DK955344
Clone id TST39A01NGRL0022_N15
Library
Length 581
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_N15. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID
Sequence
AATAAGGGTTGCAGGGGCGTTTCTGCATCTTACCCAGCATCGCCTCTCATCACAGAGTCT
TCTCCTCCTCTCTGCGTTTTTTGTTTTTGCGTGAAGCTCTTCTGTTTATACTCCGAAAAT
AACCACCGTTTGCTTAACGTAGTCATTTGAGCAGAACATCAGATCTAGCCCAAGCGCCTT
TATCAGCTTCTCATCGGCGGAGGAACTGCACTGCAAACTACCAGACAAATCCCAAGCGAA
ACCCTATTGGGACTGTTTTTAACCCTTCTGAACGAGGAATACATCAGAGCAGCAGCTCTT
CTTTCATCATGGCTCTGAGTAATGTGCTCATCATCGTCCTCAATACCTTGACCTTCATCC
TCTCCATACCCATCATTGCCATTGGGGCAAAACATGACAGTAACGATTGCTATCGGTTTC
TCCAAAAGCCTGTGATCGCCCTCGGAGTGTTTATCATGTTAATGTCCATCATGGGCATTG
TAGGGGCTGCTTGCAAGAATAGATGTTTGCTATGGATCTATCTGGTGGTCATGTTTTTGC
TCATTATTCTACTCTTCATCTTCACCATCTTCGCATTCGTG
■■Homology search results ■■ -
sp_hit_id Q3SYV5
Definition sp|Q3SYV5|TSN33_BOVIN Tetraspanin-33 OS=Bos taurus
Align length 79
Score (bit) 36.6
E-value 0.093
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955344|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_N15, 5'
(581 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q3SYV5|TSN33_BOVIN Tetraspanin-33 OS=Bos taurus GN=TSPAN33 PE... 37 0.093
sp|Q8R3S2|TSN33_MOUSE Tetraspanin-33 OS=Mus musculus GN=Tspan33 ... 35 0.21
sp|Q86UF1|TSN33_HUMAN Tetraspanin-33 OS=Homo sapiens GN=TSPAN33 ... 35 0.21
sp|Q9CQ88|TSN31_MOUSE Tetraspanin-31 OS=Mus musculus GN=Tspan31 ... 33 1.3
sp|Q7ZWW7|TS31B_XENLA Tetraspanin-31-B OS=Xenopus laevis GN=tspa... 32 1.8
sp|Q5XHG6|TS31A_XENLA Tetraspanin-31-A OS=Xenopus laevis GN=tspa... 32 1.8
sp|Q48838|SDHA_LACSK Probable L-serine dehydratase, alpha chain ... 32 1.8
sp|Q5RAP8|TSN31_PONAB Tetraspanin-31 OS=Pongo abelii GN=TSPAN31 ... 32 2.3
sp|Q12999|TSN31_HUMAN Tetraspanin-31 OS=Homo sapiens GN=TSPAN31 ... 32 2.3
sp|O95857|TSN13_HUMAN Tetraspanin-13 OS=Homo sapiens GN=TSPAN13 ... 32 3.0
sp|Q3ZBV0|TSN13_BOVIN Tetraspanin-13 OS=Bos taurus GN=TSPAN13 PE... 32 3.0
sp|P27701|CD82_HUMAN CD82 antigen OS=Homo sapiens GN=CD82 PE=1 SV=1 32 3.0
sp|Q5U1V9|TSN31_RAT Tetraspanin-31 OS=Rattus norvegicus GN=Tspan... 31 3.9
sp|Q29257|TSN31_PIG Tetraspanin-31 (Fragment) OS=Sus scrofa GN=T... 31 3.9
sp|Q32KP1|TSN31_BOVIN Tetraspanin-31 OS=Bos taurus GN=TSPAN31 PE... 31 3.9
sp|Q5FVL6|TSN13_RAT Tetraspanin-13 OS=Rattus norvegicus GN=Tspan... 31 3.9
sp|Q9D8C2|TSN13_MOUSE Tetraspanin-13 OS=Mus musculus GN=Tspan13 ... 31 3.9
sp|Q9H1Z9|TSN10_HUMAN Tetraspanin-10 OS=Homo sapiens GN=TSPAN10 ... 31 3.9
sp|Q8BJU2|TSN9_MOUSE Tetraspanin-9 OS=Mus musculus GN=Tspan9 PE=... 31 5.1
sp|O75954|TSN9_HUMAN Tetraspanin-9 OS=Homo sapiens GN=TSPAN9 PE=... 31 5.1
sp|O70352|CD82_RAT CD82 antigen OS=Rattus norvegicus GN=Cd82 PE=... 31 5.1
sp|P08962|CD63_HUMAN CD63 antigen OS=Homo sapiens GN=CD63 PE=1 SV=2 31 5.1
sp|P36632|RAD26_SCHPO DNA repair protein rad26 OS=Schizosaccharo... 30 6.7
sp|A8AN88|UBIA_CITK8 4-hydroxybenzoate octaprenyltransferase OS=... 30 8.7
sp|Q21751|EAA6_CAEEL Putative sodium-dependent excitatory amino ... 30 8.7

>sp|Q3SYV5|TSN33_BOVIN Tetraspanin-33 OS=Bos taurus GN=TSPAN33 PE=2
SV=1
Length = 283

Score = 36.6 bits (83), Expect = 0.093
Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 8/79 (10%)
Frame = +3

Query: 300 SFIMALSNVLIIVLNTLTFILSIPIIAIGA-----KHDSNDCYRFLQKPVIAL---GVFI 455
SF+ L L+ N L +++S+ ++A+G KH+ P I L G+ +
Sbjct: 16 SFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHEEAALACLAVDPAILLIVVGILM 75

Query: 456 MLMSIMGIVGAACKNRCLL 512
L++ G +G+ +N CLL
Sbjct: 76 FLLTFCGCIGSLRENICLL 94


>sp|Q8R3S2|TSN33_MOUSE Tetraspanin-33 OS=Mus musculus GN=Tspan33
PE=1 SV=1
Length = 283

Score = 35.4 bits (80), Expect = 0.21
Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 8/79 (10%)
Frame = +3

Query: 300 SFIMALSNVLIIVLNTLTFILSIPIIAIGA-----KHDSNDCYRFLQKPVIAL---GVFI 455
SF+ L L+ N L +++S+ ++A+G KH P I L GV +
Sbjct: 16 SFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACLAVDPAILLIVVGVLM 75

Query: 456 MLMSIMGIVGAACKNRCLL 512
L++ G +G+ +N CLL
Sbjct: 76 FLLTFCGCIGSLRENICLL 94


>sp|Q86UF1|TSN33_HUMAN Tetraspanin-33 OS=Homo sapiens GN=TSPAN33
PE=2 SV=1
Length = 283

Score = 35.4 bits (80), Expect = 0.21
Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 8/79 (10%)
Frame = +3

Query: 300 SFIMALSNVLIIVLNTLTFILSIPIIAIGA-----KHDSNDCYRFLQKPVIAL---GVFI 455
SF+ L L+ N L +++S+ ++A+G KH P I L GV +
Sbjct: 16 SFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACLAVDPAILLIVVGVLM 75

Query: 456 MLMSIMGIVGAACKNRCLL 512
L++ G +G+ +N CLL
Sbjct: 76 FLLTFCGCIGSLRENICLL 94


>sp|Q9CQ88|TSN31_MOUSE Tetraspanin-31 OS=Mus musculus GN=Tspan31
PE=2 SV=1
Length = 210

Score = 32.7 bits (73), Expect = 1.3
Identities = 14/28 (50%), Positives = 24/28 (85%)
Frame = +3

Query: 432 VIALGVFIMLMSIMGIVGAACKNRCLLW 515
VIA+GVF++L+++ G+VGAA ++ LL+
Sbjct: 49 VIAVGVFLLLIAVAGLVGAANHHQVLLF 76


>sp|Q7ZWW7|TS31B_XENLA Tetraspanin-31-B OS=Xenopus laevis
GN=tspan31-B PE=2 SV=1
Length = 212

Score = 32.3 bits (72), Expect = 1.8
Identities = 12/28 (42%), Positives = 24/28 (85%)
Frame = +3

Query: 432 VIALGVFIMLMSIMGIVGAACKNRCLLW 515
VIA+GVF++L++I+G++GA ++ +L+
Sbjct: 49 VIAIGVFLLLIAIIGLIGAVSHHQVMLF 76


>sp|Q5XHG6|TS31A_XENLA Tetraspanin-31-A OS=Xenopus laevis
GN=tspan31-A PE=2 SV=1
Length = 212

Score = 32.3 bits (72), Expect = 1.8
Identities = 12/28 (42%), Positives = 24/28 (85%)
Frame = +3

Query: 432 VIALGVFIMLMSIMGIVGAACKNRCLLW 515
VIA+GVF++L++I+G++GA ++ +L+
Sbjct: 49 VIAIGVFLLLIAIIGLIGAVSHHQVMLF 76


>sp|Q48838|SDHA_LACSK Probable L-serine dehydratase, alpha chain
(Fragment) OS=Lactobacillus sakei GN=sdhA PE=3 SV=1
Length = 209

Score = 32.3 bits (72), Expect = 1.8
Identities = 13/34 (38%), Positives = 23/34 (67%)
Frame = +3

Query: 276 GIHQSSSSSFIMALSNVLIIVLNTLTFILSIPII 377
G HQ SS +F MA+SN+L +V + + ++ +P +
Sbjct: 101 GTHQQSSEAFAMAMSNLLGLVCDPVAGLVEVPCV 134


>sp|Q5RAP8|TSN31_PONAB Tetraspanin-31 OS=Pongo abelii GN=TSPAN31
PE=2 SV=1
Length = 210

Score = 32.0 bits (71), Expect = 2.3
Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 2/70 (2%)
Frame = +3

Query: 312 ALSNVLIIVLNTLTFILSIPIIAIGAKHDSNDCYRFLQ--KPVIALGVFIMLMSIMGIVG 485
A S + LN + ++S+ +I + A + VIA+GVF++L+++ G+VG
Sbjct: 7 ACSKNALCALNVVYMLVSLLLIGVAAWGKGLGLVSSIHIIGGVIAVGVFLLLIAVAGLVG 66

Query: 486 AACKNRCLLW 515
A ++ LL+
Sbjct: 67 AVNHHQVLLF 76


>sp|Q12999|TSN31_HUMAN Tetraspanin-31 OS=Homo sapiens GN=TSPAN31
PE=2 SV=1
Length = 210

Score = 32.0 bits (71), Expect = 2.3
Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 2/70 (2%)
Frame = +3

Query: 312 ALSNVLIIVLNTLTFILSIPIIAIGAKHDSNDCYRFLQ--KPVIALGVFIMLMSIMGIVG 485
A S + LN + ++S+ +I + A + VIA+GVF++L+++ G+VG
Sbjct: 7 ACSKNALCALNVVYMLVSLLLIGVAAWGKGLGLVSSIHIIGGVIAVGVFLLLIAVAGLVG 66

Query: 486 AACKNRCLLW 515
A ++ LL+
Sbjct: 67 AVNHHQVLLF 76


>sp|O95857|TSN13_HUMAN Tetraspanin-13 OS=Homo sapiens GN=TSPAN13
PE=2 SV=1
Length = 204

Score = 31.6 bits (70), Expect = 3.0
Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 2/70 (2%)
Frame = +3

Query: 312 ALSNVLIIVLNTLTFILSIPIIAIGAKHDSNDCYRFLQKP--VIALGVFIMLMSIMGIVG 485
A S + LN L ++S+ +I I A L+ VIA+G+F+ L++++G++G
Sbjct: 7 ACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIALVGLIG 66

Query: 486 AACKNRCLLW 515
A ++ LL+
Sbjct: 67 AVKHHQVLLF 76


tr_hit_id A9TS82
Definition tr|A9TS82|A9TS82_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 72
Score (bit) 78.6
E-value 2.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955344|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_N15, 5'
(581 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TS82|A9TS82_PHYPA Predicted protein OS=Physcomitrella paten... 79 2e-13
tr|A7PFH9|A7PFH9_VITVI Chromosome chr11 scaffold_14, whole genom... 77 9e-13
tr|A5BRM6|A5BRM6_VITVI Putative uncharacterized protein OS=Vitis... 77 9e-13
tr|Q9SUD4|Q9SUD4_ARATH Senescence-associated protein-like OS=Ara... 76 1e-12
tr|A9NRM9|A9NRM9_PICSI Putative uncharacterized protein OS=Picea... 76 2e-12
tr|B3TLS7|B3TLS7_ELAGV Senescence-associated protein OS=Elaeis g... 75 2e-12
tr|O81655|O81655_HEMSP Senescence-associated protein 5 OS=Hemero... 75 3e-12
tr|B7FIB2|B7FIB2_MEDTR Putative uncharacterized protein OS=Medic... 74 5e-12
tr|Q84VG2|Q84VG2_ORYSJ Os09g0425900 protein OS=Oryza sativa subs... 74 6e-12
tr|A2Z1E9|A2Z1E9_ORYSI Putative uncharacterized protein OS=Oryza... 74 6e-12
tr|Q683G1|Q683G1_ARATH Similar to senescence-associated protein ... 73 1e-11
tr|Q8S8Q6|Q8S8Q6_ARATH Putative uncharacterized protein At2g2381... 73 1e-11
tr|Q8S8N8|Q8S8N8_ARATH Putative uncharacterized protein At2g2381... 73 1e-11
tr|A9RCL2|A9RCL2_PHYPA Predicted protein OS=Physcomitrella paten... 72 3e-11
tr|Q5UCF4|Q5UCF4_MAIZE Putative uncharacterized protein OS=Zea m... 71 5e-11
tr|Q9M0B7|Q9M0B7_ARATH Senescence-associated protein homolog OS=... 68 3e-10
tr|A9RQS0|A9RQS0_PHYPA Predicted protein OS=Physcomitrella paten... 68 4e-10
tr|Q9M1E7|Q9M1E7_ARATH Putative uncharacterized protein F9K21.18... 67 7e-10
tr|A9TA05|A9TA05_PHYPA Predicted protein OS=Physcomitrella paten... 67 9e-10
tr|A9PJW4|A9PJW4_POPJC Putative uncharacterized protein OS=Popul... 66 2e-09
tr|A9PGY6|A9PGY6_POPTR Putative uncharacterized protein OS=Popul... 65 3e-09
tr|A7NZD6|A7NZD6_VITVI Chromosome chr6 scaffold_3, whole genome ... 65 4e-09
tr|Q8LFB2|Q8LFB2_ARATH Senescence-associated protein-like protei... 64 5e-09
tr|A9NV38|A9NV38_PICSI Putative uncharacterized protein OS=Picea... 63 1e-08
tr|Q9LSS4|Q9LSS4_ARATH Similarity to senescence-associated prote... 63 1e-08
tr|B7FIU8|B7FIU8_MEDTR Putative uncharacterized protein OS=Medic... 62 2e-08
tr|Q6Z8Q8|Q6Z8Q8_ORYSJ Os08g0443800 protein OS=Oryza sativa subs... 59 2e-07
tr|Q75L87|Q75L87_ORYSJ Os05g0122800 protein OS=Oryza sativa subs... 58 4e-07
tr|B8AXD3|B8AXD3_ORYSI Putative uncharacterized protein OS=Oryza... 58 4e-07
tr|Q67WQ6|Q67WQ6_ORYSJ Os06g0653100 protein OS=Oryza sativa subs... 57 7e-07

>tr|A9TS82|A9TS82_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_60941 PE=4 SV=1
Length = 269

Score = 78.6 bits (192), Expect = 2e-13
Identities = 38/72 (52%), Positives = 54/72 (75%), Gaps = 3/72 (4%)
Frame = +3

Query: 309 MALSNVLIIVLNTLTFILSIPIIAIG---AKHDSNDCYRFLQKPVIALGVFIMLMSIMGI 479
MA SNV++IVLN L+ ILS+PIIA G AK +C RFLQ P+I LGVF++++S+ G+
Sbjct: 1 MAFSNVVMIVLNFLSMILSLPIIAFGVWLAKKGDTECVRFLQWPIIVLGVFVLVLSLSGL 60

Query: 480 VGAACKNRCLLW 515
+G+ C NR L++
Sbjct: 61 IGSWCGNRVLMY 72


>tr|A7PFH9|A7PFH9_VITVI Chromosome chr11 scaffold_14, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017103001
PE=4 SV=1
Length = 272

Score = 76.6 bits (187), Expect = 9e-13
Identities = 36/70 (51%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
Frame = +3

Query: 315 LSNVLIIVLNTLTFILSIPIIAIG---AKHDSNDCYRFLQKPVIALGVFIMLMSIMGIVG 485
LSN L+ +LN +TF+LS+PI+ G + S DC +FL+KPVIALGVF+M++S+ G++G
Sbjct: 4 LSNNLVGILNFITFLLSVPILGAGIWLSHRASTDCEKFLEKPVIALGVFLMVVSLAGLIG 63

Query: 486 AACKNRCLLW 515
A C+ LLW
Sbjct: 64 ACCRVSWLLW 73


>tr|A5BRM6|A5BRM6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_035079 PE=4 SV=1
Length = 272

Score = 76.6 bits (187), Expect = 9e-13
Identities = 36/70 (51%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
Frame = +3

Query: 315 LSNVLIIVLNTLTFILSIPIIAIG---AKHDSNDCYRFLQKPVIALGVFIMLMSIMGIVG 485
LSN L+ +LN +TF+LS+PI+ G + S DC +FL+KPVIALGVF+M++S+ G++G
Sbjct: 4 LSNNLVGILNFITFLLSVPILGAGIWLSHRASTDCEKFLEKPVIALGVFLMVVSLAGLIG 63

Query: 486 AACKNRCLLW 515
A C+ LLW
Sbjct: 64 ACCRVSWLLW 73


>tr|Q9SUD4|Q9SUD4_ARATH Senescence-associated protein-like
OS=Arabidopsis thaliana GN=T13J8.160 PE=2 SV=1
Length = 263

Score = 76.3 bits (186), Expect = 1e-12
Identities = 35/69 (50%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
Frame = +3

Query: 318 SNVLIIVLNTLTFILSIPIIAIG---AKHDSNDCYRFLQKPVIALGVFIMLMSIMGIVGA 488
SN L+ +LN TF+LSIPI++ G K+ + +C RFL KP++ LG+F+M +SI G+VGA
Sbjct: 5 SNNLLGILNFFTFLLSIPILSAGIWLGKNAATECERFLDKPMVVLGIFLMFVSIAGLVGA 64

Query: 489 ACKNRCLLW 515
C+ CLLW
Sbjct: 65 CCRVSCLLW 73


>tr|A9NRM9|A9NRM9_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 269

Score = 75.9 bits (185), Expect = 2e-12
Identities = 37/73 (50%), Positives = 53/73 (72%), Gaps = 3/73 (4%)
Frame = +3

Query: 306 IMALSNVLIIVLNTLTFILSIPIIAIG---AKHDSNDCYRFLQKPVIALGVFIMLMSIMG 476
++ SN +I +LN +TF+LSIPI+ G A S DC +FL+KPVIA+GVF+M++SI G
Sbjct: 1 MVRFSNNVIGILNFITFVLSIPILGGGIWLANRASTDCEKFLEKPVIAIGVFLMVVSIAG 60

Query: 477 IVGAACKNRCLLW 515
++GA C+ LLW
Sbjct: 61 LIGACCRVSWLLW 73


>tr|B3TLS7|B3TLS7_ELAGV Senescence-associated protein OS=Elaeis
guineensis var. tenera PE=2 SV=1
Length = 270

Score = 75.5 bits (184), Expect = 2e-12
Identities = 39/70 (55%), Positives = 51/70 (72%), Gaps = 3/70 (4%)
Frame = +3

Query: 315 LSNVLIIVLNTLTFILSIPIIAIG---AKHDSNDCYRFLQKPVIALGVFIMLMSIMGIVG 485
+SN LI +LN LTF+LSIPI+ G A S DC +FLQ PVIA+GVF+M++S+ G+VG
Sbjct: 4 VSNNLIGILNFLTFLLSIPIVGGGIWLATRGSTDCEKFLQGPVIAVGVFLMVVSLAGLVG 63

Query: 486 AACKNRCLLW 515
A C+ LLW
Sbjct: 64 ACCRVTWLLW 73


>tr|O81655|O81655_HEMSP Senescence-associated protein 5
OS=Hemerocallis sp. GN=SA5 PE=2 SV=1
Length = 275

Score = 74.7 bits (182), Expect = 3e-12
Identities = 34/70 (48%), Positives = 50/70 (71%), Gaps = 3/70 (4%)
Frame = +3

Query: 315 LSNVLIIVLNTLTFILSIPIIAIG---AKHDSNDCYRFLQKPVIALGVFIMLMSIMGIVG 485
LSN L+ +LN +T +L+IPI++ G + H S DC FLQ P++ LG+ ++L+S+ G+VG
Sbjct: 6 LSNNLVGILNFVTLLLTIPILSTGVYLSHHSSTDCAHFLQGPILGLGIVLLLVSLAGLVG 65

Query: 486 AACKNRCLLW 515
A CKN LLW
Sbjct: 66 ACCKNSLLLW 75


>tr|B7FIB2|B7FIB2_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 266

Score = 74.3 bits (181), Expect = 5e-12
Identities = 36/72 (50%), Positives = 51/72 (70%), Gaps = 3/72 (4%)
Frame = +3

Query: 309 MALSNVLIIVLNTLTFILSIPIIAIGA---KHDSNDCYRFLQKPVIALGVFIMLMSIMGI 479
M +SN LI +LN LT ILSIPI+ G K +++C RFL+KP+I LGVF++++S+MG
Sbjct: 1 MKISNNLIGILNFLTLILSIPILLTGIWLHKQATSECERFLEKPIIILGVFLLIVSLMGF 60

Query: 480 VGAACKNRCLLW 515
+G C+ LLW
Sbjct: 61 IGGCCRVTWLLW 72


>tr|Q84VG2|Q84VG2_ORYSJ Os09g0425900 protein OS=Oryza sativa subsp.
japonica GN=Os09g0425900 PE=2 SV=1
Length = 276

Score = 73.9 bits (180), Expect = 6e-12
Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 4/71 (5%)
Frame = +3

Query: 315 LSNVLIIVLNTLTFILSIPIIAIG----AKHDSNDCYRFLQKPVIALGVFIMLMSIMGIV 482
LSN L+ +LN +TF+LS+P++ G + D +C R+ PVIA GVF++L+S+ G+V
Sbjct: 5 LSNSLLGILNAVTFLLSVPVLGGGIWLATRADGTECERYFSAPVIAFGVFLLLVSLAGLV 64

Query: 483 GAACKNRCLLW 515
GA C+ CLLW
Sbjct: 65 GACCRVNCLLW 75


>tr|A2Z1E9|A2Z1E9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_31430 PE=4 SV=1
Length = 276

Score = 73.9 bits (180), Expect = 6e-12
Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 4/71 (5%)
Frame = +3

Query: 315 LSNVLIIVLNTLTFILSIPIIAIG----AKHDSNDCYRFLQKPVIALGVFIMLMSIMGIV 482
LSN L+ +LN +TF+LS+P++ G + D +C R+ PVIA GVF++L+S+ G+V
Sbjct: 5 LSNSLLGILNAVTFLLSVPVLGGGIWLATRADGTECERYFSAPVIAFGVFLLLVSLAGLV 64

Query: 483 GAACKNRCLLW 515
GA C+ CLLW
Sbjct: 65 GACCRVNCLLW 75