DK955314
Clone id TST39A01NGRL0022_M08
Library
Length 591
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_M08. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
GGCATCTATACTGAGATGGCGGTGTGTACTGGTCACCCTAAAATTGGGGCTGGTGAACTA
GAAAGGAAACAGAATTTTGGCCTGAAATGGCGACGCAAGCAGGGGACCTCAACGTCGATC
ATGCTTGCAGAAACTGACTTTCAAACACTCAACCATGGATCCCTCCATGACCAGAACCAG
AAAGAATGCGCAACAGCTAGCTCAAGCAGAGGCCCTGCTCCCCTCCTCCACTTTCCCCCT
TCAAGAAGGAGACCCAGAAGCCGCCCCCACAGAGATCAAGAGCAAAGAAGATCTTCATTC
CCTGTCTTGTCATCTCCTTCATCATCATCACCATCACCTTCTTCACCATCTCCATCATCA
GCAGTCGCTGCATTTGCGCTCCTTTGGTAAACCCTCAGTTCGCCTCTGTTTGCTCCTCGT
TTTCGTGGTTCTGGGCACCTTCTTCTTCTTGCCGTCACTGCTGTCCTCTTCAACGTTGCA
GCTCAAATCTCTCCATGACTCCACATCTTACGCACAGCATCAATTTGGAGATGCCGAAAA
ATGATGACTTCACCTTGGGAGGTCTGCTAGCCAAAGAATCAGCTACGACGC
■■Homology search results ■■ -
sp_hit_id Q55CW2
Definition sp|Q55CW2|SAMKC_DICDI Probable serine/threonine-protein kinase samkC OS=Dictyostelium discoideum
Align length 58
Score (bit) 33.1
E-value 1.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955314|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_M08, 5'
(591 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q55CW2|SAMKC_DICDI Probable serine/threonine-protein kinase s... 33 1.1
sp|Q52KI8|SRRM1_MOUSE Serine/arginine repetitive matrix protein ... 32 1.8
sp|Q5TKR9|MYST3_RAT Histone acetyltransferase MYST3 OS=Rattus no... 32 2.4
sp|P0C5K4|FH21A_ARATH Putative formin-like protein 21a OS=Arabid... 32 2.4
sp|Q03211|PEXLP_TOBAC Pistil-specific extensin-like protein OS=N... 32 3.1
sp|Q83949|Y066_NPVOP Uncharacterized 98.6 kDa protein OS=Orgyia ... 31 4.0
sp|Q9NVE4|CCD87_HUMAN Coiled-coil domain-containing protein 87 O... 31 4.0
sp|Q6LA55|YF49_SCHPO UPF0648 protein C3H5.09c OS=Schizosaccharom... 31 4.1
sp|P35323|SPRR1_PIG Cornifin OS=Sus scrofa GN=SPRP PE=2 SV=1 31 5.3
sp|P35321|SPR1A_HUMAN Cornifin-A OS=Homo sapiens GN=SPRR1A PE=1 ... 30 6.9
sp|Q6J8G2|POLN_HEVMG Non-structural polyprotein pORF1 OS=Hepatit... 30 9.0
sp|O60885|BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sa... 30 9.0

>sp|Q55CW2|SAMKC_DICDI Probable serine/threonine-protein kinase
samkC OS=Dictyostelium discoideum GN=samkC PE=3 SV=2
Length = 875

Score = 33.1 bits (74), Expect = 1.1
Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 6/58 (10%)
Frame = +3

Query: 138 LSNTQPWIPP*PEPERMRNS*LKQRPCS------PPPLSPFKKETQKPPPQRSRAKKI 293
LS+ P + P P+P+ ++ K +P S PPPL P ++ KP P +S+ + I
Sbjct: 552 LSSEPPPLEPQPKPQTSQS---KPKPSSSLSSSEPPPLEPQPTQSSKPQPSQSKPQPI 606


>sp|Q52KI8|SRRM1_MOUSE Serine/arginine repetitive matrix protein 1
OS=Mus musculus GN=Srrm1 PE=1 SV=1
Length = 946

Score = 32.3 bits (72), Expect = 1.8
Identities = 15/37 (40%), Positives = 19/37 (51%)
Frame = +3

Query: 165 P*PEPERMRNS*LKQRPCSPPPLSPFKKETQKPPPQR 275
P P P R R S P PPP P ++ + PPP+R
Sbjct: 562 PSPPPARRRRSPSPAPPPPPPPPPPRRRRSPTPPPRR 598


>sp|Q5TKR9|MYST3_RAT Histone acetyltransferase MYST3 OS=Rattus
norvegicus GN=Myst3 PE=2 SV=2
Length = 1998

Score = 32.0 bits (71), Expect = 2.4
Identities = 16/45 (35%), Positives = 22/45 (48%)
Frame = +3

Query: 141 SNTQPWIPP*PEPERMRNS*LKQRPCSPPPLSPFKKETQKPPPQR 275
SN QP PP P P + Q+ +P P P ++ PPPQ+
Sbjct: 1638 SNQQPPPPPPPPPPPQQPQPQPQQQAAPQPPPPQPQQQPPPPPQQ 1682


>sp|P0C5K4|FH21A_ARATH Putative formin-like protein 21a
OS=Arabidopsis thaliana GN=FH21A PE=3 SV=1
Length = 438

Score = 32.0 bits (71), Expect = 2.4
Identities = 15/47 (31%), Positives = 22/47 (46%)
Frame = +3

Query: 162 PP*PEPERMRNS*LKQRPCSPPPLSPFKKETQKPPPQRSRAKKIFIP 302
PP P P MR ++ P PPP P ++ PPP ++ +P
Sbjct: 26 PPPPPPPPMR----RRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLP 68


>sp|Q03211|PEXLP_TOBAC Pistil-specific extensin-like protein
OS=Nicotiana tabacum PE=2 SV=1
Length = 426

Score = 31.6 bits (70), Expect = 3.1
Identities = 22/53 (41%), Positives = 26/53 (49%), Gaps = 6/53 (11%)
Frame = +3

Query: 150 QPWIPP*PEPERMRN-S*LKQRPCSPPPL-----SPFKKETQKPPPQRSRAKK 290
QP PP P P + + S KQ P PPP+ SP + K PP RAKK
Sbjct: 176 QPSPPPPPPPVKAPSPSPAKQPPPPPPPVKAPSPSPATQPPTKQPPPPPRAKK 228


>sp|Q83949|Y066_NPVOP Uncharacterized 98.6 kDa protein OS=Orgyia
pseudotsugata multicapsid polyhedrosis virus GN=ORF71
PE=4 SV=2
Length = 875

Score = 31.2 bits (69), Expect = 4.0
Identities = 16/68 (23%), Positives = 32/68 (47%)
Frame = +3

Query: 72 EFWPEMATQAGDLNVDHACRN*LSNTQPWIPP*PEPERMRNS*LKQRPCSPPPLSPFKKE 251
+F+ ++ + N+++ + P+ PP P+P Q+P PPP P + +
Sbjct: 56 QFFSDLTGRNTTHNINYRYDYNVGGALPFQPPPPQPFYPYGQYWPQQPPQPPPDQPQQPQ 115

Query: 252 TQKPPPQR 275
+ PPQ+
Sbjct: 116 PPQQPPQQ 123


>sp|Q9NVE4|CCD87_HUMAN Coiled-coil domain-containing protein 87
OS=Homo sapiens GN=CCDC87 PE=2 SV=1
Length = 849

Score = 31.2 bits (69), Expect = 4.0
Identities = 19/45 (42%), Positives = 20/45 (44%)
Frame = +3

Query: 162 PP*PEPERMRNS*LKQRPCSPPPLSPFKKETQKPPPQRSRAKKIF 296
PP PEPE R RP S P E QK PPQ R + F
Sbjct: 4 PPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSF 48


>sp|Q6LA55|YF49_SCHPO UPF0648 protein C3H5.09c OS=Schizosaccharomyces
pombe GN=SPAC3H5.09c PE=2 SV=1
Length = 2685

Score = 31.2 bits (69), Expect = 4.1
Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 19/81 (23%)
Frame = +1

Query: 34 HPKIGAGELERKQNFGLKWRRKQGTSTSIMLAETDFQTL---------NHGSLH------ 168
H + E++ K N G K ++ TS + LAE DF+T+ + G+L
Sbjct: 1587 HQRSEKHEVKNKANLGRK--HQEATSMKVHLAEIDFKTIDLRAISASFDEGALDNSDSIP 1644

Query: 169 ----DQNQKECATASSSRGPA 219
D+ +KEC + + GPA
Sbjct: 1645 ANVLDEEEKECFSFKNVDGPA 1665


>sp|P35323|SPRR1_PIG Cornifin OS=Sus scrofa GN=SPRP PE=2 SV=1
Length = 97

Score = 30.8 bits (68), Expect = 5.3
Identities = 14/38 (36%), Positives = 23/38 (60%)
Frame = +3

Query: 150 QPWIPP*PEPERMRNS*LKQRPCSPPPLSPFKKETQKP 263
QP PP P+P++ + ++PC PPP P +T++P
Sbjct: 8 QPCTPP-PQPQQQQ----VKQPCQPPPQEPCVPKTKEP 40


>sp|P35321|SPR1A_HUMAN Cornifin-A OS=Homo sapiens GN=SPRR1A PE=1
SV=2
Length = 89

Score = 30.4 bits (67), Expect = 6.9
Identities = 14/38 (36%), Positives = 23/38 (60%)
Frame = +3

Query: 150 QPWIPP*PEPERMRNS*LKQRPCSPPPLSPFKKETQKP 263
QP PP P+P++ + ++PC PPP P +T++P
Sbjct: 8 QPCTPP-PQPQQQQ----VKQPCQPPPQEPCIPKTKEP 40


tr_hit_id Q803F7
Definition tr|Q803F7|Q803F7_DANRE RNA binding motif protein 4.2 (Rbm4.2 protein) OS=Danio rerio
Align length 46
Score (bit) 35.0
E-value 3.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955314|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_M08, 5'
(591 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q803F7|Q803F7_DANRE RNA binding motif protein 4.2 (Rbm4.2 pro... 35 3.2
tr|Q6FIZ5|Q6FIZ5_CANGA Similarity OS=Candida glabrata GN=CAGL0M1... 35 4.1
tr|Q6NX91|Q6NX91_DANRE Rbm4.2 protein OS=Danio rerio GN=rbm4.2 P... 34 5.4
tr|B6SKU6|B6SKU6_MAIZE Membrane protein OS=Zea mays PE=2 SV=1 34 5.4
tr|B4FZM6|B4FZM6_MAIZE Putative uncharacterized protein OS=Zea m... 33 9.2
tr|A8N5N8|A8N5N8_COPC7 Predicted protein OS=Coprinopsis cinerea ... 33 9.2

>tr|Q803F7|Q803F7_DANRE RNA binding motif protein 4.2 (Rbm4.2
protein) OS=Danio rerio GN=rbm4.2 PE=1 SV=1
Length = 385

Score = 35.0 bits (79), Expect = 3.2
Identities = 16/46 (34%), Positives = 24/46 (52%)
Frame = +3

Query: 159 IPP*PEPERMRNS*LKQRPCSPPPLSPFKKETQKPPPQRSRAKKIF 296
IPP P P + +S L + +PP L P+++ PPP + A F
Sbjct: 289 IPPPPPPPPLSSSSLSRMRLAPPSLDPYERRPLAPPPPTAAAAASF 334


>tr|Q6FIZ5|Q6FIZ5_CANGA Similarity OS=Candida glabrata GN=CAGL0M10395g
PE=4 SV=1
Length = 1665

Score = 34.7 bits (78), Expect = 4.1
Identities = 18/43 (41%), Positives = 21/43 (48%)
Frame = +3

Query: 162 PP*PEPERMRNS*LKQRPCSPPPLSPFKKETQKPPPQRSRAKK 290
PP P P LK++P PPP KK+ PPPQ KK
Sbjct: 1114 PPPPPPHGQ----LKKKPPPPPPQGQLKKKPPPPPPQGQLKKK 1152


>tr|Q6NX91|Q6NX91_DANRE Rbm4.2 protein OS=Danio rerio GN=rbm4.2 PE=2
SV=1
Length = 384

Score = 34.3 bits (77), Expect = 5.4
Identities = 15/42 (35%), Positives = 23/42 (54%)
Frame = +3

Query: 159 IPP*PEPERMRNS*LKQRPCSPPPLSPFKKETQKPPPQRSRA 284
IPP P P + +S L + +PP L P+++ PPP + A
Sbjct: 289 IPPPPPPPPLSSSSLSRMRLAPPSLDPYERRPLAPPPPTAAA 330


>tr|B6SKU6|B6SKU6_MAIZE Membrane protein OS=Zea mays PE=2 SV=1
Length = 289

Score = 34.3 bits (77), Expect = 5.4
Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
Frame = +3

Query: 150 QPWIPP*PEPERMRNS*LKQRPCSPPPLSPF--KKETQKPPPQRSRAKKIFIPCL 308
+P +PP P P + K+ P PPPL P KK+ PPP K+++ P L
Sbjct: 147 RPALPPRPPPPPQQRE--KKLPPPPPPLLPLPPKKQQYPPPPLLPPKKQLYPPPL 199


>tr|B4FZM6|B4FZM6_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 291

Score = 33.5 bits (75), Expect = 9.2
Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 2/55 (3%)
Frame = +3

Query: 150 QPWIPP*PEPERMRNS*LKQRPCSPPPLSPF--KKETQKPPPQRSRAKKIFIPCL 308
+P +PP P P + P PPPL P KK+ PPP K+++ P L
Sbjct: 147 RPALPPRPPPPPQQREKKLPLPPPPPPLLPLPPKKQQYPPPPLLPPKKQLYPPPL 201


>tr|A8N5N8|A8N5N8_COPC7 Predicted protein OS=Coprinopsis cinerea
(strain Okayama-7 / 130 / FGSC 9003) GN=CC1G_09343 PE=4
SV=1
Length = 498

Score = 33.5 bits (75), Expect = 9.2
Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 5/47 (10%)
Frame = +3

Query: 156 WIPP*PEPERMRNS*LKQRPCSP---PPLSPFKKETQK--PPPQRSR 281
+IPP P E N+ P SP PP+SP +++ Q PPP+RSR
Sbjct: 291 YIPPPPGSESNDNADNATTPTSPHAYPPISPSQQQQQPQTPPPKRSR 337