta-fructofuranosidase, insoluble isoenzym... 124 1e-36
sp|Q9LIB9|INV5_ARATH Beta-fructofuranosidase, insoluble isoenzym... 130 1e-35
sp|Q8W4S6|INV6_ARATH Beta-fructofuranosidase, insoluble isoenzym... 136 2e-35
sp|Q67XZ3|INV3_ARATH Beta-fructofuranosidase, insoluble isoenzym... 130 3e-34
sp|A2X5P7|INV1_ORYSI Beta-fructofuranosidase, insoluble isoenzym... 126 3e-34
sp|P49174|INVA_MAIZE Beta-fructofuranosidase, cell wall isozyme ... 122 7e-34
sp|Q0E0P0|INV1_ORYSJ Beta-fructofuranosidase, insoluble isoenzym... 124 9e-34
sp|Q5JJV0|INV4_ORYSJ Beta-fructofuranosidase, insoluble isoenzym... 123 2e-33
sp|P92916|GFT_ALLCE Bifunctional 6(G)-fructosyltransferase/2,1-f... 113 3e-33
sp|Q39693|INV3_DAUCA Beta-fructofuranosidase, insoluble isoenzym... 112 3e-31
sp|A2YZ01|INV7_ORYSI Beta-fructofuranosidase, insoluble isoenzym... 122 4e-30
sp|Q0J360|INV7_ORYSJ Beta-fructofuranosidase, insoluble isoenzym... 122 5e-30
sp|Q56UD1|INV5_ORYSJ Beta-fructofuranosidase, insoluble isoenzym... 123 7e-28

>sp|P29001|INVA_PHAAU Acid beta-fructofuranosidase OS=Phaseolus
aureus GN=INVA PE=1 SV=1
Length = 649

Score = 182 bits (462), Expect(2) = 6e-55
Identities = 84/144 (58%), Positives = 110/144 (76%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAWIGTDGL 180
TGSTNES QVQNLA+P+DP+D LL +W K+ GNPVLVPP GI + DFRDPTTAW+ ++G
Sbjct: 206 TGSTNESVQVQNLAYPADPSDPLLLDWIKHTGNPVLVPPPGIGAKDFRDPTTAWLTSEGK 265

Query: 181 WRLGIGSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGSAMGVD 360
WR+ IGSKL + GIA+VY + DF + + E L V GTGMWEC+DFFPV+ + G+D
Sbjct: 266 WRITIGSKLNKTGIALVYDTEDFKTYELKEGLLRAVPGTGMWECVDFFPVSKK-NGNGLD 324

Query: 361 TSIYGEDVKHVLKSSMDNSKLDFY 432
TS+ G +VKHV+K S+D+ + D+Y
Sbjct: 325 TSVNGAEVKHVMKVSLDDDRHDYY 348



Score = 51.2 bits (121), Expect(2) = 6e-55
Identities = 23/35 (65%), Positives = 25/35 (71%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
IGTYD F PDD D+G+GLRYDYG FYASK
Sbjct: 350 IGTYDDNKVLFTPDDVKNDVGVGLRYDYGIFYASK 384


>sp|P80065|INVB_DAUCA Beta-fructofuranosidase, soluble isoenzyme I
OS=Daucus carota GN=INV*DC4 PE=1 SV=2
Length = 661

Score = 182 bits (462), Expect(2) = 1e-54
Identities = 83/144 (57%), Positives = 113/144 (78%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAWIGTDGL 180
TG T++ QVQNLA+P++ +D LL +W KY NPV+ PP GI STDFRDPTTAWIG DG
Sbjct: 221 TGDTDDLVQVQNLAYPANLSDPLLLDWIKYPDNPVMFPPPGIGSTDFRDPTTAWIGRDGK 280

Query: 181 WRLGIGSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGSAMGVD 360
WR+ IGSK+ + GI+++Y ++DFI + + +N LH V GTGMWEC+DF+PV+++GS G+D
Sbjct: 281 WRITIGSKVNKTGISLMYKTTDFITYELLDNLLHAVPGTGMWECVDFYPVSVTGS-NGLD 339

Query: 361 TSIYGEDVKHVLKSSMDNSKLDFY 432
TS+ G VKHVLKSS+D+ + D+Y
Sbjct: 340 TSVNGPGVKHVLKSSLDDDRHDYY 363



Score = 50.1 bits (118), Expect(2) = 1e-54
Identities = 21/35 (60%), Positives = 27/35 (77%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
+GTYD N + PD+P D+G+GLR DYGK+YASK
Sbjct: 365 LGTYDPINDKWTPDNPELDVGIGLRLDYGKYYASK 399


>sp|Q43857|INVA_VICFA Acid beta-fructofuranosidase OS=Vicia faba
GN=VCINV PE=2 SV=1
Length = 642

Score = 177 bits (448), Expect(2) = 7e-53
Identities = 83/144 (57%), Positives = 107/144 (74%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAWIGTDGL 180
TGSTNE QVQNLA+P+D D LL +W KY NPVLVPP GIL DFRDPTTAW+ T+G
Sbjct: 198 TGSTNEFVQVQNLAYPADLNDPLLVDWIKYPSNPVLVPPPGILPKDFRDPTTAWLTTEGK 257

Query: 181 WRLGIGSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGSAMGVD 360
WR+ IGSK+ + G+A+VY + DF + + L+ V GTGMWEC+DFFPV+M S G+D
Sbjct: 258 WRITIGSKINKTGVALVYDTVDFKTYERKDMLLNAVPGTGMWECVDFFPVSMK-SENGLD 316

Query: 361 TSIYGEDVKHVLKSSMDNSKLDFY 432
TS G++VKHV+K S+D+ + D+Y
Sbjct: 317 TSFTGDEVKHVMKVSLDDDRHDYY 340



Score = 49.7 bits (117), Expect(2) = 7e-53
Identities = 22/35 (62%), Positives = 26/35 (74%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
+GTYD + FI DD D+G+GLRYDYG FYASK
Sbjct: 342 LGTYDEKKVKFIADDFENDVGIGLRYDYGIFYASK 376


>sp|O24509|INVA_PHAVU Acid beta-fructofuranosidase OS=Phaseolus
vulgaris PE=2 SV=1
Length = 651

Score = 173 bits (439), Expect(2) = 2e-52
Identities = 83/146 (56%), Positives = 110/146 (75%), Gaps = 2/146 (1%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAWIGTDGL 180
TGSTNES QVQNLA+P+DP+D LL +W K+ GNPVLVPP GI + DFRDPTTAW+ ++G
Sbjct: 206 TGSTNESVQVQNLAYPADPSDPLLVDWIKHPGNPVLVPPPGIGAKDFRDPTTAWLTSEGK 265

Query: 181 WRLGIGSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGSAMGVD 360
WR+ IGSKL + GIA+VY + DF + + +L V GTGMWEC+DFFPV+ + G+D
Sbjct: 266 WRITIGSKLNKTGIALVYDTDDFKTYELKNGHLRAVPGTGMWECVDFFPVSKK-NENGLD 324

Query: 361 T--SIYGEDVKHVLKSSMDNSKLDFY 432
T SI G +VK+V+K S+D+ + D+Y
Sbjct: 325 TSLSINGAEVKYVMKVSLDDDRHDYY 350



Score = 51.6 bits (122), Expect(2) = 2e-52
Identities = 23/35 (65%), Positives = 25/35 (71%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
IGTYD F PDD D+G+GLRYDYG FYASK
Sbjct: 352 IGTYDENKVLFTPDDVKNDVGVGLRYDYGIFYASK 386


>sp|P29000|INVA_SOLLC Acid beta-fructofuranosidase OS=Solanum
lycopersicum GN=TIV1 PE=2 SV=1
Length = 636

Score = 160 bits (406), Expect(2) = 6e-48
Identities = 78/145 (53%), Positives = 106/145 (73%), Gaps = 1/145 (0%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAWIG-TDG 177
TG T++ QVQNLA+P++ +D LL +W K+ GNPVLVPP GI DFRDPTTAW G +G
Sbjct: 194 TGDTDDYVQVQNLAYPANLSDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTAWTGPQNG 253

Query: 178 LWRLGIGSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGSAMGV 357
W L IGSK+ + G+A+VY +S+F ++ + + LH V GTGMWEC+DF+PV+ + G+
Sbjct: 254 QWLLTIGSKIGKTGVALVYETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVS-TKKTNGL 312

Query: 358 DTSIYGEDVKHVLKSSMDNSKLDFY 432
DTS G VKHVLK+S+D++K D Y
Sbjct: 313 DTSYNGPGVKHVLKASLDDNKQDHY 337



Score = 49.3 bits (116), Expect(2) = 6e-48
Identities = 21/35 (60%), Positives = 25/35 (71%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
IGTYD + PD+P D G+GLR DYGK+YASK
Sbjct: 339 IGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASK 373


>sp|P93761|INV1_CAPAN Acid beta-fructofuranosidase AIV-18
OS=Capsicum annuum PE=2 SV=1
Length = 640

Score = 158 bits (400), Expect(2) = 4e-47
Identities = 81/146 (55%), Positives = 106/146 (72%), Gaps = 1/146 (0%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAWIG-TDG 177
TG T++ QVQNLA+P++ +D LL +W KY GNPVLVPP GI DFRDPTTAW G +G
Sbjct: 202 TGDTDDYVQVQNLAYPANLSDPLLLDWVKYQGNPVLVPPPGIGVKDFRDPTTAWTGPQNG 261

Query: 178 LWRLGIGSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGSAMGV 357
W L IGSK+ + GIA+VY +S N+ + + LH V GTGMWEC+DF+PV+ + A G+
Sbjct: 262 QWLLTIGSKVGKTGIALVYETS---NFKLLDGVLHAVPGTGMWECVDFYPVS-TLDANGL 317

Query: 358 DTSIYGEDVKHVLKSSMDNSKLDFYV 435
DTS G +KHVLK+S+D++K D YV
Sbjct: 318 DTSYNGPGIKHVLKASLDDNKQDHYV 343



Score = 48.9 bits (115), Expect(2) = 4e-47
Identities = 21/35 (60%), Positives = 25/35 (71%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
IGTYD F PD+P D G+GLR DYG++YASK
Sbjct: 344 IGTYDPVKNKFSPDNPDLDCGIGLRLDYGRYYASK 378


>sp|P49175|INV1_MAIZE Beta-fructofuranosidase 1 OS=Zea mays GN=IVR1
PE=3 SV=1
Length = 670

Score = 146 bits (369), Expect(2) = 4e-44
Identities = 83/155 (53%), Positives = 102/155 (65%), Gaps = 11/155 (7%)
Frame = +1

Query: 1 TGSTNES-AQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAW---IG 168
TGST ES AQVQNLA P+D +D LLR W K NPVLVPP GI TDFRDPTTA G
Sbjct: 215 TGSTAESSAQVQNLAEPADASDPLLREWVKSDANPVLVPPPGIGPTDFRDPTTACRTPAG 274

Query: 169 TDGLWRLGIGSK-LEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPV----- 330
D WR+ IGSK + G+A+VY + DF+ + +H V GTGMWEC+DF+PV
Sbjct: 275 NDTAWRVAIGSKDRDHAGLALVYRTEDFVRYDPAPALMHAVPGTGMWECVDFYPVAAGSG 334

Query: 331 NMSGSAMGVDTSIY-GEDVKHVLKSSMDNSKLDFY 432
+GS G++TS G VKHVLK+S+D+ K D+Y
Sbjct: 335 AAAGSGDGLETSAAPGPGVKHVLKASLDDDKHDYY 369



Score = 50.8 bits (120), Expect(2) = 4e-44
Identities = 22/35 (62%), Positives = 26/35 (74%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
IGTYD T+ PD D+G+GLRYDYGK+YASK
Sbjct: 371 IGTYDPATDTWTPDSAEDDVGIGLRYDYGKYYASK 405


>sp|Q43089|INV1_PEA Beta-fructofuranosidase, cell wall isozyme
OS=Pisum sativum GN=BFRUCT1 PE=2 SV=1
Length = 555

Score = 145 bits (365), Expect(2) = 2e-41
Identities = 73/149 (48%), Positives = 102/149 (68%), Gaps = 4/149 (2%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTG--ILSTDFRDPTTAWIGTD 174
TG + QVQN+A P + +D LLR W K NP++ P I S+ FRDPTT+W+G D
Sbjct: 137 TGIDPNNHQVQNIAIPKNMSDPLLREWKKSPKNPLMEPTIANKINSSSFRDPTTSWLGKD 196

Query: 175 GLWRLGIGSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPV-NMSGSAM 351
G WR+ IGSK++ KG+A++Y S +F++W ++ LH EGTGMWEC DF+PV + +
Sbjct: 197 GFWRVLIGSKIDTKGMAILYKSKNFVDWVEAKHPLHSAEGTGMWECPDFYPVLDKNLLRT 256

Query: 352 GVDTSIYG-EDVKHVLKSSMDNSKLDFYV 435
GVDTS G +DV+HVLK S+D++K D Y+
Sbjct: 257 GVDTSRNGDDDVRHVLKVSLDDTKHDHYL 285



Score = 43.5 bits (101), Expect(2) = 2e-41
Identities = 19/35 (54%), Positives = 24/35 (68%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
IG+YD F+P++ D G LRYDYGK+YASK
Sbjct: 286 IGSYDVVKDVFVPENGFEDNGFVLRYDYGKYYASK 320


>sp|P26792|INV1_DAUCA Beta-fructofuranosidase, insoluble isoenzyme 1
OS=Daucus carota GN=INV1 PE=1 SV=1
Length = 592

Score = 142 bits (359), Expect(2) = 5e-41
Identities = 67/139 (48%), Positives = 94/139 (67%)
Frame = +1

Query: 16 ESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAWIGTDGLWRLGI 195
++ QVQN A P++ +D LR W K NP++V G +T FRDPTTAW+ G W++ +
Sbjct: 158 KNVQVQNYAIPANLSDPYLRKWIKPDNNPLVVANNGENATAFRDPTTAWLDKSGHWKMLV 217

Query: 196 GSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGSAMGVDTSIYG 375
GSK ++GIA +Y S DFI WT ++ +H TGMWEC DFFPV++ G G+DTS+ G
Sbjct: 218 GSKRNRRGIAYLYRSKDFIKWTKAKHPIHSQANTGMWECPDFFPVSLKG-LNGLDTSVTG 276

Query: 376 EDVKHVLKSSMDNSKLDFY 432
E VKHVLK S+D ++ ++Y
Sbjct: 277 ESVKHVLKVSLDLTRYEYY 295



Score = 44.3 bits (103), Expect(2) = 5e-41
Identities = 20/35 (57%), Positives = 24/35 (68%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
+GTY + +IPD+ S D GLRYDYG FYASK
Sbjct: 297 VGTYLTDKDRYIPDNTSVDGWAGLRYDYGNFYASK 331


>sp|Q5FC15|GFT_ASPOF 6(G)-fructosyltransferase OS=Asparagus
officinalis GN=FT1 PE=1 SV=1
Length = 610

Score = 136 bits (342), Expect(2) = 9e-41
Identities = 76/152 (50%), Positives = 97/152 (63%), Gaps = 8/152 (5%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAG-NPVLVPPTGILSTDFRDPTTAWIGT-D 174
TG T E Q+ ++A +DP+D LL W KY NPVL PP GI TDFRDP W T D
Sbjct: 159 TGGTKEKYQIMSVAMAADPSDPLLVEWVKYDEVNPVLRPPPGIGLTDFRDPNPIWYNTTD 218

Query: 175 GLWRLGIGSK---LEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGS 345
W+L IGSK L+ GIAMVY++ DFIN T+ LH V+ GMWEC+D FPV SG
Sbjct: 219 STWQLVIGSKNDSLQHTGIAMVYTTKDFINLTLLPGVLHSVDHVGMWECVDLFPVASSGP 278

Query: 346 AM--GVDTS-IYGEDVKHVLKSSMDNSKLDFY 432
+ G+D S + ++VKHVLK+SM++ D+Y
Sbjct: 279 LIGRGLDRSMMLADNVKHVLKASMNDEWHDYY 310



Score = 50.1 bits (118), Expect(2) = 9e-41
Identities = 19/35 (54%), Positives = 28/35 (80%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
IG+YD + ++PDD S D+G+G+R D+GKFYAS+
Sbjct: 312 IGSYDVATHRWVPDDESVDVGIGMRIDWGKFYASR 346


tr_hit_id B2NIA0
Definition tr|B2NIA0|B2NIA0_PYRPY Soluble acid invertase OS=Pyrus pyrifolia
Align length 144
Score (bit) 198.0
E-value 4.0e-61
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955080|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_C09, 5'
(541 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B2NIA0|B2NIA0_PYRPY Soluble acid invertase OS=Pyrus pyrifolia... 198 4e-61
tr|A0A7Y9|A0A7Y9_PYRPY Soluble acid invertase OS=Pyrus pyrifolia... 198 4e-61
tr|Q941I4|Q941I4_9ROSA Vacuolar acid invertase OS=Prunus cerasus... 192 9e-59
tr|Q08IC1|Q08IC1_FRAAN Soluble acid invertase (Fragment) OS=Frag... 190 4e-57
tr|Q8VXS7|Q8VXS7_BETVU Beta-fructofuranosidase OS=Beta vulgaris ... 183 1e-55
tr|Q42647|Q42647_BETVU Beta-fructofuranosidase (Fragment) OS=Bet... 182 2e-55
tr|Q8W3M2|Q8W3M2_CITUN Acid invertase OS=Citrus unshiu GN=CitINV... 182 4e-55
tr|Q05JI2|Q05JI2_CITSI Beta-fructofuranosidase OS=Citrus sinensi... 182 5e-55
tr|Q8L6W2|Q8L6W2_BETVU Acid vacuolar invertase OS=Beta vulgaris ... 181 5e-55
tr|Q9SI83|Q9SI83_ARATH F23N19.3 OS=Arabidopsis thaliana PE=3 SV=1 181 9e-55
tr|Q9SXD2|Q9SXD2_ARATH T3P18.21 OS=Arabidopsis thaliana PE=3 SV=1 181 9e-55
tr|Q94BX0|Q94BX0_ARATH At1g62660/F23N19_3 OS=Arabidopsis thalian... 181 9e-55
tr|Q43348|Q43348_ARATH Beta-fructosidase (At1g62660/F23N19_3) OS... 181 9e-55
tr|Q7DLY6|Q7DLY6_ARATH Beta-fructosidase (Fragment) OS=Arabidops... 181 9e-55
tr|O22447|O22447_CITUN Acid invertase (Fragment) OS=Citrus unshi... 182 2e-54
tr|Q05JI1|Q05JI1_CITSI Beta-fructofuranosidase OS=Citrus sinensi... 186 5e-54
tr|Q42567|Q42567_ARATH Beta-fructofuranosidase (Fragment) OS=Ara... 177 1e-53
tr|Q944C7|Q944C7_MALDO Vacuolar invertase (Fragment) OS=Malus do... 182 2e-53
tr|Q42722|Q42722_DAUCA Soluble beta-fructosidase (Beta-fructofur... 181 2e-53
tr|Q9S943|Q9S943_VITVI Vacuolar invertase 2, GIN2 OS=Vitis vinif... 176 3e-53
tr|Q944C8|Q944C8_CITSI Vacuolar invertase OS=Citrus sinensis PE=... 182 3e-53
tr|Q9FQ62|Q9FQ62_BRAOL Acid invertase OS=Brassica oleracea PE=2 ... 179 8e-53
tr|Q8RVH4|Q8RVH4_CICIN Beta-fructofuranosidase OS=Cichorium inty... 180 1e-52
tr|B6V3B8|B6V3B8_CUCME Invertase 2 OS=Cucumis melo GN=INV2 PE=2 ... 176 1e-52
tr|A7R4X6|A7R4X6_VITVI Chromosome undetermined scaffold_805, who... 176 2e-52
tr|Q8LK75|Q8LK75_LAGLE Acid invertase OS=Lagenaria leucantha PE=... 177 4e-52
tr|Q39041|Q39041_ARATH Beta-fructosidase OS=Arabidopsis thaliana... 176 7e-52
tr|Q7DLW9|Q7DLW9_ARATH Beta-fructosidase (Fragment) OS=Arabidops... 176 7e-52
tr|Q8VXS6|Q8VXS6_BETVU Beta-fructofuranosidase (Fragment) OS=Bet... 173 1e-51
tr|Q8VWP5|Q8VWP5_BETVU Beta-fructofuranosidase (Fragment) OS=Bet... 173 1e-51

>tr|B2NIA0|B2NIA0_PYRPY Soluble acid invertase OS=Pyrus pyrifolia
GN=PpAIV1 PE=2 SV=1
Length = 645

Score = 198 bits (504), Expect(2) = 4e-61
Identities = 91/144 (63%), Positives = 116/144 (80%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAWIGTDGL 180
TGSTNES QVQNLA+P++ +D LL +W KY GNP+L PP+GI STDFRDPTTAWIG DG
Sbjct: 209 TGSTNESVQVQNLAYPANLSDPLLLDWVKYEGNPILTPPSGIGSTDFRDPTTAWIGPDGK 268

Query: 181 WRLGIGSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGSAMGVD 360
WR+ IGSK GI+MVY+++DFIN+ +H LHEV GTGMWEC+DF+PV ++GS G+D
Sbjct: 269 WRITIGSKFNTTGISMVYTTNDFINYELHNGVLHEVPGTGMWECVDFYPVAINGS-KGLD 327

Query: 361 TSIYGEDVKHVLKSSMDNSKLDFY 432
TS+ +KHVLK+S+D++KLD Y
Sbjct: 328 TSVNSGRIKHVLKASLDDTKLDHY 351



Score = 59.7 bits (143), Expect(2) = 4e-61
Identities = 24/35 (68%), Positives = 31/35 (88%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
IGTY EN T++PDDP+ D+G+GLRYDYG++YASK
Sbjct: 353 IGTYFIENETWVPDDPTIDVGIGLRYDYGRYYASK 387


>tr|A0A7Y9|A0A7Y9_PYRPY Soluble acid invertase OS=Pyrus pyrifolia
var. culta GN=PsS-AIV1 PE=2 SV=1
Length = 645

Score = 198 bits (504), Expect(2) = 4e-61
Identities = 91/144 (63%), Positives = 116/144 (80%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAWIGTDGL 180
TGSTNES QVQNLA+P++ +D LL +W KY GNP+L PP+GI STDFRDPTTAWIG DG
Sbjct: 209 TGSTNESVQVQNLAYPANLSDPLLLDWVKYEGNPILTPPSGIGSTDFRDPTTAWIGPDGK 268

Query: 181 WRLGIGSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGSAMGVD 360
WR+ IGSK GI+MVY+++DFIN+ +H LHEV GTGMWEC+DF+PV ++GS G+D
Sbjct: 269 WRITIGSKFNTTGISMVYTTNDFINYELHNGVLHEVPGTGMWECVDFYPVAINGS-KGLD 327

Query: 361 TSIYGEDVKHVLKSSMDNSKLDFY 432
TS+ +KHVLK+S+D++KLD Y
Sbjct: 328 TSVNSGRIKHVLKASLDDTKLDHY 351



Score = 59.7 bits (143), Expect(2) = 4e-61
Identities = 24/35 (68%), Positives = 31/35 (88%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
IGTY EN T++PDDP+ D+G+GLRYDYG++YASK
Sbjct: 353 IGTYFIENETWVPDDPTIDVGIGLRYDYGRYYASK 387


>tr|Q941I4|Q941I4_9ROSA Vacuolar acid invertase OS=Prunus cerasus
GN=AI-2 PE=2 SV=2
Length = 636

Score = 192 bits (487), Expect(2) = 9e-59
Identities = 88/144 (61%), Positives = 118/144 (81%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAWIGTDGL 180
T STNES QVQNLA+P++ +D LL +W KY+GNPVL PP GI STDFRDPTTAWIG DGL
Sbjct: 201 TASTNESVQVQNLAYPANLSDPLLLDWVKYSGNPVLTPPAGIGSTDFRDPTTAWIGPDGL 260

Query: 181 WRLGIGSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGSAMGVD 360
WR IGSK+ + GI++VY++++FI++ + E LH V GTGMWEC+DF+PV+++GS G++
Sbjct: 261 WRTTIGSKVNKTGISIVYTTTNFIDYELLEGVLHAVPGTGMWECVDFYPVSINGST-GLE 319

Query: 361 TSIYGEDVKHVLKSSMDNSKLDFY 432
TS+ G VKHVLK+S+D++K+D Y
Sbjct: 320 TSVNGPGVKHVLKASLDDTKMDHY 343



Score = 58.5 bits (140), Expect(2) = 9e-59
Identities = 24/35 (68%), Positives = 30/35 (85%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
IGTY EN T+IPDDP D+G+GL+YDYG++YASK
Sbjct: 345 IGTYFLENNTWIPDDPKIDVGIGLKYDYGRYYASK 379


>tr|Q08IC1|Q08IC1_FRAAN Soluble acid invertase (Fragment)
OS=Fragaria ananassa GN=FasAIV PE=2 SV=1
Length = 295

Score = 190 bits (483), Expect(2) = 4e-57
Identities = 87/144 (60%), Positives = 112/144 (77%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAWIGTDGL 180
TG T ++ QVQ LA+P + +D LL +W KY+GNPVL PP GILSTDFRDPTTAWIG DG
Sbjct: 20 TGDTVDAVQVQCLAYPGNLSDPLLLDWVKYSGNPVLTPPPGILSTDFRDPTTAWIGPDGK 79

Query: 181 WRLGIGSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGSAMGVD 360
WR+ IGSK+ G++ VY++ DFIN+ M + LHEV GTGMWEC+DF+PV + GS G+D
Sbjct: 80 WRITIGSKINTTGVSFVYTTEDFINYNMSQGLLHEVPGTGMWECIDFYPVAIKGS-KGLD 138

Query: 361 TSIYGEDVKHVLKSSMDNSKLDFY 432
TS+ G VKHVLK+S+D++K+D Y
Sbjct: 139 TSVNGPSVKHVLKASLDDTKVDHY 162



Score = 54.7 bits (130), Expect(2) = 4e-57
Identities = 21/35 (60%), Positives = 30/35 (85%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
+GTY EN T++PD+P D+G+GL+YDYG++YASK
Sbjct: 164 LGTYFIENETWVPDNPVLDVGIGLKYDYGRYYASK 198


>tr|Q8VXS7|Q8VXS7_BETVU Beta-fructofuranosidase OS=Beta vulgaris
GN=vi1 PE=3 SV=1
Length = 691

Score = 183 bits (464), Expect(2) = 1e-55
Identities = 85/144 (59%), Positives = 111/144 (77%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAWIGTDGL 180
TGSTNES QVQNLA+P++ +D LL W KY GNPVLVPP GI DFRDPTTAW+ ++G
Sbjct: 235 TGSTNESVQVQNLAYPANLSDPLLLEWVKYPGNPVLVPPPGIGKLDFRDPTTAWLTSEGK 294

Query: 181 WRLGIGSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGSAMGVD 360
WR+ IGSKL + GI++VY ++DF N+ + N LH V+GTGMWEC+DF+PV+++ G+D
Sbjct: 295 WRITIGSKLNKTGISLVYDTTDFKNYELLSNILHAVQGTGMWECVDFYPVSVA-EPNGLD 353

Query: 361 TSIYGEDVKHVLKSSMDNSKLDFY 432
TS G VKHVLK+SMD+ + D+Y
Sbjct: 354 TSTNGPSVKHVLKASMDDDRNDYY 377



Score = 57.0 bits (136), Expect(2) = 1e-55
Identities = 22/35 (62%), Positives = 31/35 (88%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
+GTY +N T++PD+P+ D+G+GLRYDYG+FYASK
Sbjct: 379 LGTYIEDNVTWVPDNPAIDVGIGLRYDYGRFYASK 413


>tr|Q42647|Q42647_BETVU Beta-fructofuranosidase (Fragment) OS=Beta
vulgaris subsp. vulgaris GN=BIN44 PE=2 SV=1
Length = 248

Score = 182 bits (462), Expect(2) = 2e-55
Identities = 84/144 (58%), Positives = 111/144 (77%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAWIGTDGL 180
TGSTNES QVQNLA+P++ +D LL W KY GNPVLVPP GI DFRDPTTAW+ ++G
Sbjct: 66 TGSTNESVQVQNLAYPANLSDPLLLEWVKYPGNPVLVPPPGIGKLDFRDPTTAWLTSEGK 125

Query: 181 WRLGIGSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGSAMGVD 360
WR+ IGSK+ + GI++VY ++DF N+ + N LH V+GTGMWEC+DF+PV+++ G+D
Sbjct: 126 WRITIGSKINKTGISLVYDTTDFKNYELLSNILHAVQGTGMWECVDFYPVSVA-EPNGLD 184

Query: 361 TSIYGEDVKHVLKSSMDNSKLDFY 432
TS G VKHVLK+SMD+ + D+Y
Sbjct: 185 TSTNGPSVKHVLKASMDDDRNDYY 208



Score = 57.0 bits (136), Expect(2) = 2e-55
Identities = 22/35 (62%), Positives = 31/35 (88%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
+GTY +N T++PD+P+ D+G+GLRYDYG+FYASK
Sbjct: 210 LGTYIEDNVTWVPDNPAIDVGIGLRYDYGRFYASK 244


>tr|Q8W3M2|Q8W3M2_CITUN Acid invertase OS=Citrus unshiu GN=CitINV1
PE=2 SV=1
Length = 687

Score = 182 bits (463), Expect(2) = 4e-55
Identities = 85/144 (59%), Positives = 108/144 (75%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAWIGTDGL 180
TGSTNES QVQNLA+P+DP+D LL W KY GNPVLVPP GI S DFRDPTTAW+ ++G
Sbjct: 209 TGSTNESVQVQNLAYPADPSDPLLIKWVKYPGNPVLVPPPGIGSKDFRDPTTAWLTSEGK 268

Query: 181 WRLGIGSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGSAMGVD 360
WR+ IGS++ + GI VY + DFIN+ + LH V TGMWEC+DF+PV+ +G G+D
Sbjct: 269 WRIAIGSRINRTGITFVYDTKDFINYELLRGVLHGVPNTGMWECVDFYPVSTTGE-HGLD 327

Query: 361 TSIYGEDVKHVLKSSMDNSKLDFY 432
TS G VKHV+K+SMD+ + D+Y
Sbjct: 328 TSHNGLGVKHVVKASMDDDRHDYY 351



Score = 55.5 bits (132), Expect(2) = 4e-55
Identities = 22/35 (62%), Positives = 29/35 (82%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
IGTY +N T++PD+P D+G+G+RYDYG FYASK
Sbjct: 353 IGTYHEKNVTWVPDNPEIDVGIGIRYDYGLFYASK 387


>tr|Q05JI2|Q05JI2_CITSI Beta-fructofuranosidase OS=Citrus sinensis
GN=Cs-bFruct1 PE=2 SV=1
Length = 687

Score = 182 bits (462), Expect(2) = 5e-55
Identities = 84/144 (58%), Positives = 108/144 (75%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAWIGTDGL 180
TGSTNES QVQNLA+P+DP+D LL W KY GNPVLVPP GI + DFRDPTTAW+ ++G
Sbjct: 209 TGSTNESVQVQNLAYPADPSDPLLIKWVKYPGNPVLVPPPGIGAKDFRDPTTAWLTSEGK 268

Query: 181 WRLGIGSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGSAMGVD 360
WR+ IGS++ + GI VY + DFIN+ + LH V TGMWEC+DF+PV+ +G G+D
Sbjct: 269 WRIAIGSRINRTGITFVYDTKDFINYELLRGVLHGVPNTGMWECVDFYPVSTTGE-HGLD 327

Query: 361 TSIYGEDVKHVLKSSMDNSKLDFY 432
TS G VKHV+K+SMD+ + D+Y
Sbjct: 328 TSHNGPGVKHVVKASMDDDRHDYY 351



Score = 55.5 bits (132), Expect(2) = 5e-55
Identities = 22/35 (62%), Positives = 29/35 (82%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
IGTY +N T++PD+P D+G+G+RYDYG FYASK
Sbjct: 353 IGTYHEKNVTWVPDNPEIDVGIGIRYDYGLFYASK 387


>tr|Q8L6W2|Q8L6W2_BETVU Acid vacuolar invertase OS=Beta vulgaris
GN=vacinv PE=2 SV=1
Length = 675

Score = 181 bits (458), Expect(2) = 5e-55
Identities = 83/144 (57%), Positives = 111/144 (77%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAWIGTDGL 180
TGSTNES QVQNLA+P++ +D LL W KY GNPVLVPP GI DFRDPTTAW+ ++G
Sbjct: 233 TGSTNESVQVQNLAYPANLSDPLLLEWVKYPGNPVLVPPPGIGKLDFRDPTTAWLTSEGK 292

Query: 181 WRLGIGSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGSAMGVD 360
WR+ IGSK+ + GI++VY ++DF N+ + N LH V+GTGMWEC+DF+PV+++ G+D
Sbjct: 293 WRITIGSKINKTGISLVYDTTDFKNYELLSNILHAVQGTGMWECVDFYPVSVA-EPNGLD 351

Query: 361 TSIYGEDVKHVLKSSMDNSKLDFY 432
TS + VKHVLK+SMD+ + D+Y
Sbjct: 352 TSTNDQSVKHVLKASMDDDRNDYY 375



Score = 57.0 bits (136), Expect(2) = 5e-55
Identities = 22/35 (62%), Positives = 31/35 (88%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGLGLRYDYGKFYASK 541
+GTY +N T++PD+P+ D+G+GLRYDYG+FYASK
Sbjct: 377 LGTYIEDNVTWVPDNPAIDVGIGLRYDYGRFYASK 411


>tr|Q9SI83|Q9SI83_ARATH F23N19.3 OS=Arabidopsis thaliana PE=3 SV=1
Length = 728

Score = 181 bits (459), Expect(2) = 9e-55
Identities = 81/144 (56%), Positives = 110/144 (76%)
Frame = +1

Query: 1 TGSTNESAQVQNLAFPSDPTDFLLRNWTKYAGNPVLVPPTGILSTDFRDPTTAWIGTDGL 180
TGST+E QVQNLA+P DP+D LL W K++GNPVLVPP GI + DFRDPTTAW + G
Sbjct: 198 TGSTDEFVQVQNLAYPEDPSDPLLLKWVKFSGNPVLVPPPGIGAKDFRDPTTAWKTSSGK 257

Query: 181 WRLGIGSKLEQKGIAMVYSSSDFINWTMHENYLHEVEGTGMWECLDFFPVNMSGSAMGVD 360
WR+ IGSK+ + GI+++Y ++DF + HE LH+V TGMWEC+DF+PV+ + G+D
Sbjct: 258 WRITIGSKINRTGISLIYDTTDFKTYEKHETLLHQVPNTGMWECVDFYPVSKT-QLNGLD 316

Query: 361 TSIYGEDVKHVLKSSMDNSKLDFY 432
TS+ G DVKHV+K+SMD++++D Y
Sbjct: 317 TSVNGPDVKHVIKASMDDTRIDHY 340



Score = 55.8 bits (133), Expect(2) = 9e-55
Identities = 25/37 (67%), Positives = 31/37 (83%), Gaps = 2/37 (5%)
Frame = +2

Query: 437 IGTYDYENYTFIPDDPSADLGL--GLRYDYGKFYASK 541
IGTYD N T++PD+PS D+G+ GLRYDYGK+YASK
Sbjct: 342 IGTYDDSNATWVPDNPSIDVGISTGLRYDYGKYYASK 378