DK955257
Clone id TST39A01NGRL0022_J19
Library
Length 567
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_J19. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
GCAAGCTCATGTGTGCTCGCAACTGCAACTGCTGGAAGCAGCTGCTTCACACACACACAC
ACACACACACACACACACACACGAACAAGCGCGCACACACCCACACACAGAGGATTCCCG
CCACACTACGCTCATTCGATTCCATATTCATTCCTTACTCGCCCATTTAATTACCTGATC
AATCATGGGTCCCTCTGCGGAGAAGCTCAACCCTGCACAACACGCTAAGGAAGCTGCCCA
CATTAGTGCCATCAACATGGGCTTCGCCAGCGTGACCCCTTCCCTCCAATCAGAGCTTCT
GATGAAAGAAAAGGAGAGCTCCAGGCGAGAGCTCTCCTTTCCAGAGCTTGCAGTCAATGG
AAAGCTTCAAAACCATCTGAAAGTCACGCATGAAAATTACTCCGATGTTGATGAAGATGA
TGAAGAAAGTGGGTTTTATTTGCCATACCCAGAAGACTCAGCTGGTGGTGGCTATGGTGT
TGATCAACGAGATGAAGGCACCTCAGATAGCTGGATCAAGAGACACCCGGATCTTGTAAG
GCTCACAGGGAGGCATCCATTTAACTG
■■Homology search results ■■ -
sp_hit_id P23312
Definition sp|P23312|NIA_SPIOL Nitrate reductase [NADH] OS=Spinacia oleracea
Align length 59
Score (bit) 56.6
E-value 8.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955257|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_J19, 5'
(567 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P23312|NIA_SPIOL Nitrate reductase [NADH] OS=Spinacia olerace... 57 8e-08
sp|P27968|NIA7_HORVU Nitrate reductase [NAD(P)H] OS=Hordeum vulg... 56 1e-07
sp|P43101|NIA_CICIN Nitrate reductase [NADH] OS=Cichorium intybu... 56 1e-07
sp|P39864|NIA_PHYIN Nitrate reductase [NADPH] OS=Phytophthora in... 54 7e-07
sp|P17570|NIA_SOLLC Nitrate reductase [NADH] OS=Solanum lycopers... 53 9e-07
sp|P27969|NIA2_HORVU Nitrate reductase [NADH] (Fragment) OS=Hord... 53 1e-06
sp|P11605|NIA1_TOBAC Nitrate reductase [NADH] 1 OS=Nicotiana tab... 52 2e-06
sp|P27967|NIA1_HORVU Nitrate reductase [NADH] OS=Hordeum vulgare... 52 2e-06
sp|P36859|NIA_PETHY Nitrate reductase [NADH] OS=Petunia hybrida ... 52 2e-06
sp|P08509|NIA2_TOBAC Nitrate reductase [NADH] 2 OS=Nicotiana tab... 51 3e-06
sp|P39865|NIA1_PHAVU Nitrate reductase [NADH] 1 OS=Phaseolus vul... 51 3e-06
sp|P39868|NIA2_BRANA Nitrate reductase [NADH], clone PBNBR1412 O... 50 6e-06
sp|P11035|NIA2_ARATH Nitrate reductase [NADH] 2 OS=Arabidopsis t... 50 6e-06
sp|P16081|NIA1_ORYSJ Nitrate reductase [NADH] 1 OS=Oryza sativa ... 50 6e-06
sp|P17569|NIA_CUCMA Nitrate reductase [NADH] OS=Cucurbita maxima... 50 8e-06
sp|P39867|NIA1_BRANA Nitrate reductase [NADH], clone PBNBR1405 O... 50 8e-06
sp|P11832|NIA1_ARATH Nitrate reductase [NADH] 1 OS=Arabidopsis t... 50 8e-06
sp|P39866|NIA2_PHAVU Nitrate reductase [NADH] 2 OS=Phaseolus vul... 50 1e-05
sp|P39870|NIA2_SOYBN Inducible nitrate reductase [NADH] 2 OS=Gly... 49 1e-05
sp|P39869|NIA_LOTJA Nitrate reductase [NADH] OS=Lotus japonicus ... 48 3e-05
sp|P54233|NIA1_SOYBN Inducible nitrate reductase [NADH] 1 OS=Gly... 47 7e-05
sp|P36841|NIA_VOLCA Nitrate reductase [NADH] OS=Volvox carteri G... 47 9e-05
sp|P27783|NIA_BETVE Nitrate reductase [NAD(P)H] OS=Betula verruc... 47 9e-05
sp|P49102|NIA3_MAIZE Nitrate reductase [NADH] 3 OS=Zea mays PE=3... 40 0.008
sp|P49050|NIA_PICAN Nitrate reductase [NADPH] OS=Pichia angusta ... 38 0.031
sp|P39863|NIA_FUSOX Nitrate reductase [NADPH] OS=Fusarium oxyspo... 38 0.040
sp|Q05531|NIA_USTMA Nitrate reductase [NADPH] OS=Ustilago maydis... 37 0.089
sp|P22945|NIA_EMENI Nitrate reductase [NADPH] OS=Emericella nidu... 35 0.26
sp|P36842|NIA_LEPMC Nitrate reductase [NADPH] OS=Leptosphaeria m... 34 0.58
sp|P08354|VGLE_SUHVR Glycoprotein GI OS=Suid herpesvirus 1 (stra... 33 0.75

>sp|P23312|NIA_SPIOL Nitrate reductase [NADH] OS=Spinacia oleracea
GN=NIA PE=1 SV=1
Length = 926

Score = 56.6 bits (135), Expect = 8e-08
Identities = 27/59 (45%), Positives = 37/59 (62%), Gaps = 4/59 (6%)
Frame = +2

Query: 401 SDVDEDDEESGFYLPYPEDSAGGGY----GVDQRDEGTSDSWIKRHPDLVRLTGRHPFN 565
SD +EDD+E+ + G VD RDEGT+D WI+R+P ++RLTG+HPFN
Sbjct: 76 SDSEEDDDENEMNVWNEMIKKGNSELEPSSVDSRDEGTADQWIERNPSMIRLTGKHPFN 134


>sp|P27968|NIA7_HORVU Nitrate reductase [NAD(P)H] OS=Hordeum vulgare
GN=NAR-7 PE=2 SV=1
Length = 891

Score = 56.2 bits (134), Expect = 1e-07
Identities = 30/61 (49%), Positives = 36/61 (59%), Gaps = 6/61 (9%)
Frame = +2

Query: 401 SDVDEDDEES------GFYLPYPEDSAGGGYGVDQRDEGTSDSWIKRHPDLVRLTGRHPF 562
+D D DDE+S Y P + D RDE TSD+W+KRHP LVRLTG+HPF
Sbjct: 41 ADSDSDDEDSVPPDWRSLYSPRLDVEPSVK---DPRDEATSDAWVKRHPALVRLTGKHPF 97

Query: 563 N 565
N
Sbjct: 98 N 98


>sp|P43101|NIA_CICIN Nitrate reductase [NADH] OS=Cichorium intybus
GN=NIA PE=2 SV=1
Length = 920

Score = 55.8 bits (133), Expect = 1e-07
Identities = 29/88 (32%), Positives = 50/88 (56%), Gaps = 1/88 (1%)
Frame = +2

Query: 305 KEKESSRRELSFPELAVNGKLQNHLKVTHENYSDVDEDDEESGFYLPYPEDSAGGGYGV- 481
+ +S R ++P A + K+ E Y D++++E+ + + ++ V
Sbjct: 30 RRSDSPIRNCNYPAAA--REFMTPKKLPPETYDTSDDEEDEADYRDAIKKSNSELESSVF 87

Query: 482 DQRDEGTSDSWIKRHPDLVRLTGRHPFN 565
D RD+GT+D WI+R+P +VRLTG+HPFN
Sbjct: 88 DPRDQGTADQWIERNPSMVRLTGKHPFN 115


>sp|P39864|NIA_PHYIN Nitrate reductase [NADPH] OS=Phytophthora
infestans GN=NIAA PE=3 SV=1
Length = 902

Score = 53.5 bits (127), Expect = 7e-07
Identities = 20/29 (68%), Positives = 24/29 (82%)
Frame = +2

Query: 479 VDQRDEGTSDSWIKRHPDLVRLTGRHPFN 565
+D RD GT D W+ RHP+L+RLTGRHPFN
Sbjct: 84 IDPRDVGTPDEWVPRHPELIRLTGRHPFN 112


>sp|P17570|NIA_SOLLC Nitrate reductase [NADH] OS=Solanum
lycopersicum GN=NIA PE=3 SV=1
Length = 911

Score = 53.1 bits (126), Expect = 9e-07
Identities = 31/90 (34%), Positives = 49/90 (54%), Gaps = 6/90 (6%)
Frame = +2

Query: 314 ESSRRELSFP-----ELAVNGKLQNHLKVTHENYSDVDEDDEESGFYLPYPEDSAGGGYG 478
+S R +FP EL K + + + + D D+DDE++ + +
Sbjct: 29 DSPVRGCNFPPSSNHELPFQKKQNPPIYLDYSSSEDEDDDDEKNEYVQMIKKGKTELEPS 88

Query: 479 V-DQRDEGTSDSWIKRHPDLVRLTGRHPFN 565
+ D RDEGT+D+WI+R+ L+RLTG+HPFN
Sbjct: 89 IHDTRDEGTADNWIERNFSLIRLTGKHPFN 118


>sp|P27969|NIA2_HORVU Nitrate reductase [NADH] (Fragment) OS=Hordeum
vulgare PE=2 SV=1
Length = 912

Score = 52.8 bits (125), Expect = 1e-06
Identities = 29/68 (42%), Positives = 39/68 (57%), Gaps = 7/68 (10%)
Frame = +2

Query: 383 VTHENYSDVDEDDEES-------GFYLPYPEDSAGGGYGVDQRDEGTSDSWIKRHPDLVR 541
V E+ D DEDDE G +L + + D RDEGT+D+WI+R+P L+R
Sbjct: 53 VAEEDEEDDDEDDEGHEDWREAYGSHLQLEVEPSTR----DPRDEGTADAWIERNPSLIR 108

Query: 542 LTGRHPFN 565
LTG+HP N
Sbjct: 109 LTGKHPLN 116


>sp|P11605|NIA1_TOBAC Nitrate reductase [NADH] 1 OS=Nicotiana
tabacum GN=NIA1 PE=3 SV=1
Length = 904

Score = 52.4 bits (124), Expect = 2e-06
Identities = 27/57 (47%), Positives = 38/57 (66%), Gaps = 2/57 (3%)
Frame = +2

Query: 401 SDVDEDDEESGFYLPYPE--DSAGGGYGVDQRDEGTSDSWIKRHPDLVRLTGRHPFN 565
S+ D+DD+E YL + +S D RDEGT+D+WI+R+ L+RLTG+HPFN
Sbjct: 57 SEDDDDDDEKNEYLQMIKKGNSELEPSVHDSRDEGTADNWIERNFSLIRLTGKHPFN 113


>sp|P27967|NIA1_HORVU Nitrate reductase [NADH] OS=Hordeum vulgare
PE=3 SV=1
Length = 915

Score = 52.4 bits (124), Expect = 2e-06
Identities = 29/68 (42%), Positives = 38/68 (55%), Gaps = 7/68 (10%)
Frame = +2

Query: 383 VTHENYSDVDEDDEES-------GFYLPYPEDSAGGGYGVDQRDEGTSDSWIKRHPDLVR 541
V E D DEDDE G +L + + D RDEGT+D+WI+R+P L+R
Sbjct: 56 VAEEEEDDDDEDDEGHEDWREAYGSHLQLEVEPSTR----DPRDEGTADAWIERNPSLIR 111

Query: 542 LTGRHPFN 565
LTG+HP N
Sbjct: 112 LTGKHPLN 119


>sp|P36859|NIA_PETHY Nitrate reductase [NADH] OS=Petunia hybrida
GN=NIA PE=2 SV=1
Length = 909

Score = 52.0 bits (123), Expect = 2e-06
Identities = 39/120 (32%), Positives = 58/120 (48%), Gaps = 13/120 (10%)
Frame = +2

Query: 245 SAINMGFASVTPSLQSEL--LMKEKESSRRELSFPELAVNGKLQNHLKVTHENY------ 400
S N F+ + P L + +S R +FP +N +L N K +
Sbjct: 4 SVENRQFSHLEPGLSGVVRSFKPRSDSPVRGCNFP---LNNELTNFQKKPNTTIYLDCSS 60

Query: 401 SDVDEDDEESGFYLPYPEDSAGGGYGV-----DQRDEGTSDSWIKRHPDLVRLTGRHPFN 565
S+ D+DD++ YL G V D RDEGT+D+WI+R+ ++RLTG+HPFN
Sbjct: 61 SEDDDDDDDKNEYLQMIRK---GKLEVEPSVHDIRDEGTADNWIERNNSMIRLTGKHPFN 117


>sp|P08509|NIA2_TOBAC Nitrate reductase [NADH] 2 OS=Nicotiana
tabacum GN=NIA2 PE=2 SV=2
Length = 904

Score = 51.2 bits (121), Expect = 3e-06
Identities = 26/57 (45%), Positives = 38/57 (66%), Gaps = 2/57 (3%)
Frame = +2

Query: 401 SDVDEDDEESGFYLPYPE--DSAGGGYGVDQRDEGTSDSWIKRHPDLVRLTGRHPFN 565
S+ D+DD+E YL + +S D RDEGT+D+WI+R+ ++RLTG+HPFN
Sbjct: 57 SEDDDDDDEKNEYLQMIKKGNSELEPSVHDTRDEGTADNWIERNFSMIRLTGKHPFN 113


tr_hit_id Q4LEW8
Definition tr|Q4LEW8|Q4LEW8_PHYPA Pyridine nucleotide-dependent nitrate reductase (Nitrate reductase) OS=Physcomitrella patens
Align length 63
Score (bit) 62.4
E-value 2.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955257|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_J19, 5'
(567 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q4LEW8|Q4LEW8_PHYPA Pyridine nucleotide-dependent nitrate red... 62 2e-08
tr|A9SHD3|A9SHD3_PHYPA Predicted protein OS=Physcomitrella paten... 62 2e-08
tr|Q93XS1|Q93XS1_PRUPE Nitrate reductase OS=Prunus persica GN=Pp... 61 4e-08
tr|A9S9K7|A9S9K7_PHYPA Predicted protein OS=Physcomitrella paten... 60 6e-08
tr|Q4LEW9|Q4LEW9_PHYPA Pyridine nucleotide-dependent nitrate red... 60 1e-07
tr|A9S9L0|A9S9L0_PHYPA Predicted protein OS=Physcomitrella paten... 60 1e-07
tr|Q6ZHH7|Q6ZHH7_ORYSJ Os02g0770800 protein OS=Oryza sativa subs... 57 7e-07
tr|B8AJ60|B8AJ60_ORYSI Putative uncharacterized protein OS=Oryza... 57 7e-07
tr|A3ABS4|A3ABS4_ORYSJ Putative uncharacterized protein OS=Oryza... 57 7e-07
tr|Q9FUC2|Q9FUC2_RICCO Nitrate reductase OS=Ricinus communis GN=... 55 3e-06
tr|A7NV67|A7NV67_VITVI Chromosome chr18 scaffold_1, whole genome... 53 1e-05
tr|A8IJ84|A8IJ84_BETVU Nitrate reductase OS=Beta vulgaris GN=NR ... 53 1e-05
tr|Q8LT13|Q8LT13_SOLTU Nitrate reductase OS=Solanum tuberosum GN... 52 2e-05
tr|Q42497|Q42497_CHLVU Nitrate reductase OS=Chlorella vulgaris P... 52 2e-05
tr|O24390|O24390_SOLTU NADH nitrate reductase OS=Solanum tuberos... 52 2e-05
tr|O04926|O04926_SOLTU NADH nitrate reductase OS=Solanum tuberos... 52 2e-05
tr|A0MLW3|A0MLW3_CHLVU Nitrate reductase OS=Chlorella vulgaris P... 52 2e-05
tr|Q84LQ4|Q84LQ4_CHLEL Nitrate reductase OS=Chlorella ellipsoide... 52 2e-05
tr|Q7XZI6|Q7XZI6_CHLEL Nitrate reductase (Fragment) OS=Chlorella... 52 2e-05
tr|Q43042|Q43042_PETHY Nitrate reductase apoenzyme OS=Petunia hy... 52 2e-05
tr|A3ABS1|A3ABS1_ORYSJ Putative uncharacterized protein OS=Oryza... 52 3e-05
tr|Q8H1T7|Q8H1T7_TILPL Nitrate reductase OS=Tilia platyphyllos G... 51 4e-05
tr|Q5QIV6|Q5QIV6_9SOLA Nitrate reductase (Fragment) OS=Nicotiana... 51 4e-05
tr|Q3C1F0|Q3C1F0_NICBE Nitrate reductase OS=Nicotiana benthamian... 51 4e-05
tr|Q18NX4|Q18NX4_NICBE Nitrate reductase 2 OS=Nicotiana benthami... 51 4e-05
tr|A9XF45|A9XF45_CHLVU Nitrate reductase OS=Chlorella vulgaris P... 51 4e-05
tr|A4S3I7|A4S3I7_OSTLU Predicted protein (Fragment) OS=Ostreococ... 51 4e-05
tr|Q94C76|Q94C76_ARATH Putative nitrate reductase OS=Arabidopsis... 50 7e-05
tr|Q0WLH2|Q0WLH2_ARATH Nitrate reductase OS=Arabidopsis thaliana... 50 7e-05
tr|Q0J545|Q0J545_ORYSJ Os08g0468100 protein OS=Oryza sativa subs... 50 7e-05

>tr|Q4LEW8|Q4LEW8_PHYPA Pyridine nucleotide-dependent nitrate
reductase (Nitrate reductase) OS=Physcomitrella patens
GN=Nia1;2 PE=2 SV=1
Length = 892

Score = 62.4 bits (150), Expect = 2e-08
Identities = 35/63 (55%), Positives = 40/63 (63%), Gaps = 8/63 (12%)
Frame = +2

Query: 401 SDVDE-DDEESGFYLPYPEDSAGGGYG-------VDQRDEGTSDSWIKRHPDLVRLTGRH 556
S+ +E DDEES ED GY VD+RD+GTSD WI RHP+LVRLTGRH
Sbjct: 59 SETEEFDDEESA-----SEDEKVMGYAAEIPITKVDERDKGTSDDWIPRHPELVRLTGRH 113

Query: 557 PFN 565
PFN
Sbjct: 114 PFN 116


>tr|A9SHD3|A9SHD3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_184973 PE=4 SV=1
Length = 892

Score = 62.4 bits (150), Expect = 2e-08
Identities = 35/63 (55%), Positives = 40/63 (63%), Gaps = 8/63 (12%)
Frame = +2

Query: 401 SDVDE-DDEESGFYLPYPEDSAGGGYG-------VDQRDEGTSDSWIKRHPDLVRLTGRH 556
S+ +E DDEES ED GY VD+RD+GTSD WI RHP+LVRLTGRH
Sbjct: 59 SETEEFDDEESA-----SEDEKVMGYAAEIPITKVDERDKGTSDDWIPRHPELVRLTGRH 113

Query: 557 PFN 565
PFN
Sbjct: 114 PFN 116


>tr|Q93XS1|Q93XS1_PRUPE Nitrate reductase OS=Prunus persica GN=PpNR1
PE=2 SV=1
Length = 906

Score = 61.2 bits (147), Expect = 4e-08
Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 14/94 (14%)
Frame = +2

Query: 326 RELSFPELAVNGKLQNHLKVTHENYSDVDEDDEESGFYLPYPEDSAGGGYG--------- 478
R +F +L N +++ +Y +DD+E+ D+ GG YG
Sbjct: 22 RSFNFSDLTRPKTTANFVEIDDASYFSSSDDDDEN--------DNPGGEYGDLIRKGNSE 73

Query: 479 -----VDQRDEGTSDSWIKRHPDLVRLTGRHPFN 565
+D RDE TSDSW+ R+P +VRLTG+HPFN
Sbjct: 74 LEPSILDPRDEATSDSWVHRNPSMVRLTGKHPFN 107


>tr|A9S9K7|A9S9K7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_126122 PE=4 SV=1
Length = 892

Score = 60.5 bits (145), Expect = 6e-08
Identities = 41/117 (35%), Positives = 60/117 (51%), Gaps = 14/117 (11%)
Frame = +2

Query: 257 MGFASVTPSLQSELL-------MKEKESSRRELSFP-----ELAVNGKLQNHLKVTHENY 400
MG + +P L +E+L +K K S+ P E+A + +++ V + +
Sbjct: 1 MGVSVASPVLSNEVLGHHDADLLKTKLVSKGGFQPPKLLQEEMAPSSIIKSLAVVDTDEF 60

Query: 401 SD--VDEDDEESGFYLPYPEDSAGGGYGVDQRDEGTSDSWIKRHPDLVRLTGRHPFN 565
D ED++ + P VD+RD+GTSD WI RHP+LVRLTGRHPFN
Sbjct: 61 DDDSTSEDEKVMEYVKEIPITD------VDERDKGTSDDWIPRHPELVRLTGRHPFN 111


>tr|Q4LEW9|Q4LEW9_PHYPA Pyridine nucleotide-dependent nitrate
reductase (Nitrate reductase) OS=Physcomitrella patens
GN=Nia1;1 PE=2 SV=1
Length = 891

Score = 59.7 bits (143), Expect = 1e-07
Identities = 43/117 (36%), Positives = 57/117 (48%), Gaps = 14/117 (11%)
Frame = +2

Query: 257 MGFASVTPSLQSELL-------MKEKESSRRELSFPELAVNGKLQNHLKVTHENYSDVDE 415
MG + +P L +E+L +K K S P+L + + + D DE
Sbjct: 1 MGVSVASPVLSNEVLGHHDADLLKTKLVSNGGFQPPKLLQEEMAPSSI-IKSLTVVDTDE 59

Query: 416 DDEESGFYLPYPEDSAGGGY-------GVDQRDEGTSDSWIKRHPDLVRLTGRHPFN 565
D++S ED Y VD+RD+GTSD WI RHP+LVRLTGRHPFN
Sbjct: 60 FDDDST-----SEDEKVMEYVKEIPITDVDERDKGTSDDWIPRHPELVRLTGRHPFN 111


>tr|A9S9L0|A9S9L0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_209989 PE=4 SV=1
Length = 891

Score = 59.7 bits (143), Expect = 1e-07
Identities = 43/117 (36%), Positives = 57/117 (48%), Gaps = 14/117 (11%)
Frame = +2

Query: 257 MGFASVTPSLQSELL-------MKEKESSRRELSFPELAVNGKLQNHLKVTHENYSDVDE 415
MG + +P L +E+L +K K S P+L + + + D DE
Sbjct: 1 MGVSVASPVLSNEVLGHHDADLLKTKLVSNGGFQPPKLLQEEMAPSSI-IKSLTVVDTDE 59

Query: 416 DDEESGFYLPYPEDSAGGGY-------GVDQRDEGTSDSWIKRHPDLVRLTGRHPFN 565
D++S ED Y VD+RD+GTSD WI RHP+LVRLTGRHPFN
Sbjct: 60 FDDDST-----SEDEKVMEYVKEIPITDVDERDKGTSDDWIPRHPELVRLTGRHPFN 111


>tr|Q6ZHH7|Q6ZHH7_ORYSJ Os02g0770800 protein OS=Oryza sativa subsp.
japonica GN=OJ1353_F08.4 PE=2 SV=1
Length = 889

Score = 57.0 bits (136), Expect = 7e-07
Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 4/59 (6%)
Frame = +2

Query: 401 SDVDEDDEES----GFYLPYPEDSAGGGYGVDQRDEGTSDSWIKRHPDLVRLTGRHPFN 565
S+ D DDE+S L +P D RDE TSD+W++RHP LVRLTG+HPFN
Sbjct: 37 SETDSDDEDSIPPDWRSLYHPRLEVAEPAVKDPRDEATSDAWVRRHPALVRLTGKHPFN 95


>tr|B8AJ60|B8AJ60_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_09099 PE=4 SV=1
Length = 893

Score = 57.0 bits (136), Expect = 7e-07
Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 4/59 (6%)
Frame = +2

Query: 401 SDVDEDDEES----GFYLPYPEDSAGGGYGVDQRDEGTSDSWIKRHPDLVRLTGRHPFN 565
S+ D DDE+S L +P D RDE TSD+W++RHP LVRLTG+HPFN
Sbjct: 37 SETDSDDEDSIPPDWRSLYHPRLEVAEPAVKDPRDEATSDAWVRRHPALVRLTGKHPFN 95


>tr|A3ABS4|A3ABS4_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_008246 PE=4 SV=1
Length = 890

Score = 57.0 bits (136), Expect = 7e-07
Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 4/59 (6%)
Frame = +2

Query: 401 SDVDEDDEES----GFYLPYPEDSAGGGYGVDQRDEGTSDSWIKRHPDLVRLTGRHPFN 565
S+ D DDE+S L +P D RDE TSD+W++RHP LVRLTG+HPFN
Sbjct: 37 SETDSDDEDSIPPDWRSLYHPRLEVAEPAVKDPRDEATSDAWVRRHPALVRLTGKHPFN 95


>tr|Q9FUC2|Q9FUC2_RICCO Nitrate reductase OS=Ricinus communis GN=NIA
PE=2 SV=1
Length = 914

Score = 54.7 bits (130), Expect = 3e-06
Identities = 19/29 (65%), Positives = 27/29 (93%)
Frame = +2

Query: 479 VDQRDEGTSDSWIKRHPDLVRLTGRHPFN 565
+D RDEGT+D+W++RHP ++RLTG+HPFN
Sbjct: 88 LDPRDEGTADNWVERHPSMIRLTGKHPFN 116