DK955365
Clone id TST39A01NGRL0022_O12
Library
Length 623
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_O12. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
GAGAACTTAAACTGAAAACAATGTATGGATTGAAGGTGCTAGGCGAAGAATTCTTCTTTT
GCAAGATAGACTTTGATGCTGATTACCTTAGACAGATAGCGAGGGGCTCCCCAGACCGTG
AGTTAGTTCTGTATCGGTATCCGCAGAGCAGAGGACTCCGAATCTCAAAACCAGATGATA
GAAAAAAGTTATTGTATTGTATGTACCGACTCAGGGAGCAGTTGCTTGCATCAGGTCGTT
AACTCCAGGACTTTTTCAACGTCTTGGAGCTGGCAGTGCATGATGAAGCTAGGTGACTAT
GAAATGCACCAAGAAGTGTAGCTCAGTTGGTGAGGCCTTAGTGATGTAACCCCAATGCTG
GGGGTTCGAGTTTCATGGGCTGCGTTCTTGATGGGTGTATCCTCCTTCCCTATTGGGGAG
GTTTCTGTAGTCAAGGAGTGAATGAATATCATTGATTGTGTAATGGAGCAAGGTGGACTG
ATTCTTTAAATTGGCTGATTCTTCTATCAGCAAAATAATTAGCACTGAAGATTGGTTGGG
CTTTTTGCCAGAAGGGGGGGGCAGGCTGATCAGCATAAATCGAATATGAAGTAAGGTCAA
TAATTATCTGAGAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id O49624
Definition sp|O49624|FB242_ARATH Putative F-box protein At4g22180 OS=Arabidopsis thaliana
Align length 43
Score (bit) 30.8
E-value 5.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955365|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_O12, 5'
(612 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O49624|FB242_ARATH Putative F-box protein At4g22180 OS=Arabid... 31 5.7
sp|P39001|UME6_YEAST Transcriptional regulatory protein UME6 OS=... 30 7.5
sp|Q61001|LAMA5_MOUSE Laminin subunit alpha-5 OS=Mus musculus GN... 30 7.5
sp|O15230|LAMA5_HUMAN Laminin subunit alpha-5 OS=Homo sapiens GN... 30 9.8
sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein ... 30 9.8
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein ... 30 9.8

>sp|O49624|FB242_ARATH Putative F-box protein At4g22180
OS=Arabidopsis thaliana GN=At4g22180 PE=4 SV=3
Length = 402

Score = 30.8 bits (68), Expect = 5.7
Identities = 15/43 (34%), Positives = 22/43 (51%)
Frame = -3

Query: 292 LASSCTASSKTLKKSWS*RPDASNCSLSRYIQYNNFFLSSGFE 164
L SSC SK K W+ P+ SNC Y + +F +S ++
Sbjct: 191 LGSSCVVYSKKGDKCWNQIPETSNCHHMVYKDHKLYFSTSTYK 233


>sp|P39001|UME6_YEAST Transcriptional regulatory protein UME6
OS=Saccharomyces cerevisiae GN=UME6 PE=1 SV=2
Length = 836

Score = 30.4 bits (67), Expect = 7.5
Identities = 14/37 (37%), Positives = 19/37 (51%)
Frame = -2

Query: 422 TSPIGKEDTPIKNAAHETRTPSIGVTSLRPHQLSYTS 312
+SP D PI N T ++GV + RPH S+ S
Sbjct: 532 SSPYRTHDKPISNVNDMNNTNALGVPASRPHSSSFPS 568


>sp|Q61001|LAMA5_MOUSE Laminin subunit alpha-5 OS=Mus musculus
GN=Lama5 PE=1 SV=3
Length = 3718

Score = 30.4 bits (67), Expect = 7.5
Identities = 14/36 (38%), Positives = 20/36 (55%)
Frame = +1

Query: 169 NQMIEKSYCIVCTDSGSSCLHQVVNSRTFSTSWSWQ 276
NQ I+ YC +CT + S+ H V N+ + W WQ
Sbjct: 100 NQTIQGQYCDICTAANSNKAHPVSNAIDGTERW-WQ 134


>sp|O15230|LAMA5_HUMAN Laminin subunit alpha-5 OS=Homo sapiens
GN=LAMA5 PE=2 SV=6
Length = 3695

Score = 30.0 bits (66), Expect = 9.8
Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
Frame = +1

Query: 100 RGAPQ-TVS*FCIGIRRAEDSESQNQMIEKSYCIVCTDSGSSCLHQVVNSRTFSTSWSWQ 276
RG+P+ T +C + NQ I+ YC +CT + S+ H N+ + W WQ
Sbjct: 71 RGSPRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICTAANSNKAHPASNAIDGTERW-WQ 129


>sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein
1-like OS=Homo sapiens GN=CHD1L PE=1 SV=1
Length = 897

Score = 30.0 bits (66), Expect = 9.8
Identities = 11/23 (47%), Positives = 20/23 (86%)
Frame = -1

Query: 516 ILLIEESANLKNQSTLLHYTIND 448
+L+++E+ LKNQS+LLH T+++
Sbjct: 170 VLVVDEAHRLKNQSSLLHKTLSE 192


>sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein
1-like OS=Bos taurus GN=CHD1L PE=2 SV=1
Length = 897

Score = 30.0 bits (66), Expect = 9.8
Identities = 11/23 (47%), Positives = 20/23 (86%)
Frame = -1

Query: 516 ILLIEESANLKNQSTLLHYTIND 448
+L+++E+ LKNQS+LLH T+++
Sbjct: 172 VLVVDEAHRLKNQSSLLHKTLSE 194


tr_hit_id A9TIW4
Definition tr|A9TIW4|A9TIW4_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 72
Score (bit) 54.3
E-value 5.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955365|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_O12, 5'
(612 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TIW4|A9TIW4_PHYPA Predicted protein OS=Physcomitrella paten... 54 5e-06
tr|A9SGS7|A9SGS7_PHYPA Predicted protein OS=Physcomitrella paten... 49 2e-04
tr|A9SR91|A9SR91_PHYPA Predicted protein OS=Physcomitrella paten... 45 0.003

>tr|A9TIW4|A9TIW4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_93404 PE=4 SV=1
Length = 332

Score = 54.3 bits (129), Expect = 5e-06
Identities = 21/72 (29%), Positives = 42/72 (58%)
Frame = +3

Query: 15 KTMYGLKVLGEEFFFCKIDFDADYLRQIARGSPDRELVLYRYPQSRGLRISKPDDRKKLL 194
+ +YG+ + + + F +Y+ + RG P ++L + +YP+ RGL++S P +R ++L
Sbjct: 256 RVLYGINIKSDRISIMRTTFSEEYISSLFRGLPQQQLEVLKYPKDRGLKLSDPIERSQVL 315

Query: 195 YCMYRLREQLLA 230
Y + LR L+
Sbjct: 316 YLVTELRRHALS 327


>tr|A9SGS7|A9SGS7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_229605 PE=4 SV=1
Length = 431

Score = 48.9 bits (115), Expect = 2e-04
Identities = 23/72 (31%), Positives = 42/72 (58%)
Frame = +3

Query: 15 KTMYGLKVLGEEFFFCKIDFDADYLRQIARGSPDRELVLYRYPQSRGLRISKPDDRKKLL 194
+ MYG+ V G+E ++ F +Y+ + G P+++L + +YP GLR+S + R ++L
Sbjct: 355 EVMYGINVKGDEVSIIRVVFTEEYIVSLFGGLPEQKLEVKKYPSIGGLRLSSFESRVEVL 414

Query: 195 YCMYRLREQLLA 230
M +LR L+
Sbjct: 415 SLMTKLRRHALS 426


>tr|A9SR91|A9SR91_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_82893 PE=4 SV=1
Length = 305

Score = 45.4 bits (106), Expect = 0.003
Identities = 23/72 (31%), Positives = 40/72 (55%)
Frame = +3

Query: 15 KTMYGLKVLGEEFFFCKIDFDADYLRQIARGSPDRELVLYRYPQSRGLRISKPDDRKKLL 194
+ MYG+ V +E + F +Y+ + G P + L + +YP+ GL++S + R KLL
Sbjct: 211 QVMYGINVRVDEVSIMRAVFTREYILSLFGGLPQQVLEVKKYPERTGLKLSFYESRNKLL 270

Query: 195 YCMYRLREQLLA 230
M +LR+ L+
Sbjct: 271 SLMTKLRKYTLS 282