DK955210
Clone id TST39A01NGRL0022_H20
Library
Length 533
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_H20. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID
Sequence
GGCACAAAAAAAAATTTGTTTGGTAATAAGGGAGAGAAGCTTTCTCCCTCCACTCTCTCC
CCCCTCTCGCAGCAAGTCATGGCGTACAGATCTGATGATGACTACCATTACCTGTTCAAG
GTGGTGCTGATAGGCGATTCGGGCGTTGGCGAGTCCAACTTGCTATCCAGATTCACTCGC
AACGAGTTCAGTCTCGAGTCCAAGTCCACCATTGGGGTAGAGTTTGCTACACACATCATC
AACGTCGATGGCAAGACGATCAAGGCACACATCTGGGACACTGCCGGCCAAGAAAGGTAC
AGAGCCATTACCAGTGCGTACTACCGAGGTGCAGTGGGTGCATTGTTGGTATATGATATA
ACAAGACATGTGACATTTGAGAACGTTGAGCGGTGGTTGAAGGATCTGAAGGATCACACG
GATTCGAATATCGTGGTTATGCTGGTGGGCAACAAGTCCGATCTACGTCATCTAATATCA
GTATCAGCGGACGACAGCCAGGCTTTTGCAGAGAGAGAGGGTCTGTACTTCAT
■■Homology search results ■■ -
sp_hit_id P40393
Definition sp|P40393|RIC2_ORYSJ Ras-related protein RIC2 OS=Oryza sativa subsp. japonica
Align length 149
Score (bit) 259.0
E-value 4.0e-69
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955210|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_H20, 5'
(533 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P40393|RIC2_ORYSJ Ras-related protein RIC2 OS=Oryza sativa su... 259 4e-69
sp|Q01111|YPT3_NICPL Ras-related protein YPT3 OS=Nicotiana plumb... 254 1e-67
sp|Q39572|YPTC6_CHLRE Ras-related protein YPTC6 OS=Chlamydomonas... 252 7e-67
sp|Q9FK68|RAA1C_ARATH Ras-related protein RABA1c OS=Arabidopsis ... 252 7e-67
sp|Q40521|RB11B_TOBAC Ras-related protein Rab11B OS=Nicotiana ta... 250 3e-66
sp|Q40195|RB11E_LOTJA Ras-related protein Rab11E OS=Lotus japoni... 249 8e-66
sp|Q40194|RB11D_LOTJA Ras-related protein Rab11D OS=Lotus japoni... 248 1e-65
sp|P62494|RB11A_RAT Ras-related protein Rab-11A OS=Rattus norveg... 247 3e-65
sp|P62493|RB11A_RABIT Ras-related protein Rab-11A OS=Oryctolagus... 247 3e-65
sp|Q5R9M7|RB11A_PONAB Ras-related protein Rab-11A OS=Pongo abeli... 247 3e-65
sp|Q52NJ1|RB11A_PIG Ras-related protein Rab-11A OS=Sus scrofa GN... 247 3e-65
sp|P62492|RB11A_MOUSE Ras-related protein Rab-11A OS=Mus musculu... 247 3e-65
sp|P62491|RB11A_HUMAN Ras-related protein Rab-11A OS=Homo sapien... 247 3e-65
sp|Q5ZJN2|RB11A_CHICK Ras-related protein Rab-11A OS=Gallus gall... 247 3e-65
sp|P62490|RB11A_CANFA Ras-related protein Rab-11A OS=Canis famil... 247 3e-65
sp|Q2TA29|RB11A_BOVIN Ras-related protein Rab-11A OS=Bos taurus ... 247 3e-65
sp|O35509|RB11B_RAT Ras-related protein Rab-11B OS=Rattus norveg... 244 1e-64
sp|P46638|RB11B_MOUSE Ras-related protein Rab-11B OS=Mus musculu... 244 1e-64
sp|Q15907|RB11B_HUMAN Ras-related protein Rab-11B OS=Homo sapien... 244 1e-64
sp|Q3MHP2|RB11B_BOVIN Ras-related protein Rab-11B OS=Bos taurus ... 244 1e-64
sp|Q39222|RAA1B_ARATH Ras-related protein RABA1b OS=Arabidopsis ... 244 2e-64
sp|P22129|RB11B_DISOM Ras-related protein Rab-11B OS=Discopyge o... 243 3e-64
sp|P28185|RAA1A_ARATH Ras-related protein RABA1a OS=Arabidopsis ... 241 2e-63
sp|O04486|RAA2A_ARATH Ras-related protein RABA2a OS=Arabidopsis ... 240 4e-63
sp|Q39434|RB2BV_BETVU Ras-related protein Rab2BV OS=Beta vulgari... 238 1e-62
sp|Q40193|RB11C_LOTJA Ras-related protein Rab11C OS=Lotus japoni... 236 4e-62
sp|Q96283|RAA2C_ARATH Ras-related protein RABA2c OS=Arabidopsis ... 234 3e-61
sp|Q40523|RB11A_TOBAC Ras-related protein Rab11A OS=Nicotiana ta... 230 3e-60
sp|Q40723|RGP2_ORYSJ Ras-related protein RGP2 OS=Oryza sativa su... 228 1e-59
sp|P17610|YPT3_SCHPO GTP-binding protein ypt3 OS=Schizosaccharom... 218 2e-56

>sp|P40393|RIC2_ORYSJ Ras-related protein RIC2 OS=Oryza sativa
subsp. japonica GN=RIC2 PE=2 SV=2
Length = 217

Score = 259 bits (663), Expect = 4e-69
Identities = 125/149 (83%), Positives = 137/149 (91%)
Frame = +1

Query: 85 YRSDDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKTIK 264
YR++DDY YLFKVVLIGDSGVG+SNLLSRFTRNEFSLESKSTIGVEFAT + VDGK +K
Sbjct: 5 YRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLQVDGKVVK 64

Query: 265 AHIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVVML 444
A IWDTAGQERYRAITSAYYRGAVGALLVYD+TRH TFENVERWLK+L+DHTD NIVVML
Sbjct: 65 AQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLKELRDHTDPNIVVML 124

Query: 445 VGNKSDLRHLISVSADDSQAFAEREGLYF 531
VGNKSDLRHL++V D+ +AFAERE LYF
Sbjct: 125 VGNKSDLRHLVAVQTDEGKAFAERESLYF 153


>sp|Q01111|YPT3_NICPL Ras-related protein YPT3 OS=Nicotiana
plumbaginifolia GN=YPT3 PE=2 SV=1
Length = 218

Score = 254 bits (650), Expect = 1e-67
Identities = 120/149 (80%), Positives = 138/149 (92%)
Frame = +1

Query: 85 YRSDDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKTIK 264
YR+DD+Y YLFK+VLIGDSGVG+SNLLSRFT+NEF+LESKSTIGVEFAT +N+D K IK
Sbjct: 4 YRADDEYDYLFKLVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATKSLNIDNKVIK 63

Query: 265 AHIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVVML 444
A IWDTAGQERYRAITSAYYRGAVGALLVYD+TRHVT+ENV RWLK+L+DHTD NIVVML
Sbjct: 64 AQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTYENVTRWLKELRDHTDPNIVVML 123

Query: 445 VGNKSDLRHLISVSADDSQAFAEREGLYF 531
+GNKSDLRHL++VS D+++ AEREGLYF
Sbjct: 124 IGNKSDLRHLVAVSTDEAKGLAEREGLYF 152


>sp|Q39572|YPTC6_CHLRE Ras-related protein YPTC6 OS=Chlamydomonas
reinhardtii GN=YPTC6 PE=3 SV=1
Length = 216

Score = 252 bits (644), Expect = 7e-67
Identities = 125/151 (82%), Positives = 136/151 (90%)
Frame = +1

Query: 79 MAYRSDDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKT 258
M+++ DDDY YLFKVVLIGDSGVG+SNLLSRFTRNEFSLESKSTIGVEFAT I VDGKT
Sbjct: 1 MSHKPDDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIQVDGKT 60

Query: 259 IKAHIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVV 438
IKA IWDTAGQERYRAITSAYYRGAVGALLVYDIT+ VTFENVERWLK+L+DH DSNIV+
Sbjct: 61 IKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKSVTFENVERWLKELRDHADSNIVI 120

Query: 439 MLVGNKSDLRHLISVSADDSQAFAEREGLYF 531
MLVGNKSDL+HL V + +QAF EREGL F
Sbjct: 121 MLVGNKSDLKHLRDVQTEVAQAFCEREGLSF 151


>sp|Q9FK68|RAA1C_ARATH Ras-related protein RABA1c OS=Arabidopsis
thaliana GN=RABA1C PE=1 SV=1
Length = 216

Score = 252 bits (644), Expect = 7e-67
Identities = 121/149 (81%), Positives = 137/149 (91%)
Frame = +1

Query: 85 YRSDDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKTIK 264
YR+DD+Y YLFKVVLIGDSGVG+SNLLSRFT+NEFSLESKSTIGVEFAT +NVD K IK
Sbjct: 4 YRADDEYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSLNVDDKVIK 63

Query: 265 AHIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVVML 444
A IWDTAGQERYRAITSAYYRGAVGALLVYD+TRH TFENVE WLK+L++HTD NIVVML
Sbjct: 64 AQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVETWLKELRNHTDPNIVVML 123

Query: 445 VGNKSDLRHLISVSADDSQAFAEREGLYF 531
VGNKSDLRHL++V +D+++FAE+E LYF
Sbjct: 124 VGNKSDLRHLVAVQTEDAKSFAEKESLYF 152


>sp|Q40521|RB11B_TOBAC Ras-related protein Rab11B OS=Nicotiana
tabacum GN=RAB11B PE=2 SV=1
Length = 217

Score = 250 bits (638), Expect = 3e-66
Identities = 120/149 (80%), Positives = 137/149 (91%)
Frame = +1

Query: 85 YRSDDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKTIK 264
YR++DDY YLFK+VLIGDSGVG+SNLLSRF+RNEF+LESKSTIGVEFAT I VD K +K
Sbjct: 5 YRAEDDYDYLFKLVLIGDSGVGKSNLLSRFSRNEFNLESKSTIGVEFATRSIRVDDKIVK 64

Query: 265 AHIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVVML 444
A IWDTAGQERYRAITSAYYRGAVGAL+VYDITRHVTFENVERWLK+L+DHTD NIV+ML
Sbjct: 65 AQIWDTAGQERYRAITSAYYRGAVGALVVYDITRHVTFENVERWLKELRDHTDQNIVIML 124

Query: 445 VGNKSDLRHLISVSADDSQAFAEREGLYF 531
VGNK+DLRHL +VS +D++AFAERE +F
Sbjct: 125 VGNKADLRHLRAVSTEDAKAFAERENTFF 153


>sp|Q40195|RB11E_LOTJA Ras-related protein Rab11E OS=Lotus japonicus
GN=RAB11E PE=2 SV=1
Length = 218

Score = 249 bits (635), Expect = 8e-66
Identities = 118/149 (79%), Positives = 135/149 (90%)
Frame = +1

Query: 85 YRSDDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKTIK 264
Y++DD+Y YLFK+VLIGDSGVG+SNLLSRFTRNEF+LESKSTIGVEFAT +N+DGK IK
Sbjct: 4 YKADDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATKSLNIDGKVIK 63

Query: 265 AHIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVVML 444
A IWDTAGQERYRAITSAYYRGAVGALLVYD+TR TFE RWLK+L+DHTD NIVVML
Sbjct: 64 AQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRSTTFETAGRWLKELRDHTDPNIVVML 123

Query: 445 VGNKSDLRHLISVSADDSQAFAEREGLYF 531
+GNKSDLRHL++VS +D +AFAE+E LYF
Sbjct: 124 IGNKSDLRHLVTVSTEDGKAFAEKESLYF 152


>sp|Q40194|RB11D_LOTJA Ras-related protein Rab11D OS=Lotus japonicus
GN=RAB11D PE=2 SV=1
Length = 218

Score = 248 bits (633), Expect = 1e-65
Identities = 117/149 (78%), Positives = 134/149 (89%)
Frame = +1

Query: 85 YRSDDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKTIK 264
YR+DD+Y YLFK+VLIGDSGVG+SNLLSRFT+NEF+LESKSTIGVEFAT +NVD K +K
Sbjct: 4 YRTDDEYDYLFKLVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATKTLNVDAKVVK 63

Query: 265 AHIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVVML 444
A IWDTAGQERYRAITSAYYRGAVGALLVYD+TR TFEN RWLK+L+DHTD NIVVML
Sbjct: 64 AQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRRATFENAARWLKELRDHTDPNIVVML 123

Query: 445 VGNKSDLRHLISVSADDSQAFAEREGLYF 531
+GNKSDLRHL++V +D ++FAERE LYF
Sbjct: 124 IGNKSDLRHLVAVPTEDGKSFAERESLYF 152


>sp|P62494|RB11A_RAT Ras-related protein Rab-11A OS=Rattus
norvegicus GN=Rab11a PE=1 SV=3
Length = 216

Score = 247 bits (630), Expect = 3e-65
Identities = 120/146 (82%), Positives = 134/146 (91%)
Frame = +1

Query: 94 DDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKTIKAHI 273
DD+Y YLFKVVLIGDSGVG+SNLLSRFTRNEF+LESKSTIGVEFAT I VDGKTIKA I
Sbjct: 5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQI 64

Query: 274 WDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVVMLVGN 453
WDTAGQERYRAITSAYYRGAVGALLVYDI +H+T+ENVERWLK+L+DH DSNIV+MLVGN
Sbjct: 65 WDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGN 124

Query: 454 KSDLRHLISVSADDSQAFAEREGLYF 531
KSDLRHL +V D+++AFAE+ GL F
Sbjct: 125 KSDLRHLRAVPTDEARAFAEKNGLSF 150


>sp|P62493|RB11A_RABIT Ras-related protein Rab-11A OS=Oryctolagus
cuniculus GN=RAB11A PE=2 SV=3
Length = 216

Score = 247 bits (630), Expect = 3e-65
Identities = 120/146 (82%), Positives = 134/146 (91%)
Frame = +1

Query: 94 DDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKTIKAHI 273
DD+Y YLFKVVLIGDSGVG+SNLLSRFTRNEF+LESKSTIGVEFAT I VDGKTIKA I
Sbjct: 5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQI 64

Query: 274 WDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVVMLVGN 453
WDTAGQERYRAITSAYYRGAVGALLVYDI +H+T+ENVERWLK+L+DH DSNIV+MLVGN
Sbjct: 65 WDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGN 124

Query: 454 KSDLRHLISVSADDSQAFAEREGLYF 531
KSDLRHL +V D+++AFAE+ GL F
Sbjct: 125 KSDLRHLRAVPTDEARAFAEKNGLSF 150


>sp|Q5R9M7|RB11A_PONAB Ras-related protein Rab-11A OS=Pongo abelii
GN=RAB11A PE=2 SV=3
Length = 216

Score = 247 bits (630), Expect = 3e-65
Identities = 120/146 (82%), Positives = 134/146 (91%)
Frame = +1

Query: 94 DDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKTIKAHI 273
DD+Y YLFKVVLIGDSGVG+SNLLSRFTRNEF+LESKSTIGVEFAT I VDGKTIKA I
Sbjct: 5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQI 64

Query: 274 WDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVVMLVGN 453
WDTAGQERYRAITSAYYRGAVGALLVYDI +H+T+ENVERWLK+L+DH DSNIV+MLVGN
Sbjct: 65 WDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGN 124

Query: 454 KSDLRHLISVSADDSQAFAEREGLYF 531
KSDLRHL +V D+++AFAE+ GL F
Sbjct: 125 KSDLRHLRAVPTDEARAFAEKNGLSF 150


tr_hit_id A9NV29
Definition tr|A9NV29|A9NV29_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 151
Score (bit) 268.0
E-value 1.0e-70
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955210|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_H20, 5'
(533 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NV29|A9NV29_PICSI Putative uncharacterized protein OS=Picea... 268 1e-70
tr|A9NZD1|A9NZD1_PICSI Putative uncharacterized protein OS=Picea... 261 1e-68
tr|A7QDG9|A7QDG9_VITVI Chromosome chr10 scaffold_81, whole genom... 261 2e-68
tr|Q6DXU0|Q6DXU0_GOSHI Putative GTP-binding protein OS=Gossypium... 260 3e-68
tr|Q6DXS7|Q6DXS7_GOSHI Putative GTP-binding protein OS=Gossypium... 260 3e-68
tr|B2ZAR1|B2ZAR1_GOSRA Putative GTP-binding protein OS=Gossypium... 260 3e-68
tr|Q0DBM2|Q0DBM2_ORYSJ Os06g0551400 protein OS=Oryza sativa subs... 259 5e-68
tr|B6TJP1|B6TJP1_MAIZE Ras-related protein RIC2 OS=Zea mays PE=2... 259 5e-68
tr|B4FIB2|B4FIB2_MAIZE Putative uncharacterized protein OS=Zea m... 259 5e-68
tr|A9T2Z0|A9T2Z0_PHYPA Rab11/RabA-family small GTPase OS=Physcom... 259 5e-68
tr|A2YDY6|A2YDY6_ORYSI Putative uncharacterized protein OS=Oryza... 259 5e-68
tr|B2ZAS4|B2ZAS4_9ROSI Putative GTP-binding protein OS=Gossypioi... 259 6e-68
tr|A9TDJ8|A9TDJ8_PHYPA Rab11/RabA-family small GTPase OS=Physcom... 259 8e-68
tr|A9SJB2|A9SJB2_PHYPA Predicted protein OS=Physcomitrella paten... 259 8e-68
tr|A9PCP6|A9PCP6_POPTR Putative uncharacterized protein OS=Popul... 259 8e-68
tr|A5ART2|A5ART2_VITVI Putative uncharacterized protein OS=Vitis... 259 8e-68
tr|Q68HC1|Q68HC1_WHEAT Rab GTP-binding protein OS=Triticum aesti... 258 1e-67
tr|A7P1V6|A7P1V6_VITVI Chromosome chr19 scaffold_4, whole genome... 258 1e-67
tr|Q6AUF8|Q6AUF8_ORYSJ Os05g0564400 protein OS=Oryza sativa subs... 258 2e-67
tr|A9RQ44|A9RQ44_PHYPA Rab11/RabA-family small GTPase OS=Physcom... 258 2e-67
tr|A7QPP6|A7QPP6_VITVI Chromosome chr10 scaffold_138, whole geno... 258 2e-67
tr|Q0J2L0|Q0J2L0_ORYSJ Os09g0327100 protein (Fragment) OS=Oryza ... 257 3e-67
tr|A9RSL8|A9RSL8_PHYPA Rab11/RabA-family small GTPase OS=Physcom... 257 3e-67
tr|A5BUD1|A5BUD1_VITVI Putative uncharacterized protein (Chromos... 257 3e-67
tr|Q7DLK8|Q7DLK8_VICFA Guanine nucleotide regulatory protein OS=... 256 5e-67
tr|Q6K2P6|Q6K2P6_ORYSJ cDNA clone:J023092H24, full insert sequen... 256 5e-67
tr|Q08150|Q08150_PEA GTP-binding protein OS=Pisum sativum PE=2 SV=1 256 5e-67
tr|Q08149|Q08149_PEA GTP-binding protein OS=Pisum sativum PE=2 SV=1 256 5e-67
tr|A2YZX0|A2YZX0_ORYSI Putative uncharacterized protein OS=Oryza... 256 5e-67
tr|B4FQ28|B4FQ28_MAIZE Putative uncharacterized protein OS=Zea m... 256 7e-67

>tr|A9NV29|A9NV29_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 216

Score = 268 bits (686), Expect = 1e-70
Identities = 133/151 (88%), Positives = 141/151 (93%)
Frame = +1

Query: 79 MAYRSDDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKT 258
MAY+ DDDY YLFKVVLIGDSGVG+SNLLSRFTRNEFSLESKSTIGVEFAT INVDGK
Sbjct: 1 MAYKVDDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSINVDGKM 60

Query: 259 IKAHIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVV 438
IKA IWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLK+L+DHT+ NIVV
Sbjct: 61 IKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKELRDHTEHNIVV 120

Query: 439 MLVGNKSDLRHLISVSADDSQAFAEREGLYF 531
MLVGNKSDLRHL +VS +D+Q FAEREGLYF
Sbjct: 121 MLVGNKSDLRHLRAVSTEDAQTFAEREGLYF 151


>tr|A9NZD1|A9NZD1_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 217

Score = 261 bits (668), Expect = 1e-68
Identities = 128/151 (84%), Positives = 139/151 (92%)
Frame = +1

Query: 79 MAYRSDDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKT 258
MAYR+DDDY YLFKVVLIGDSGVG+SNLLSRFTRNEFSLESKSTIGVEFAT I VD K
Sbjct: 1 MAYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSITVDDKV 60

Query: 259 IKAHIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVV 438
IKA IWDTAGQERYRAITSAYYRGAVGALLVYD+TRHVTFENVERWLK+L+DHTD+NIV+
Sbjct: 61 IKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDANIVI 120

Query: 439 MLVGNKSDLRHLISVSADDSQAFAEREGLYF 531
MLVGNK+DLRHL +VS +D +AFAERE YF
Sbjct: 121 MLVGNKADLRHLRAVSIEDGKAFAERENTYF 151


>tr|A7QDG9|A7QDG9_VITVI Chromosome chr10 scaffold_81, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00035834001
PE=3 SV=1
Length = 218

Score = 261 bits (667), Expect = 2e-68
Identities = 125/149 (83%), Positives = 139/149 (93%)
Frame = +1

Query: 85 YRSDDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKTIK 264
YR++DDY YLFKVVLIGDSGVG+SNLLSRFTRNEFSLESKSTIGVEFAT +NVDGK IK
Sbjct: 4 YRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVDGKVIK 63

Query: 265 AHIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVVML 444
A IWDTAGQERYRAITSAYYRGAVGALLVYD+TRH TFENVERWL++L+DHTD NIVVML
Sbjct: 64 AQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVML 123

Query: 445 VGNKSDLRHLISVSADDSQAFAEREGLYF 531
+GNKSDLRHL++VS +D ++FAERE LYF
Sbjct: 124 IGNKSDLRHLVAVSTEDGKSFAERESLYF 152


>tr|Q6DXU0|Q6DXU0_GOSHI Putative GTP-binding protein OS=Gossypium
hirsutum PE=3 SV=1
Length = 218

Score = 260 bits (665), Expect = 3e-68
Identities = 125/149 (83%), Positives = 139/149 (93%)
Frame = +1

Query: 85 YRSDDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKTIK 264
YR++DDY YLFKVVLIGDSGVG+SNLLSRFTRNEFSLESKSTIGVEFAT +NVDGK IK
Sbjct: 4 YRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVDGKVIK 63

Query: 265 AHIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVVML 444
A IWDTAGQERYRAITSAYYRGAVGALLVYD+TRH TFENVERWL++L+DHTD NIVVML
Sbjct: 64 AQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVML 123

Query: 445 VGNKSDLRHLISVSADDSQAFAEREGLYF 531
VGNKSDLRHL++VS +D ++FAE+E LYF
Sbjct: 124 VGNKSDLRHLVAVSTEDGKSFAEKESLYF 152


>tr|Q6DXS7|Q6DXS7_GOSHI Putative GTP-binding protein OS=Gossypium
hirsutum PE=3 SV=1
Length = 218

Score = 260 bits (665), Expect = 3e-68
Identities = 125/149 (83%), Positives = 139/149 (93%)
Frame = +1

Query: 85 YRSDDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKTIK 264
YR++DDY YLFKVVLIGDSGVG+SNLLSRFTRNEFSLESKSTIGVEFAT +NVDGK IK
Sbjct: 4 YRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVDGKVIK 63

Query: 265 AHIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVVML 444
A IWDTAGQERYRAITSAYYRGAVGALLVYD+TRH TFENVERWL++L+DHTD NIVVML
Sbjct: 64 AQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVML 123

Query: 445 VGNKSDLRHLISVSADDSQAFAEREGLYF 531
VGNKSDLRHL++VS +D ++FAE+E LYF
Sbjct: 124 VGNKSDLRHLVAVSTEDGKSFAEKESLYF 152


>tr|B2ZAR1|B2ZAR1_GOSRA Putative GTP-binding protein OS=Gossypium
raimondii PE=4 SV=1
Length = 218

Score = 260 bits (665), Expect = 3e-68
Identities = 125/149 (83%), Positives = 139/149 (93%)
Frame = +1

Query: 85 YRSDDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKTIK 264
YR++DDY YLFKVVLIGDSGVG+SNLLSRFTRNEFSLESKSTIGVEFAT +NVDGK IK
Sbjct: 4 YRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVDGKVIK 63

Query: 265 AHIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVVML 444
A IWDTAGQERYRAITSAYYRGAVGALLVYD+TRH TFENVERWL++L+DHTD NIVVML
Sbjct: 64 AQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVML 123

Query: 445 VGNKSDLRHLISVSADDSQAFAEREGLYF 531
VGNKSDLRHL++VS +D ++FAE+E LYF
Sbjct: 124 VGNKSDLRHLVAVSTEDGKSFAEKESLYF 152


>tr|Q0DBM2|Q0DBM2_ORYSJ Os06g0551400 protein OS=Oryza sativa subsp.
japonica GN=Os06g0551400 PE=2 SV=1
Length = 217

Score = 259 bits (663), Expect = 5e-68
Identities = 125/149 (83%), Positives = 137/149 (91%)
Frame = +1

Query: 85 YRSDDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKTIK 264
YR++DDY YLFKVVLIGDSGVG+SNLLSRFTRNEFSLESKSTIGVEFAT + VDGK +K
Sbjct: 5 YRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLQVDGKVVK 64

Query: 265 AHIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVVML 444
A IWDTAGQERYRAITSAYYRGAVGALLVYD+TRH TFENVERWLK+L+DHTD NIVVML
Sbjct: 65 AQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLKELRDHTDPNIVVML 124

Query: 445 VGNKSDLRHLISVSADDSQAFAEREGLYF 531
VGNKSDLRHL++V D+ +AFAERE LYF
Sbjct: 125 VGNKSDLRHLVAVQTDEGKAFAERESLYF 153


>tr|B6TJP1|B6TJP1_MAIZE Ras-related protein RIC2 OS=Zea mays PE=2
SV=1
Length = 217

Score = 259 bits (663), Expect = 5e-68
Identities = 125/149 (83%), Positives = 137/149 (91%)
Frame = +1

Query: 85 YRSDDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKTIK 264
YR++DDY YLFKVVLIGDSGVG+SNLLSRFTRNEFSLESKSTIGVEFAT + VDGK +K
Sbjct: 5 YRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLQVDGKVVK 64

Query: 265 AHIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVVML 444
A IWDTAGQERYRAITSAYYRGAVGALLVYD+TRH TFENVERWLK+L+DHTD NIVVML
Sbjct: 65 AQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLKELRDHTDPNIVVML 124

Query: 445 VGNKSDLRHLISVSADDSQAFAEREGLYF 531
VGNKSDLRHL++V D+ +AFAERE LYF
Sbjct: 125 VGNKSDLRHLVAVQTDEGKAFAERESLYF 153


>tr|B4FIB2|B4FIB2_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 217

Score = 259 bits (663), Expect = 5e-68
Identities = 125/149 (83%), Positives = 137/149 (91%)
Frame = +1

Query: 85 YRSDDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKTIK 264
YR++DDY YLFKVVLIGDSGVG+SNLLSRFTRNEFSLESKSTIGVEFAT + VDGK +K
Sbjct: 5 YRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLQVDGKVVK 64

Query: 265 AHIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVVML 444
A IWDTAGQERYRAITSAYYRGAVGALLVYD+TRH TFENVERWLK+L+DHTD NIVVML
Sbjct: 65 AQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLKELRDHTDPNIVVML 124

Query: 445 VGNKSDLRHLISVSADDSQAFAEREGLYF 531
VGNKSDLRHL++V D+ +AFAERE LYF
Sbjct: 125 VGNKSDLRHLVAVQTDEGKAFAERESLYF 153


>tr|A9T2Z0|A9T2Z0_PHYPA Rab11/RabA-family small GTPase
OS=Physcomitrella patens subsp. patens GN=RabA24 PE=3
SV=1
Length = 216

Score = 259 bits (663), Expect = 5e-68
Identities = 127/151 (84%), Positives = 140/151 (92%)
Frame = +1

Query: 79 MAYRSDDDYHYLFKVVLIGDSGVGESNLLSRFTRNEFSLESKSTIGVEFATHIINVDGKT 258
MA+++DD+Y YLFKVVLIGDSGVG+SNLLSRFTRNEF LESKSTIGVEFAT I VDGKT
Sbjct: 1 MAHKADDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFCLESKSTIGVEFATRSIQVDGKT 60

Query: 259 IKAHIWDTAGQERYRAITSAYYRGAVGALLVYDITRHVTFENVERWLKDLKDHTDSNIVV 438
IKA IWDTAGQERYRAITSAYYRGAVGALLVYDIT+HVT+ENVERWLK+L+DH DSNIV+
Sbjct: 61 IKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKHVTYENVERWLKELRDHADSNIVI 120

Query: 439 MLVGNKSDLRHLISVSADDSQAFAEREGLYF 531
MLVGNKSDLRHL VS DD+Q+FAE+EGL F
Sbjct: 121 MLVGNKSDLRHLRGVSLDDAQSFAEKEGLSF 151