DK955090
Clone id TST39A01NGRL0022_C19
Library
Length 687
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_C19. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
CAATAGCGTTTTTTTACTCCACTTCACTACGCTGCTCTGCGCCCGCGCCGCAACATGTTC
AAGTCAAAGCGACCTCCAGAGTTTCAAACCGTCATTGTGAAGGTGGATATGCGCACTGAA
TCATGCAGCAAAAAGGTTGTCAAGTGTCTACAGGCCATGGAAAATGTGGAGGAGTATGAC
GTAAATCTGGCAGAGAAGAAAGTGACAGTAACAGGACGGGTAGACCCAAAGAAGCTGGTT
AAGCGCTTGGAACGAAAGAGTGGTCGGCATGCTGAACTTTGGACTGAAAGAAGCTTAGCA
TCGCTCTCATCCCGCAAGAGTTGGAGGTTTGGCACTAGCTTCCGAGACTCTTTCAAGAGG
GCAACCACCGTTTTCAGTGATGAAGATACCAACTCTTGCTCCATCATGTAGGTATCGCCT
TGTGACGACAATAATGTACAACCTGAACTAGCTTTTCCCTCTTTCTCTGTCTCTCCCCCC
ATATACTCTAAAACCTTTAGGCAGCACACCGCCACCGTTGTACCATATCGATCTGCATCA
TAGCCCATTTCTCTTGCAACCACTGTCACAAATGCAGTCTGAGGCGTGTGGTCACCAGTA
TCTCTGCTGATCTGCCTCTGCTCCCAGGTTGTTGTTGTTGTACACTAAATGTCTCTCTCT
CTCTCTCAAAAAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id Q6BK66
Definition sp|Q6BK66|CCS1_DEBHA Superoxide dismutase 1 copper chaperone OS=Debaryomyces hansenii
Align length 54
Score (bit) 40.0
E-value 0.011
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955090|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_C19, 5'
(667 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6BK66|CCS1_DEBHA Superoxide dismutase 1 copper chaperone OS=... 40 0.011
sp|Q59385|COPA_ECOLI Copper-exporting P-type ATPase A OS=Escheri... 37 0.095
sp|Q8XD24|COPA_ECO57 Copper-exporting P-type ATPase A OS=Escheri... 37 0.095
sp|Q6BZU2|CCS1_YARLI Superoxide dismutase 1 copper chaperone OS=... 36 0.21
sp|Q9LY77|ACA12_ARATH Putative calcium-transporting ATPase 12, p... 35 0.27
sp|Q8ZCA7|COPA_YERPE Copper-exporting P-type ATPase A OS=Yersini... 34 0.80
sp|Q8ZR95|COPA_SALTY Copper-exporting P-type ATPase A OS=Salmone... 33 1.8
sp|Q8Z8S4|COPA_SALTI Copper-exporting P-type ATPase A OS=Salmone... 33 1.8
sp|Q6CIG2|CCS1_KLULA Superoxide dismutase 1 copper chaperone OS=... 33 1.8
sp|Q9TT99|ATOX1_CANFA Copper transport protein ATOX1 OS=Canis fa... 32 2.3
sp|A5D8V7|CC151_HUMAN Coiled-coil domain-containing protein 151 ... 32 3.9
sp|P35024|RL1_SULAC 50S ribosomal protein L1P OS=Sulfolobus acid... 32 4.0
sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorh... 32 4.0
sp|Q971J1|RL1_SULTO 50S ribosomal protein L1P OS=Sulfolobus toko... 31 5.2
sp|O29777|COPA_ARCFU Probable copper-exporting P-type ATPase A O... 31 5.2
sp|A8MWL8|CH1BL_HUMAN Putative charged multivesicular body prote... 31 6.7
sp|Q03772|CWC15_YEAST Pre-mRNA-splicing factor CWC15 OS=Saccharo... 31 6.8
sp|Q9KPZ7|COPA_VIBCH Copper-exporting P-type ATPase A OS=Vibrio ... 31 6.8
sp|Q970U7|CARB_SULTO Carbamoyl-phosphate synthase large chain OS... 30 8.8
sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium ... 30 8.9

>sp|Q6BK66|CCS1_DEBHA Superoxide dismutase 1 copper chaperone
OS=Debaryomyces hansenii GN=CCS1 PE=3 SV=2
Length = 250

Score = 40.0 bits (92), Expect = 0.011
Identities = 16/54 (29%), Positives = 30/54 (55%)
Frame = +1

Query: 91 VIVKVDMRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLVKRLE 252
++ V M +SC V L+++ + +YD++L VT G V P ++VK ++
Sbjct: 7 IVFAVPMECQSCVDSVSSSLKSLNGISKYDIDLKSNLVTTEGSVPPSEIVKAIQ 60


>sp|Q59385|COPA_ECOLI Copper-exporting P-type ATPase A
OS=Escherichia coli (strain K12) GN=copA PE=1 SV=4
Length = 834

Score = 37.0 bits (84), Expect = 0.095
Identities = 22/56 (39%), Positives = 31/56 (55%)
Frame = +1

Query: 109 MRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLVKRLERKSGRHAE 276
M SC +V LQ++ V + VNLAE+ V G P+ LV+ +E K+G AE
Sbjct: 108 MSCASCVTRVQNALQSVPGVTQARVNLAERTALVMGSASPQDLVQAVE-KAGYGAE 162


>sp|Q8XD24|COPA_ECO57 Copper-exporting P-type ATPase A
OS=Escherichia coli O157:H7 GN=copA PE=3 SV=3
Length = 834

Score = 37.0 bits (84), Expect = 0.095
Identities = 22/56 (39%), Positives = 31/56 (55%)
Frame = +1

Query: 109 MRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLVKRLERKSGRHAE 276
M SC +V LQ++ V + VNLAE+ V G P+ LV+ +E K+G AE
Sbjct: 108 MSCASCVTRVQNALQSVPGVTQARVNLAERTALVMGSASPQDLVQAVE-KAGYGAE 162


>sp|Q6BZU2|CCS1_YARLI Superoxide dismutase 1 copper chaperone
OS=Yarrowia lipolytica GN=CCS1 PE=3 SV=1
Length = 234

Score = 35.8 bits (81), Expect = 0.21
Identities = 16/55 (29%), Positives = 29/55 (52%)
Frame = +1

Query: 88 TVIVKVDMRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLVKRLE 252
T V + ESC V + L ++ +E D L ++ ++VTG P ++VK ++
Sbjct: 4 TTTFAVPLECESCCDSVKQALANVQGIESVDCKLVDQLISVTGTSAPSQIVKAVQ 58


>sp|Q9LY77|ACA12_ARATH Putative calcium-transporting ATPase 12,
plasma membrane-type OS=Arabidopsis thaliana GN=ACA12
PE=2 SV=1
Length = 1033

Score = 35.4 bits (80), Expect = 0.27
Identities = 33/111 (29%), Positives = 51/111 (45%), Gaps = 5/111 (4%)
Frame = -3

Query: 635 TTTWEQRQ--ISRDTGDHTPQTAFVTVVAREMGYDADRYGTTVAVCCLKVL--EYMGGET 468
+TTW Q I++D+ + TP + + +G + G TVA L VL Y G T
Sbjct: 317 STTWGQTMSSINQDSSERTPLQVRLDTLTSTIG----KIGLTVAALVLVVLLVRYFTGNT 372

Query: 467 EKEGKASSGCTLLSSQGDTYMME-QELVSSSLKTVVALLKESRKLVPNLQL 318
EKEGK + + DT + +V++++ VV + E L L L
Sbjct: 373 EKEGKREYNGS--KTPVDTVVNSVVRIVAAAVTIVVVAIPEGLPLAVTLTL 421


>sp|Q8ZCA7|COPA_YERPE Copper-exporting P-type ATPase A OS=Yersinia
pestis GN=copA PE=3 SV=1
Length = 961

Score = 33.9 bits (76), Expect = 0.80
Identities = 20/57 (35%), Positives = 31/57 (54%)
Frame = +1

Query: 109 MRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLVKRLERKSGRHAEL 279
M SC KV LQ ++ V+ VNLAE+ VTG + + L+ + + +G AE+
Sbjct: 235 MSCASCVSKVQNALQRVDGVQVARVNLAERSALVTGTQNNEALIAAV-KNAGYGAEI 290


>sp|Q8ZR95|COPA_SALTY Copper-exporting P-type ATPase A OS=Salmonella
typhimurium GN=copA PE=1 SV=3
Length = 833

Score = 32.7 bits (73), Expect = 1.8
Identities = 21/56 (37%), Positives = 29/56 (51%)
Frame = +1

Query: 109 MRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLVKRLERKSGRHAE 276
M SC +V LQ++ V + VNLAE+ V G LV+ +E K+G AE
Sbjct: 107 MSCASCVTRVQHALQSVPGVTQARVNLAERTALVMGSASAADLVQAVE-KAGYGAE 161


>sp|Q8Z8S4|COPA_SALTI Copper-exporting P-type ATPase A OS=Salmonella
typhi GN=copA PE=3 SV=3
Length = 833

Score = 32.7 bits (73), Expect = 1.8
Identities = 21/56 (37%), Positives = 29/56 (51%)
Frame = +1

Query: 109 MRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLVKRLERKSGRHAE 276
M SC +V LQ++ V + VNLAE+ V G LV+ +E K+G AE
Sbjct: 107 MSCASCVTRVQHALQSVPGVTQARVNLAERTALVMGSASAADLVQAVE-KAGYGAE 161


>sp|Q6CIG2|CCS1_KLULA Superoxide dismutase 1 copper chaperone
OS=Kluyveromyces lactis GN=CCS1 PE=3 SV=1
Length = 245

Score = 32.7 bits (73), Expect = 1.8
Identities = 12/50 (24%), Positives = 26/50 (52%)
Frame = +1

Query: 103 VDMRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLVKRLE 252
V+M ESC+ + KCL+ + ++ ++ + + V G P ++ L+
Sbjct: 15 VEMHCESCTNDIQKCLKDVNGIKNVTFDIKDNLMNVEGHAAPSAIINALK 64


>sp|Q9TT99|ATOX1_CANFA Copper transport protein ATOX1 OS=Canis
familiaris GN=ATOX1 PE=3 SV=1
Length = 68

Score = 32.3 bits (72), Expect = 2.3
Identities = 18/51 (35%), Positives = 27/51 (52%)
Frame = +1

Query: 103 VDMRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLVKRLER 255
VDM E CS V + L + V E+D++L KKV + L++ LE+
Sbjct: 8 VDMTCEGCSNAVSRVLNKLGGV-EFDIDLPNKKVCINSEHSVDILLETLEK 57


tr_hit_id A9NU95
Definition tr|A9NU95|A9NU95_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 134
Score (bit) 72.8
E-value 2.0e-11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955090|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_C19, 5'
(667 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NU95|A9NU95_PICSI Putative uncharacterized protein OS=Picea... 73 2e-11
tr|A9NQ31|A9NQ31_PICSI Putative uncharacterized protein OS=Picea... 73 2e-11
tr|A7P3I8|A7P3I8_VITVI Chromosome chr1 scaffold_5, whole genome ... 70 9e-11
tr|A5BAH0|A5BAH0_VITVI Putative uncharacterized protein OS=Vitis... 70 9e-11
tr|Q9ZRD7|Q9ZRD7_SOYBN GMFP7 (Fragment) OS=Glycine max PE=2 SV=1 70 1e-10
tr|A7NV27|A7NV27_VITVI Chromosome chr18 scaffold_1, whole genome... 70 2e-10
tr|A9NRF2|A9NRF2_PICSI Putative uncharacterized protein OS=Picea... 69 3e-10
tr|A3BY30|A3BY30_ORYSJ Putative uncharacterized protein OS=Oryza... 68 5e-10
tr|Q8LMQ0|Q8LMQ0_ORYSJ Os03g0156600 protein OS=Oryza sativa subs... 68 6e-10
tr|A2XCP5|A2XCP5_ORYSI Putative uncharacterized protein OS=Oryza... 68 6e-10
tr|Q8GTD3|Q8GTD3_HORVD Farnesylated protein 1 OS=Hordeum vulgare... 67 1e-09
tr|B7FMT9|B7FMT9_MEDTR Putative uncharacterized protein OS=Medic... 67 1e-09
tr|Q7XWS9|Q7XWS9_ORYSJ Os04g0244800 protein OS=Oryza sativa subs... 66 2e-09
tr|Q01HL4|Q01HL4_ORYSA H0211F06-OSIGBa0153M17.4 protein OS=Oryza... 66 2e-09
tr|B8LPH2|B8LPH2_PICSI Putative uncharacterized protein OS=Picea... 66 2e-09
tr|A2XR05|A2XR05_ORYSI Putative uncharacterized protein OS=Oryza... 66 2e-09
tr|B6TGP2|B6TGP2_MAIZE Farnesylated protein 1 OS=Zea mays PE=2 SV=1 66 2e-09
tr|A5C6S4|A5C6S4_VITVI Putative uncharacterized protein (Chromos... 66 2e-09
tr|Q9M8T7|Q9M8T7_ARATH F13E7.9 protein OS=Arabidopsis thaliana G... 65 3e-09
tr|B6U3K0|B6U3K0_MAIZE Farnesylated protein 1 OS=Zea mays PE=2 SV=1 65 3e-09
tr|B2MUN5|B2MUN5_9CARY Copper chaperone protein OS=Knorringia si... 65 3e-09
tr|A7PL53|A7PL53_VITVI Chromosome chr7 scaffold_20, whole genome... 65 3e-09
tr|A2Z0E8|A2Z0E8_ORYSI Putative uncharacterized protein OS=Oryza... 65 3e-09
tr|Q8H6J7|Q8H6J7_BRARP Putative farnesylated protein OS=Brassica... 65 5e-09
tr|A7Q091|A7Q091_VITVI Chromosome chr7 scaffold_42, whole genome... 65 5e-09
tr|A7PS01|A7PS01_VITVI Chromosome chr14 scaffold_27, whole genom... 65 5e-09
tr|A5AP55|A5AP55_VITVI Putative uncharacterized protein OS=Vitis... 65 5e-09
tr|B7FM62|B7FM62_MEDTR Putative uncharacterized protein OS=Medic... 64 1e-08
tr|A7P3I9|A7P3I9_VITVI Chromosome chr1 scaffold_5, whole genome ... 64 1e-08
tr|B6SXF1|B6SXF1_MAIZE Farnesylated protein 2 OS=Zea mays PE=2 SV=1 63 1e-08

>tr|A9NU95|A9NU95_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 152

Score = 72.8 bits (177), Expect = 2e-11
Identities = 46/134 (34%), Positives = 74/134 (55%), Gaps = 18/134 (13%)
Frame = +1

Query: 61 KSKRPPEFQTVIVKVDMRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLV 240
++K+ + QTV ++V M E C +K+ K L +M V+ D+N +KVTVTG V+P K++
Sbjct: 20 ENKKRKQLQTVELRVRMDCEGCERKINKVLSSMSGVQTVDINRKMQKVTVTGYVEPNKVL 79

Query: 241 KRLERKSGRHAELWTERSLASLSSRKSWR---------------FGT---SFRDSFKRAT 366
K+++R +G+ AELW S+S S + F T S R + T
Sbjct: 80 KKVKR-TGKRAELWPYVPYNSVSQPFSTQNYDKKAPSGFVRKESFNTRSYSNRQDDQYGT 138

Query: 367 TVFSDEDTNSCSIM 408
+FS+E+ N+C+IM
Sbjct: 139 NMFSEENPNACTIM 152


>tr|A9NQ31|A9NQ31_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 152

Score = 72.8 bits (177), Expect = 2e-11
Identities = 46/134 (34%), Positives = 74/134 (55%), Gaps = 18/134 (13%)
Frame = +1

Query: 61 KSKRPPEFQTVIVKVDMRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLV 240
++K+ + QTV ++V M E C +K+ K L +M V+ D+N +KVTVTG V+P K++
Sbjct: 20 ENKKRKQLQTVELRVRMDCEGCERKINKVLSSMSGVQTVDINRKMQKVTVTGYVEPNKVL 79

Query: 241 KRLERKSGRHAELWTERSLASLSSRKSWR---------------FGT---SFRDSFKRAT 366
K+++R +G+ AELW S+S S + F T S R + T
Sbjct: 80 KKVKR-TGKRAELWPYVPYNSVSQPFSTQNYDKKAPSGFVRKESFNTRSYSNRQDDQYGT 138

Query: 367 TVFSDEDTNSCSIM 408
+FS+E+ N+C+IM
Sbjct: 139 NMFSEENPNACTIM 152


>tr|A7P3I8|A7P3I8_VITVI Chromosome chr1 scaffold_5, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00030458001
PE=4 SV=1
Length = 147

Score = 70.5 bits (171), Expect = 9e-11
Identities = 44/132 (33%), Positives = 72/132 (54%), Gaps = 16/132 (12%)
Frame = +1

Query: 61 KSKRPPEFQTVIVKVDMRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLV 240
KSKR P QTV +KV M + C ++V + +M+ V+ D+N + +VTV+G VDP K++
Sbjct: 18 KSKRKP-MQTVDIKVKMDCDGCERRVKNAVSSMKGVKTVDINRKQSRVTVSGFVDPNKVL 76

Query: 241 KRLERKSGRHAELWT----------------ERSLASLSSRKSWRFGTSFRDSFKRATTV 372
KR+ + +G+ AE W ++ S + + S + +R TT+
Sbjct: 77 KRV-KSTGKRAEFWPYVPYNLVYYPYIKEAYDKKAPSGYVKNVVQALPSPSATDERLTTL 135

Query: 373 FSDEDTNSCSIM 408
FSD++ N+CSIM
Sbjct: 136 FSDDNPNACSIM 147


>tr|A5BAH0|A5BAH0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_023249 PE=4 SV=1
Length = 170

Score = 70.5 bits (171), Expect = 9e-11
Identities = 44/132 (33%), Positives = 72/132 (54%), Gaps = 16/132 (12%)
Frame = +1

Query: 61 KSKRPPEFQTVIVKVDMRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLV 240
KSKR P QTV +KV M + C ++V + +M+ V+ D+N + +VTV+G VDP K++
Sbjct: 18 KSKRKP-MQTVDIKVKMDCDGCERRVKNAVSSMKGVKTVDINRKQSRVTVSGFVDPNKVL 76

Query: 241 KRLERKSGRHAELWT----------------ERSLASLSSRKSWRFGTSFRDSFKRATTV 372
KR+ + +G+ AE W ++ S + + S + +R TT+
Sbjct: 77 KRV-KSTGKRAEFWPYVPYNLVYYPYIKEAYDKKAPSGYVKNVVQALPSPSATDERLTTL 135

Query: 373 FSDEDTNSCSIM 408
FSD++ N+CSIM
Sbjct: 136 FSDDNPNACSIM 147


>tr|Q9ZRD7|Q9ZRD7_SOYBN GMFP7 (Fragment) OS=Glycine max PE=2 SV=1
Length = 138

Score = 70.1 bits (170), Expect = 1e-10
Identities = 33/72 (45%), Positives = 48/72 (66%)
Frame = +1

Query: 67 KRPPEFQTVIVKVDMRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLVKR 246
K+ +FQTV VKV M E C +KV K ++ M+ V E +V+ KVTV+G V+P K+V R
Sbjct: 4 KKRKQFQTVEVKVKMDCEGCERKVKKSVEGMKGVTEVEVDRKASKVTVSGYVEPSKVVSR 63

Query: 247 LERKSGRHAELW 282
+ ++G+ AELW
Sbjct: 64 IAHRTGKRAELW 75


>tr|A7NV27|A7NV27_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015277001
PE=4 SV=1
Length = 149

Score = 69.7 bits (169), Expect = 2e-10
Identities = 46/133 (34%), Positives = 73/133 (54%), Gaps = 17/133 (12%)
Frame = +1

Query: 61 KSKRPPEFQTVIVKVDMRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLV 240
K K+ + QTV +KV M E C KV K L +++ V+ DVNL ++K +VTG D KK++
Sbjct: 18 KGKKRKQLQTVDLKVRMDCEGCQLKVKKALSSLKGVKSVDVNLKQQKASVTGYADAKKVL 77

Query: 241 KRLERKSGRHAELW--------TERSLASLSSRKS----WRFG-----TSFRDSFKRATT 369
K+ + +G+ AELW +A + +K+ R T+ ++ TT
Sbjct: 78 KKAQ-STGKKAELWPYVPYNLVAHPYVAQVYDKKAPPGYVRSSENPAITAMSPLEEQYTT 136

Query: 370 VFSDEDTNSCSIM 408
+FSD++ N+CSIM
Sbjct: 137 MFSDDNPNACSIM 149


>tr|A9NRF2|A9NRF2_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 150

Score = 68.9 bits (167), Expect = 3e-10
Identities = 40/133 (30%), Positives = 73/133 (54%), Gaps = 17/133 (12%)
Frame = +1

Query: 61 KSKRPPEFQTVIVKVDMRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLV 240
K K+ + QTV +KV M + C +KV + +M+ V+ DV+ E+KVTVTG VD K++
Sbjct: 19 KHKKMKQLQTVELKVRMDCDGCERKVKNAISSMKGVKSVDVSRKEQKVTVTGYVDANKVL 78

Query: 241 KRLERKSGRHAELW-----------------TERSLASLSSRKSWRFGTSFRDSFKRATT 369
K++ + +G+ AE+W +++ A + + + ++ TT
Sbjct: 79 KKV-KATGKRAEVWPYVPYSLVAQPYTAQAYDKKAPAGYVRKVESHTFPNLNSTDEQYTT 137

Query: 370 VFSDEDTNSCSIM 408
+FS+++TN+C+IM
Sbjct: 138 LFSEDNTNACTIM 150


>tr|A3BY30|A3BY30_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_027952 PE=4 SV=1
Length = 160

Score = 68.2 bits (165), Expect = 5e-10
Identities = 44/138 (31%), Positives = 70/138 (50%), Gaps = 24/138 (17%)
Frame = +1

Query: 67 KRPPEFQTVIVKVDMRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLVKR 246
K+ +FQTV +KV M + C KV L +M+ V+ ++N + KVTV G V+P K+VKR
Sbjct: 24 KKRKQFQTVELKVRMDCDGCELKVRNALSSMKGVQSVEINRKQYKVTVQGFVEPHKVVKR 83

Query: 247 LERKSGRHAELWT------------------------ERSLASLSSRKSWRFGTSFRDSF 354
++ +G+ AE+W R + ++ S+ +
Sbjct: 84 VQ-ATGKKAEIWPYVPYTLVAHPYAAPAYDKRAPPGHVRRVDAVMPVASYGSAAAAAAPE 142

Query: 355 KRATTVFSDEDTNSCSIM 408
+R TT+FSDE+ N+CSIM
Sbjct: 143 ERLTTMFSDENPNACSIM 160


>tr|Q8LMQ0|Q8LMQ0_ORYSJ Os03g0156600 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0011L14.11 PE=2 SV=1
Length = 155

Score = 67.8 bits (164), Expect = 6e-10
Identities = 43/139 (30%), Positives = 68/139 (48%), Gaps = 25/139 (17%)
Frame = +1

Query: 67 KRPPEFQTVIVKVDMRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLVKR 246
K+P +FQ V VKV M E C +KV K ++ M+ V +V+ + KVTVTG V+ +++V R
Sbjct: 21 KKPKQFQKVEVKVRMDCEGCERKVRKAVEEMKGVSSVEVDAKQNKVTVTGYVEQEEVVGR 80

Query: 247 LERKSGRHAELW-------------------------TERSLASLSSRKSWRFGTSFRDS 351
L R++G+ AE W +LA + R +
Sbjct: 81 LRRRAGKKAEPWPYVPYDVVPHPYAPGAYDKKAPPGYVRNALADPDAAPLAR----ATEE 136

Query: 352 FKRATTVFSDEDTNSCSIM 408
++ + FSDE+ NSC++M
Sbjct: 137 EEKLASAFSDENPNSCAVM 155


>tr|A2XCP5|A2XCP5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10080 PE=4 SV=1
Length = 155

Score = 67.8 bits (164), Expect = 6e-10
Identities = 43/139 (30%), Positives = 68/139 (48%), Gaps = 25/139 (17%)
Frame = +1

Query: 67 KRPPEFQTVIVKVDMRTESCSKKVVKCLQAMENVEEYDVNLAEKKVTVTGRVDPKKLVKR 246
K+P +FQ V VKV M E C +KV K ++ M+ V +V+ + KVTVTG V+ +++V R
Sbjct: 21 KKPKQFQKVEVKVRMDCEGCERKVRKAVEEMKGVSSVEVDAKQNKVTVTGYVEQEEVVGR 80

Query: 247 LERKSGRHAELW-------------------------TERSLASLSSRKSWRFGTSFRDS 351
L R++G+ AE W +LA + R +
Sbjct: 81 LRRRAGKKAEPWPYVPYDVVPHPYAPGAYDKKAPPGYVRNALADPDAAPLAR----ATEE 136

Query: 352 FKRATTVFSDEDTNSCSIM 408
++ + FSDE+ NSC++M
Sbjct: 137 EEKLASAFSDENPNSCAVM 155