DK955367
Clone id TST39A01NGRL0022_O14
Library
Length 605
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_O14. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID
Sequence
CAGAGAGTCTCTCAAAGAGCTCTTCCTTCTCAAGCAAGGAGGTCCATAAATACCCATTCC
CCTCTCTCTCTCTCTCTCTCTCTCTCTCTCGCTACAGAACATACTTTCCTTACAATTGAA
CCTTTCCTCGGCCAGTCTGTCGCTGCCTTCCCTCCTGCGTAAGCTTCCCACCGGTCCTTC
ACCGCAGAAATTACCTCTGTGGAAAGCCATGGTGGTGAACATGATGAAATGGAGACCATG
GCTTACAACGCCTACCAGGTGCTTCCAAGTGAAGCTCAAGCTTCATTGCCTTGAAGGTCT
CTCGGCCCTCTTGGCTGCAAAGAGCGGTGATTTAGGCACAGTATCCTCACCAAGCAAAAG
TAGCGGAGAGCTCAACACAATGATGGTGAATGTGAAGTGGAAGGGTCCTCGACGTGCTCT
GGGTTCTCGGTTTAAAAGAAGTCTTAAGAGAGCAAAGACAACTGCAAGGTTTCTAGAAGA
CAGCCCTCTTGTCACTTGGAATGAAGAGTTTGAGCACACTTGCATCCTCACTCTCACCAA
GGATGGCCAGTTCTTACCTTGGGACATATGCTTTTGTGGGTTAATCAGGTGAACACAAAA
TCAAA
■■Homology search results ■■ -
sp_hit_id A1UTE7
Definition sp|A1UTE7|UBIC_BARBK Probable chorismate--pyruvate lyase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583)
Align length 105
Score (bit) 32.0
E-value 2.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955367|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_O14, 5'
(605 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A1UTE7|UBIC_BARBK Probable chorismate--pyruvate lyase OS=Bart... 32 2.5
sp|Q9JIG4|PPR3F_MOUSE Protein phosphatase 1 regulatory subunit 3... 31 4.3
sp|Q38J85|IL2RB_MACFA Interleukin-2 receptor subunit beta OS=Mac... 31 4.3

>sp|A1UTE7|UBIC_BARBK Probable chorismate--pyruvate lyase
OS=Bartonella bacilliformis (strain ATCC 35685 / KC583)
GN=ubiC PE=3 SV=1
Length = 171

Score = 32.0 bits (71), Expect = 2.5
Identities = 34/105 (32%), Positives = 44/105 (41%)
Frame = +2

Query: 182 PQKLPLWKAMVVNMMKWRPWLTTPTRCFQVKLKLHCLEGLSALLAAKSGDLGTVSSPSKS 361
P+ W VV M +PWL T Q L H +AL+ + LG S
Sbjct: 70 PESSLYWLREVVLMGDNQPWLLGRTVIPQETLAHHS----NALMNLGTLPLGRYLF---S 122

Query: 362 SGELNTMMVNVKWKGPRRALGSRFKRSLKRAKTTARFLEDSPLVT 496
+GEL +++ K A SR + S K T FL DSPL T
Sbjct: 123 NGELTRDYIHIGRKDSLWARRSRLRLSGKPLLLTELFLADSPLYT 167


>sp|Q9JIG4|PPR3F_MOUSE Protein phosphatase 1 regulatory subunit 3F
OS=Mus musculus GN=Ppp1r3f PE=2 SV=2
Length = 735

Score = 31.2 bits (69), Expect = 4.3
Identities = 18/46 (39%), Positives = 24/46 (52%)
Frame = +2

Query: 290 LEGLSALLAAKSGDLGTVSSPSKSSGELNTMMVNVKWKGPRRALGS 427
L LS L A + G +SP+ + G L + +KW GP RAL S
Sbjct: 436 LSHLSRLRAVAAAGGGEGTSPTHALGILTDRDLILKWPGPERALNS 481


>sp|Q38J85|IL2RB_MACFA Interleukin-2 receptor subunit beta OS=Macaca
fascicularis GN=IL2RB PE=2 SV=1
Length = 551

Score = 31.2 bits (69), Expect = 4.3
Identities = 27/103 (26%), Positives = 48/103 (46%), Gaps = 8/103 (7%)
Frame = +2

Query: 269 VKLKLHCLEGLSALLAAKSG-----DLGTVSSPSKSSGELNTMMVNVKWKGPRRALGSRF 433
V L++ C EG+ + A +L ++ S + T N+ WK + + F
Sbjct: 104 VTLRVMCREGVRWRMMAIQDFKPFENLRLMAPISLQVVHVETHRCNISWKISQAS--HYF 161

Query: 434 KRSLK---RAKTTARFLEDSPLVTWNEEFEHTCILTLTKDGQF 553
+R L+ R + E++PL+T ++ E C+ TLT D Q+
Sbjct: 162 ERHLEFEARTLSPGHTWEEAPLMTLKQKQEWICLETLTPDTQY 204


tr_hit_id A9T1E1
Definition tr|A9T1E1|A9T1E1_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 120
Score (bit) 87.0
E-value 8.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955367|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0022_O14, 5'
(605 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9T1E1|A9T1E1_PHYPA Predicted protein OS=Physcomitrella paten... 87 8e-16
tr|Q9SF22|Q9SF22_ARATH F26K24.5 protein OS=Arabidopsis thaliana ... 82 2e-14
tr|Q0WKW4|Q0WKW4_ARATH Putative uncharacterized protein At3g1176... 82 2e-14
tr|A7Q079|A7Q079_VITVI Chromosome chr8 scaffold_41, whole genome... 75 3e-12
tr|Q9FMC4|Q9FMC4_ARATH Genomic DNA, chromosome 5, P1 clone:MUK11... 63 2e-08
tr|Q2QM21|Q2QM21_ORYSJ Os12g0620600 protein OS=Oryza sativa subs... 52 3e-05
tr|A2ZMV2|A2ZMV2_ORYSI Putative uncharacterized protein OS=Oryza... 49 3e-04
tr|Q10G00|Q10G00_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 40 0.11
tr|Q9SKK3|Q9SKK3_ARATH Expressed protein OS=Arabidopsis thaliana... 38 0.52
tr|Q8W4Q2|Q8W4Q2_ARATH SYNC1 protein OS=Arabidopsis thaliana GN=... 38 0.52
tr|B8AVW7|B8AVW7_ORYSI Putative uncharacterized protein OS=Oryza... 36 1.5
tr|Q60DI5|Q60DI5_ORYSJ Os03g0649000 protein OS=Oryza sativa subs... 35 4.4
tr|A5C4E3|A5C4E3_VITVI Putative uncharacterized protein OS=Vitis... 35 4.4
tr|B2WGP3|B2WGP3_PYRTR Fatty acid synthase subunit alpha reducta... 34 7.6

>tr|A9T1E1|A9T1E1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_138790 PE=4 SV=1
Length = 706

Score = 87.0 bits (214), Expect = 8e-16
Identities = 51/120 (42%), Positives = 70/120 (58%)
Frame = +2

Query: 209 MVVNMMKWRPWLTTPTRCFQVKLKLHCLEGLSALLAAKSGDLGTVSSPSKSSGELNTMMV 388
MV+ MKW P ++ +QV L L+ LEGLS + E + V
Sbjct: 1 MVIKAMKW-PLRQHFSKKYQVNLVLNKLEGLSP-----------------NDSEEAKLYV 42

Query: 389 NVKWKGPRRALGSRFKRSLKRAKTTARFLEDSPLVTWNEEFEHTCILTLTKDGQFLPWDI 568
++KWKGP+ ALGSRF RS+KR KT A +E+S V+W+++FEH C+LT KDG F PW +
Sbjct: 43 DLKWKGPKSALGSRF-RSMKREKTNALPVENSGSVSWDKKFEHVCVLTNDKDGVFQPWHV 101


>tr|Q9SF22|Q9SF22_ARATH F26K24.5 protein OS=Arabidopsis thaliana
GN=At3g11760 PE=4 SV=1
Length = 702

Score = 82.0 bits (201), Expect = 2e-14
Identities = 51/123 (41%), Positives = 68/123 (55%), Gaps = 1/123 (0%)
Frame = +2

Query: 209 MVVNMMKWRPWLTTPTRCFQVKLKLHCLEGLSALLAAKSGDLGTVSSPSKSSGELNTMMV 388
MVV MMKWRPW TR ++VKL + LEG DL P K + + V
Sbjct: 1 MVVKMMKWRPWPPLVTRKYEVKLSVKKLEG---------WDLVREGVPEK-----DRLTV 46

Query: 389 NVKWKGPRRALGSRFKRSLKRAKTTARFLEDSPLVTW-NEEFEHTCILTLTKDGQFLPWD 565
++WKGP+ LGS +RS+KR T + +S +V+W +EEF+ C LT KD F PW+
Sbjct: 47 EIRWKGPKATLGS-LRRSVKR-NFTKEAVGESDVVSWEDEEFQSLCSLTSYKDSLFYPWE 104

Query: 566 ICF 574
I F
Sbjct: 105 ITF 107


>tr|Q0WKW4|Q0WKW4_ARATH Putative uncharacterized protein At3g11760
OS=Arabidopsis thaliana GN=At3g11760 PE=2 SV=1
Length = 394

Score = 82.0 bits (201), Expect = 2e-14
Identities = 51/123 (41%), Positives = 68/123 (55%), Gaps = 1/123 (0%)
Frame = +2

Query: 209 MVVNMMKWRPWLTTPTRCFQVKLKLHCLEGLSALLAAKSGDLGTVSSPSKSSGELNTMMV 388
MVV MMKWRPW TR ++VKL + LEG DL P K + + V
Sbjct: 1 MVVKMMKWRPWPPLVTRKYEVKLSVKKLEG---------WDLVREGVPEK-----DRLTV 46

Query: 389 NVKWKGPRRALGSRFKRSLKRAKTTARFLEDSPLVTW-NEEFEHTCILTLTKDGQFLPWD 565
++WKGP+ LGS +RS+KR T + +S +V+W +EEF+ C LT KD F PW+
Sbjct: 47 EIRWKGPKATLGS-LRRSVKR-NFTKEAVGESDVVSWEDEEFQSLCSLTSYKDSLFYPWE 104

Query: 566 ICF 574
I F
Sbjct: 105 ITF 107


>tr|A7Q079|A7Q079_VITVI Chromosome chr8 scaffold_41, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00027182001
PE=4 SV=1
Length = 715

Score = 75.1 bits (183), Expect = 3e-12
Identities = 43/122 (35%), Positives = 65/122 (53%)
Frame = +2

Query: 209 MVVNMMKWRPWLTTPTRCFQVKLKLHCLEGLSALLAAKSGDLGTVSSPSKSSGELNTMMV 388
MVV MM+WRPW R ++VKL + +EG +G+ G E ++V
Sbjct: 1 MVVKMMRWRPWPPLIPRKYEVKLVVRRMEGWGC-----AGEEGA---------EGRRVVV 46

Query: 389 NVKWKGPRRALGSRFKRSLKRAKTTARFLEDSPLVTWNEEFEHTCILTLTKDGQFLPWDI 568
++WKGP+ +L S +R++KR T + +V W+EEF+ C L+ KD F PW+I
Sbjct: 47 EIRWKGPKISLSS-LRRTVKRNFTKEEDVGQDGVVLWDEEFQSVCNLSAYKDNVFHPWEI 105

Query: 569 CF 574
F
Sbjct: 106 AF 107


>tr|Q9FMC4|Q9FMC4_ARATH Genomic DNA, chromosome 5, P1 clone:MUK11
OS=Arabidopsis thaliana GN=At5g04860 PE=4 SV=1
Length = 782

Score = 62.8 bits (151), Expect = 2e-08
Identities = 44/124 (35%), Positives = 60/124 (48%), Gaps = 6/124 (4%)
Frame = +2

Query: 209 MVVNM---MKWRPWLTTPTRCFQVKLKLHCLEGLSALLAAKSGDLGTVSSPSKSSGELNT 379
MVV M M+W PW F V + +H ++GL L + GD T S+ G T
Sbjct: 1 MVVKMKQIMRWPPWPPLFAVKFDVIVVVHQMDGL--LDSDGGGDDST--DQSQRGGGTTT 56

Query: 380 M---MVNVKWKGPRRALGSRFKRSLKRAKTTARFLEDSPLVTWNEEFEHTCILTLTKDGQ 550
+V +KWKGP+ KRS+ R T +V WNEEF+ C ++ K+G
Sbjct: 57 RKRPVVEIKWKGPKSVT---LKRSVVRNLTEEGGFRGDGVVEWNEEFKRVCEFSVYKEGS 113

Query: 551 FLPW 562
FLPW
Sbjct: 114 FLPW 117


>tr|Q2QM21|Q2QM21_ORYSJ Os12g0620600 protein OS=Oryza sativa subsp.
japonica GN=Os12g0620600 PE=2 SV=1
Length = 753

Score = 52.0 bits (123), Expect = 3e-05
Identities = 41/126 (32%), Positives = 57/126 (45%), Gaps = 4/126 (3%)
Frame = +2

Query: 209 MVVNMMKWRPWLTTPTRCFQVKLKLHCLEGLSALLAAKSGDLGTVSSPSKSSGELNTMMV 388
MV M W P P R F+V+L + EGL+A A + SSP + + V
Sbjct: 1 MVARMWPWPP----PARKFRVRLVVRRAEGLTATATATAS-----SSPVAEA----KVAV 47

Query: 389 NVKWKGPRRALGSRFKRSLKRAKTTARFLEDSPLVTWNEEFEHTCILTLT---KDG-QFL 556
V+WKGP+ + +R + +T ++ V W EEFE T T K G F
Sbjct: 48 EVRWKGPKASPLGSLRRVMHSNRTRLESAAEA-AVAWEEEFERVETFTATSHRKSGAAFH 106

Query: 557 PWDICF 574
PWD+ F
Sbjct: 107 PWDLAF 112


>tr|A2ZMV2|A2ZMV2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_39155 PE=4 SV=1
Length = 749

Score = 48.5 bits (114), Expect = 3e-04
Identities = 38/117 (32%), Positives = 54/117 (46%), Gaps = 4/117 (3%)
Frame = +2

Query: 236 PWLTTPTRCFQVKLKLHCLEGLSALLAAKSGDLGTVSSPSKSSGELNTMMVNVKWKGPRR 415
PW P R F+V+L + EGL+A A + SSP + + V V+WKGP+
Sbjct: 3 PW-PPPARKFRVRLVVRRAEGLTATATATAS-----SSPVAEA----KVAVEVRWKGPKA 52

Query: 416 ALGSRFKRSLKRAKTTARFLEDSPLVTWNEEFEHTCILTLT---KDG-QFLPWDICF 574
+ +R + +T ++ V W EEFE T T K G F PWD+ F
Sbjct: 53 SPLGSLRRVMHSNRTRLESAAEA-AVAWEEEFERVETFTATSHRKSGAAFHPWDLAF 108


>tr|Q10G00|Q10G00_ORYSJ Expressed protein OS=Oryza sativa subsp.
japonica GN=LOC_Os03g44670 PE=4 SV=1
Length = 784

Score = 40.0 bits (92), Expect = 0.11
Identities = 38/151 (25%), Positives = 61/151 (40%), Gaps = 29/151 (19%)
Frame = +2

Query: 209 MVVNMMKW-RPWLTTPTRCFQVKLKLHCLEGLSALLAAKSGDLGTVSSPSKSSGELNTMM 385
MV MM+W RP R F+V+L + EGL AA + + + + + +
Sbjct: 1 MVARMMRWPRP---PAARKFRVRLVVRRAEGLQQPCAAAAEHAASAEAEAPPT----RVA 53

Query: 386 VNVKWKGPRRA-LGSRFKRSLKRAKTTARFLEDSPLV----------------------- 493
V+WKGP+ + L S + +++R +T E + +V
Sbjct: 54 AEVRWKGPKASPLSSLRRTAVRRNRTREAEAEAAAVVACATAADDAAAAAGAGDAAGVVV 113

Query: 494 -TWNEEFEHTCILTLT---KDGQFLPWDICF 574
W EEFE T L + F PW++ F
Sbjct: 114 AAWEEEFESTVTLAAASHREHAAFQPWELAF 144


>tr|Q9SKK3|Q9SKK3_ARATH Expressed protein OS=Arabidopsis thaliana
GN=At2g25460 PE=2 SV=2
Length = 423

Score = 37.7 bits (86), Expect = 0.52
Identities = 33/112 (29%), Positives = 46/112 (41%), Gaps = 6/112 (5%)
Frame = +2

Query: 257 RCFQVKLKLHCLEGLSALLAAKSGDLGTVSSPSKSSGELNTMMVNVKWKGPRRALGSRFK 436
R V +K L+GL A+L GD +++G+ + MV VKWKGP G F
Sbjct: 6 RKLHVTVKPVRLDGLPAIL----GD--------ETAGKNLSAMVEVKWKGPVSGFGLGFV 53

Query: 437 RSLKRAKTTARFLEDSPL------VTWNEEFEHTCILTLTKDGQFLPWDICF 574
R+ P+ V W EEFE C + PW++ F
Sbjct: 54 -PFYRSNRPVNHTSSKPIALGSNHVEWEEEFERVCCIV-------GPWNLSF 97


>tr|Q8W4Q2|Q8W4Q2_ARATH SYNC1 protein OS=Arabidopsis thaliana
GN=At2g25460 PE=2 SV=1
Length = 423

Score = 37.7 bits (86), Expect = 0.52
Identities = 33/112 (29%), Positives = 46/112 (41%), Gaps = 6/112 (5%)
Frame = +2

Query: 257 RCFQVKLKLHCLEGLSALLAAKSGDLGTVSSPSKSSGELNTMMVNVKWKGPRRALGSRFK 436
R V +K L+GL A+L GD +++G+ + MV VKWKGP G F
Sbjct: 6 RKLHVTVKPVRLDGLPAIL----GD--------ETAGKNLSAMVEVKWKGPVSGFGLGFV 53

Query: 437 RSLKRAKTTARFLEDSPL------VTWNEEFEHTCILTLTKDGQFLPWDICF 574
R+ P+ V W EEFE C + PW++ F
Sbjct: 54 -PFYRSNRPVNHTSSKPIALGSNHVEWEEEFERVCCIV-------GPWNLSF 97