DK955309
Clone id TST39A01NGRL0022_M03
Library
Length 601
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_M03. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID
Sequence
ATCATCCCTCTTTAAGCTCCCAAATCATTCTATTATACTTGTGCGTGCACAGGCTAGTGC
ACGAACACACACACACAAACTTATCCTTGTTGTATGCCCCTGTTGTGCAGTTTGTACACA
CATGTATGCTTAGCAACGCAAATATGTAAATTGTACATACAACTGTCGAAAAACCAAAAC
TTCACTTCTTGCAACACACAGAAAACCTTGCGGTCCTCGCTTTGAACATCATTTCTCATC
ATCCCAAGTCTTTCTTTCTGAGAAATCGAACACTAGTGCGTCACATATTTCACCAGCATG
TTTCGCAAAGATGTATTGCGTGCACACATCATTCCTTCTCCAGCTAAAGCAGCCTTGTTC
CTTCTTGTATTTGCATCTTCAATACACTGGTCTATTAGCATTTCTGATTCAGTTGAAGTG
CGCGCTCTTCGAGCAATAAAAGCTAGTATTGGGGATGTCTTTAACCGGCTCCGTAACTGG
GAAGGAGAGGATCCGTGCGGAGACAGTTGGACGGGCGTCTTATGCACGGATATTAATGGA
ACAAGCTATGTTACAGAACTGCGGTTGCTGAACATGAATTTTACTGGAACTTTGGCCCCA
G
■■Homology search results ■■ -
sp_hit_id Q6R2J8
Definition sp|Q6R2J8|SRF8_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 8 OS=Arabidopsis thaliana
Align length 62
Score (bit) 39.7
E-value 0.012
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955309|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_M03, 5'
(601 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6R2J8|SRF8_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 8 OS=Ara... 40 0.012
sp|Q9FG24|SRF2_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 2 OS=Ara... 39 0.016
sp|Q6R2K2|SRF4_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 4 OS=Ara... 39 0.020
sp|P43298|TMK1_ARATH Putative receptor protein kinase TMK1 OS=Ar... 38 0.035
sp|Q6R2K1|SRF5_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 5 OS=Ara... 38 0.045
sp|Q8LKZ1|NORK_PEA Nodulation receptor kinase OS=Pisum sativum G... 37 0.077
sp|Q8RWZ1|SUB_ARATH Protein STRUBBELIG OS=Arabidopsis thaliana G... 36 0.13
sp|Q9LUL4|SRF7_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 7 OS=Ara... 35 0.22
sp|Q9C8M9|SRF6_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 6 OS=Ara... 35 0.29
sp|Q06BH3|SRF1_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 1 OS=Ara... 35 0.29
sp|Q94C77|RPKL_ARATH Receptor protein kinase-like protein At4g34... 35 0.29
sp|Q8L4H4|NORK_MEDTR Nodulation receptor kinase OS=Medicago trun... 35 0.38
sp|Q5F3Z5|DNJB6_CHICK DnaJ homolog subfamily B member 6 OS=Gallu... 34 0.65
sp|Q8VIC7|VN1A2_MOUSE Vomeronasal type-1 receptor A2 OS=Mus musc... 32 1.9
sp|Q15058|KIF14_HUMAN Kinesin-like protein KIF14 OS=Homo sapiens... 32 2.5
sp|Q9LVM0|Y5830_ARATH Probable inactive receptor kinase At5g5830... 32 2.5
sp|Q9FHK7|Y5516_ARATH Probable receptor kinase At5g05160 OS=Arab... 32 2.5
sp|Q6R2K3|SRF3_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 3 OS=Ara... 32 3.2
sp|Q9US36|YFZ5_SCHPO Zinc finger protein C1039.05c OS=Schizosacc... 30 9.3
sp|O33817|HCRR_THAAR Putative transcriptional regulatory protein... 30 9.3
sp|Q9C9Y8|Y3868_ARATH Probable inactive receptor kinase At3g0868... 30 9.4
sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated re... 30 9.4

>sp|Q6R2J8|SRF8_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 8
OS=Arabidopsis thaliana GN=SRF8 PE=2 SV=1
Length = 703

Score = 39.7 bits (91), Expect = 0.012
Identities = 22/62 (35%), Positives = 39/62 (62%), Gaps = 2/62 (3%)
Frame = +1

Query: 415 EVRALRAIKASIGDVFNRLRNWE--GEDPCGDSWTGVLCTDINGTSYVTELRLLNMNFTG 588
+V+AL+ + S+ ++L NW+ G DPCG+SW G+ C G++ VT + + ++ +G
Sbjct: 33 DVQALQVLYTSLNSP-SQLTNWKNGGGDPCGESWKGITC---EGSAVVT-IDISDLGVSG 87

Query: 589 TL 594
TL
Sbjct: 88 TL 89


>sp|Q9FG24|SRF2_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 2
OS=Arabidopsis thaliana GN=SRF2 PE=2 SV=1
Length = 735

Score = 39.3 bits (90), Expect = 0.016
Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 2/63 (3%)
Frame = +1

Query: 412 VEVRALRAIKASIGDVFNRLRNW--EGEDPCGDSWTGVLCTDINGTSYVTELRLLNMNFT 585
+EV AL+ + S+ + +LR W EG DPCG++W G+ C+ S + +L+L +
Sbjct: 30 LEVLALQDLYKSLRNP-EQLRGWRLEGGDPCGEAWLGISCSG----SSIVDLQLRELKLL 84

Query: 586 GTL 594
G+L
Sbjct: 85 GSL 87


>sp|Q6R2K2|SRF4_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 4
OS=Arabidopsis thaliana GN=SRF4 PE=2 SV=1
Length = 687

Score = 38.9 bits (89), Expect = 0.020
Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 2/46 (4%)
Frame = +1

Query: 463 NRLRNWE--GEDPCGDSWTGVLCTDINGTSYVTELRLLNMNFTGTL 594
++L+ W G DPCGDSW G+ C S VTE+++ +G+L
Sbjct: 46 SKLKGWSSSGGDPCGDSWDGITCKG----SSVTEIKVSGRGLSGSL 87


>sp|P43298|TMK1_ARATH Putative receptor protein kinase TMK1
OS=Arabidopsis thaliana GN=TMK1 PE=1 SV=1
Length = 942

Score = 38.1 bits (87), Expect = 0.035
Identities = 20/61 (32%), Positives = 33/61 (54%)
Frame = +1

Query: 418 VRALRAIKASIGDVFNRLRNWEGEDPCGDSWTGVLCTDINGTSYVTELRLLNMNFTGTLA 597
V++L I +S +W+G DPC +W G+ C++ N +T + L M TGT++
Sbjct: 325 VKSLLLIASSFDYPPRLAESWKGNDPC-TNWIGIACSNGN----ITVISLEKMELTGTIS 379

Query: 598 P 600
P
Sbjct: 380 P 380


>sp|Q6R2K1|SRF5_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 5
OS=Arabidopsis thaliana GN=SRF5 PE=2 SV=1
Length = 699

Score = 37.7 bits (86), Expect = 0.045
Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 2/61 (3%)
Frame = +1

Query: 415 EVRALRAIKASIGDVFNRLRNWE--GEDPCGDSWTGVLCTDINGTSYVTELRLLNMNFTG 588
EV AL + S+ ++L+ W+ G DPC DSW GV C S VTEL+L G
Sbjct: 28 EVSALNVMFTSLNSP-SKLKGWKANGGDPCEDSWEGVKCKG----SSVTELQLSGFELGG 82

Query: 589 T 591
+
Sbjct: 83 S 83


>sp|Q8LKZ1|NORK_PEA Nodulation receptor kinase OS=Pisum sativum
GN=NORK PE=1 SV=1
Length = 924

Score = 37.0 bits (84), Expect = 0.077
Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 1/43 (2%)
Frame = +1

Query: 469 LRNWEGEDPCG-DSWTGVLCTDINGTSYVTELRLLNMNFTGTL 594
L +W G DPC W GV C NG+S +T+L L + N GT+
Sbjct: 380 LESWSG-DPCMLFPWKGVACDGSNGSSVITKLDLSSSNLKGTI 421


>sp|Q8RWZ1|SUB_ARATH Protein STRUBBELIG OS=Arabidopsis thaliana
GN=SUB PE=1 SV=1
Length = 768

Score = 36.2 bits (82), Expect = 0.13
Identities = 16/38 (42%), Positives = 22/38 (57%)
Frame = +1

Query: 484 GEDPCGDSWTGVLCTDINGTSYVTELRLLNMNFTGTLA 597
G DPCG+ W GV+C N +TE+R+ M G L+
Sbjct: 53 GGDPCGEKWQGVVCDSSN----ITEIRIPGMKVGGGLS 86


>sp|Q9LUL4|SRF7_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 7
OS=Arabidopsis thaliana GN=SRF7 PE=1 SV=1
Length = 717

Score = 35.4 bits (80), Expect = 0.22
Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 2/45 (4%)
Frame = +1

Query: 466 RLRNW--EGEDPCGDSWTGVLCTDINGTSYVTELRLLNMNFTGTL 594
+L W G DPCG +W G+ C+ S VT+++L ++ +G+L
Sbjct: 47 QLSQWTASGGDPCGQNWKGITCSG----SRVTQIKLPSLGLSGSL 87


>sp|Q9C8M9|SRF6_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 6
OS=Arabidopsis thaliana GN=SRF6 PE=1 SV=1
Length = 719

Score = 35.0 bits (79), Expect = 0.29
Identities = 15/35 (42%), Positives = 22/35 (62%)
Frame = +1

Query: 490 DPCGDSWTGVLCTDINGTSYVTELRLLNMNFTGTL 594
DPCG +W GV C+ S VT+++L + +GTL
Sbjct: 57 DPCGQNWRGVTCSG----SRVTQIKLSGLELSGTL 87


>sp|Q06BH3|SRF1_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 1
OS=Arabidopsis thaliana GN=SRF1 PE=2 SV=2
Length = 775

Score = 35.0 bits (79), Expect = 0.29
Identities = 17/37 (45%), Positives = 21/37 (56%)
Frame = +1

Query: 484 GEDPCGDSWTGVLCTDINGTSYVTELRLLNMNFTGTL 594
G DPCG+SW GVLC S V + L++ N G L
Sbjct: 60 GGDPCGESWQGVLC----NASQVETIILISANLGGEL 92


tr_hit_id Q0JI81
Definition tr|Q0JI81|Q0JI81_ORYSJ Os01g0818700 protein (Fragment) OS=Oryza sativa subsp. japonica
Align length 64
Score (bit) 70.9
E-value 6.0e-11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955309|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_M03, 5'
(601 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q0JI81|Q0JI81_ORYSJ Os01g0818700 protein (Fragment) OS=Oryza ... 71 6e-11
tr|A2ZZ08|A2ZZ08_ORYSJ Putative uncharacterized protein OS=Oryza... 71 6e-11
tr|Q9M9Z0|Q9M9Z0_ARATH F4H5.8 protein OS=Arabidopsis thaliana GN... 67 6e-10
tr|A5B1C2|A5B1C2_VITVI Putative uncharacterized protein OS=Vitis... 67 8e-10
tr|Q5KQI5|Q5KQI5_ORYSJ Unkown protein OS=Oryza sativa subsp. jap... 66 2e-09
tr|Q0DHA0|Q0DHA0_ORYSJ Os05g0481100 protein OS=Oryza sativa subs... 66 2e-09
tr|B8AZB0|B8AZB0_ORYSI Putative uncharacterized protein OS=Oryza... 66 2e-09
tr|B7F5L0|B7F5L0_ORYSJ cDNA clone:J013034D11, full insert sequen... 66 2e-09
tr|A3B561|A3B561_ORYSJ Putative uncharacterized protein OS=Oryza... 66 2e-09
tr|A9TZ00|A9TZ00_PHYPA Predicted protein (Fragment) OS=Physcomit... 61 6e-08
tr|A9T4C7|A9T4C7_PHYPA Predicted protein OS=Physcomitrella paten... 60 1e-07
tr|A9SWG5|A9SWG5_PHYPA Predicted protein (Fragment) OS=Physcomit... 59 2e-07
tr|B8ABB0|B8ABB0_ORYSI Putative uncharacterized protein OS=Oryza... 58 5e-07
tr|Q9LZV1|Q9LZV1_ARATH Putative uncharacterized protein T20L15_2... 54 7e-06
tr|Q5JN27|Q5JN27_ORYSJ cDNA clone:J013001N14, full insert sequen... 54 9e-06
tr|B8A9K1|B8A9K1_ORYSI Putative uncharacterized protein OS=Oryza... 54 9e-06
tr|A3A1R4|A3A1R4_ORYSJ Putative uncharacterized protein OS=Oryza... 54 9e-06
tr|A7NXZ3|A7NXZ3_VITVI Chromosome chr6 scaffold_3, whole genome ... 52 2e-05
tr|A7Q9W6|A7Q9W6_VITVI Chromosome chr8 scaffold_68, whole genome... 50 1e-04
tr|Q53N99|Q53N99_ORYSJ Os11g0245200 protein OS=Oryza sativa subs... 49 3e-04
tr|B8BJW1|B8BJW1_ORYSI Putative uncharacterized protein OS=Oryza... 49 3e-04
tr|A3CA56|A3CA56_ORYSJ Putative uncharacterized protein OS=Oryza... 49 3e-04
tr|Q9FG43|Q9FG43_ARATH Receptor protein kinase-like protein OS=A... 48 5e-04
tr|Q2QW32|Q2QW32_ORYSJ Os12g0210400 protein OS=Oryza sativa subs... 47 9e-04
tr|Q9LVP0|Q9LVP0_ARATH Receptor-like protein kinase OS=Arabidops... 46 0.001
tr|Q9FLK9|Q9FLK9_ARATH Leucine-rich repeat disease resistance pr... 46 0.001
tr|B1A5Z1|B1A5Z1_BRARP LRR-like disease resistance protein OS=Br... 46 0.002
tr|A9TE22|A9TE22_PHYPA CLL6 clavata1-like receptor S/T protein k... 45 0.002
tr|A7P2H1|A7P2H1_VITVI Chromosome chr1 scaffold_5, whole genome ... 45 0.002
tr|Q93ZS4|Q93ZS4_ARATH Putative receptor kinase OS=Arabidopsis t... 45 0.003

>tr|Q0JI81|Q0JI81_ORYSJ Os01g0818700 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os01g0818700 PE=4 SV=1
Length = 431

Score = 70.9 bits (172), Expect = 6e-11
Identities = 35/64 (54%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
Frame = +1

Query: 415 EVRALRAIKASIGDVFNRLRNWEGEDPCGDSWTGVLCTD--INGTSYVTELRLLNMNFTG 588
EV ALRAIK + D N L+NW DPC SW GV C + IN +VTEL+L MN +G
Sbjct: 113 EVNALRAIKGRLIDPMNNLKNWNSGDPCTSSWKGVFCDNIPINNYLHVTELQLFKMNLSG 172

Query: 589 TLAP 600
TLAP
Sbjct: 173 TLAP 176


>tr|A2ZZ08|A2ZZ08_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_003780 PE=4 SV=1
Length = 909

Score = 70.9 bits (172), Expect = 6e-11
Identities = 35/64 (54%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
Frame = +1

Query: 415 EVRALRAIKASIGDVFNRLRNWEGEDPCGDSWTGVLCTD--INGTSYVTELRLLNMNFTG 588
EV ALRAIK + D N L+NW DPC SW GV C + IN +VTEL+L MN +G
Sbjct: 33 EVNALRAIKGRLIDPMNNLKNWNSGDPCTSSWKGVFCDNIPINNYLHVTELQLFKMNLSG 92

Query: 589 TLAP 600
TLAP
Sbjct: 93 TLAP 96


>tr|Q9M9Z0|Q9M9Z0_ARATH F4H5.8 protein OS=Arabidopsis thaliana
GN=F4H5.8 PE=4 SV=1
Length = 860

Score = 67.4 bits (163), Expect = 6e-10
Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 3/64 (4%)
Frame = +1

Query: 418 VRALRAIKASIGDVFNRLRNWEGEDPCGDSWTGVLC---TDINGTSYVTELRLLNMNFTG 588
+RALR IK S+ D +RLRNW+ DPC +WTGV+C T +G +V+EL+L +MN +G
Sbjct: 39 LRALRVIKESLNDPVHRLRNWKHGDPCNSNWTGVVCFNSTLDDGYLHVSELQLFSMNLSG 98

Query: 589 TLAP 600
L+P
Sbjct: 99 NLSP 102


>tr|A5B1C2|A5B1C2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_025635 PE=4 SV=1
Length = 775

Score = 67.0 bits (162), Expect = 8e-10
Identities = 32/64 (50%), Positives = 42/64 (65%), Gaps = 2/64 (3%)
Frame = +1

Query: 415 EVRALRAIKASIGDVFNRLRNWEGEDPCGDSWTGVLCT--DINGTSYVTELRLLNMNFTG 588
EV ALRAI+ + D RL NW+ +DPC +WTGV+C+ +G +V ELRLLN + G
Sbjct: 30 EVTALRAIRRKLSDPKKRLNNWKSKDPCASNWTGVICSMNPDDGYLHVQELRLLNFSLNG 89

Query: 589 TLAP 600
LAP
Sbjct: 90 KLAP 93


>tr|Q5KQI5|Q5KQI5_ORYSJ Unkown protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0095J22.5 PE=4 SV=1
Length = 952

Score = 65.9 bits (159), Expect = 2e-09
Identities = 32/63 (50%), Positives = 39/63 (61%), Gaps = 1/63 (1%)
Frame = +1

Query: 415 EVRALRAIKASIGDVFNRLRNWEGEDPCGDSWTGVLCTDINGT-SYVTELRLLNMNFTGT 591
EV AL AIK S+ D N L+NW DPC +WTGV C D+ T +VTEL+L N +G
Sbjct: 32 EVSALMAIKGSLVDPMNNLKNWNRGDPCTKNWTGVFCHDLGDTYLHVTELQLFRRNLSGN 91

Query: 592 LAP 600
L P
Sbjct: 92 LVP 94


>tr|Q0DHA0|Q0DHA0_ORYSJ Os05g0481100 protein OS=Oryza sativa subsp.
japonica GN=Os05g0481100 PE=4 SV=1
Length = 571

Score = 65.9 bits (159), Expect = 2e-09
Identities = 32/63 (50%), Positives = 39/63 (61%), Gaps = 1/63 (1%)
Frame = +1

Query: 415 EVRALRAIKASIGDVFNRLRNWEGEDPCGDSWTGVLCTDINGT-SYVTELRLLNMNFTGT 591
EV AL AIK S+ D N L+NW DPC +WTGV C D+ T +VTEL+L N +G
Sbjct: 32 EVSALMAIKGSLVDPMNNLKNWNRGDPCTKNWTGVFCHDLGDTYLHVTELQLFRRNLSGN 91

Query: 592 LAP 600
L P
Sbjct: 92 LVP 94


>tr|B8AZB0|B8AZB0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_20362 PE=4 SV=1
Length = 952

Score = 65.9 bits (159), Expect = 2e-09
Identities = 32/63 (50%), Positives = 39/63 (61%), Gaps = 1/63 (1%)
Frame = +1

Query: 415 EVRALRAIKASIGDVFNRLRNWEGEDPCGDSWTGVLCTDINGT-SYVTELRLLNMNFTGT 591
EV AL AIK S+ D N L+NW DPC +WTGV C D+ T +VTEL+L N +G
Sbjct: 32 EVSALMAIKGSLVDPMNNLKNWNRGDPCTKNWTGVFCHDLGDTYLHVTELQLFRRNLSGN 91

Query: 592 LAP 600
L P
Sbjct: 92 LVP 94


>tr|B7F5L0|B7F5L0_ORYSJ cDNA clone:J013034D11, full insert sequence
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 593

Score = 65.9 bits (159), Expect = 2e-09
Identities = 32/63 (50%), Positives = 39/63 (61%), Gaps = 1/63 (1%)
Frame = +1

Query: 415 EVRALRAIKASIGDVFNRLRNWEGEDPCGDSWTGVLCTDINGT-SYVTELRLLNMNFTGT 591
EV AL AIK S+ D N L+NW DPC +WTGV C D+ T +VTEL+L N +G
Sbjct: 32 EVSALMAIKGSLVDPMNNLKNWNRGDPCTKNWTGVFCHDLGDTYLHVTELQLFRRNLSGN 91

Query: 592 LAP 600
L P
Sbjct: 92 LVP 94


>tr|A3B561|A3B561_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_018183 PE=4 SV=1
Length = 1009

Score = 65.9 bits (159), Expect = 2e-09
Identities = 32/63 (50%), Positives = 39/63 (61%), Gaps = 1/63 (1%)
Frame = +1

Query: 415 EVRALRAIKASIGDVFNRLRNWEGEDPCGDSWTGVLCTDINGT-SYVTELRLLNMNFTGT 591
EV AL AIK S+ D N L+NW DPC +WTGV C D+ T +VTEL+L N +G
Sbjct: 32 EVSALMAIKGSLVDPMNNLKNWNRGDPCTKNWTGVFCHDLGDTYLHVTELQLFRRNLSGN 91

Query: 592 LAP 600
L P
Sbjct: 92 LVP 94


>tr|A9TZ00|A9TZ00_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_152848 PE=4 SV=1
Length = 930

Score = 60.8 bits (146), Expect = 6e-08
Identities = 30/63 (47%), Positives = 38/63 (60%), Gaps = 4/63 (6%)
Frame = +1

Query: 424 ALRAIKASIGDVFNRLRNWEGEDPCG-DSWTGVLCTD---INGTSYVTELRLLNMNFTGT 591
AL A K SIGD +L NWEG DPCG +W G+ C I S+VTE+ L + TGT
Sbjct: 1 ALLAFKKSIGDTEGKLSNWEGNDPCGPPAWEGITCAQNVTIANISHVTEIHLFSCGLTGT 60

Query: 592 LAP 600
++P
Sbjct: 61 ISP 63