DK955496
Clone id TST39A01NGRL0023_E01
Library
Length 445
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_E01. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID
Sequence
CAATCGCCAATATTTTTAAGAAGCATGTAACAGATGAAGGAATGGCCCTTGTAAAGCAGG
CAGAAGATGCAGCTAGCAACAAGAAGGCAGAGAAAAAGGACTTGATTGGAGGCTCAGACC
AGGCCTTCGTGCGAAATGTAATTGAGCTGCATGACAAGTATTTGCAGTATGTGAGCGAAT
GTTTTGTGCATAACTCTCTTTTTCACAAGGCATTAAAGGAAGCATTTGAGGTGTTTTGCA
ACAAGGGAGTTGGTGGCAGCAGTAGTGCAGAACTGTTAGCTACTTTTTGCGACAATCTTT
TAAAGAAAGGAGGGAGTGAAAAATTGAGCGATGAGGCCATTGAGGACACTCTGGAAAAGG
TTGTGAAACTTCTTGCTTACATTAGTGATAAGGACCTCTTTGCAGAATTCTACAGGAAGA
AATTAGCTCGCAGGCTTTTGTTTGA
■■Homology search results ■■ -
sp_hit_id Q94AH6
Definition sp|Q94AH6|CUL1_ARATH Cullin-1 OS=Arabidopsis thaliana
Align length 147
Score (bit) 223.0
E-value 2.0e-58
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955496|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0023_E01, 5'
(445 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q94AH6|CUL1_ARATH Cullin-1 OS=Arabidopsis thaliana GN=CUL1 PE... 223 2e-58
sp|Q5R4G6|CUL1_PONAB Cullin-1 OS=Pongo abelii GN=CUL1 PE=2 SV=1 84 3e-16
sp|Q9WTX6|CUL1_MOUSE Cullin-1 OS=Mus musculus GN=Cul1 PE=1 SV=1 84 3e-16
sp|Q13616|CUL1_HUMAN Cullin-1 OS=Homo sapiens GN=CUL1 PE=1 SV=2 84 3e-16
sp|Q13620|CUL4B_HUMAN Cullin-4B OS=Homo sapiens GN=CUL4B PE=1 SV=3 79 1e-14
sp|Q24311|CUL1_DROME Cullin homolog 1 OS=Drosophila melanogaster... 77 3e-14
sp|Q13619|CUL4A_HUMAN Cullin-4A OS=Homo sapiens GN=CUL4A PE=1 SV=3 76 7e-14
sp|Q9D4H8|CUL2_MOUSE Cullin-2 OS=Mus musculus GN=Cul2 PE=1 SV=2 75 1e-13
sp|Q3TCH7|CUL4A_MOUSE Cullin-4A OS=Mus musculus GN=Cul4a PE=2 SV=1 74 2e-13
sp|Q17389|CUL1_CAEEL Cullin-1 OS=Caenorhabditis elegans GN=cul-1... 74 3e-13
sp|Q5RCF3|CUL2_PONAB Cullin-2 OS=Pongo abelii GN=CUL2 PE=2 SV=1 74 4e-13
sp|Q13617|CUL2_HUMAN Cullin-2 OS=Homo sapiens GN=CUL2 PE=1 SV=2 74 4e-13
sp|Q54CS2|CUL4_DICDI Cullin-4 OS=Dictyostelium discoideum GN=cul... 73 5e-13
sp|Q17390|CUL2_CAEEL Cullin-2 OS=Caenorhabditis elegans GN=cul-2... 70 5e-12
sp|Q9JLV5|CUL3_MOUSE Cullin-3 OS=Mus musculus GN=Cul3 PE=1 SV=1 65 1e-10
sp|Q13618|CUL3_HUMAN Cullin-3 OS=Homo sapiens GN=CUL3 PE=1 SV=2 65 2e-10
sp|Q54XF7|CUL5_DICDI Cullin-5 OS=Dictyostelium discoideum GN=cul... 63 5e-10
sp|O14122|CUL4_SCHPO Cullin-4 OS=Schizosaccharomyces pombe GN=cu... 63 6e-10
sp|Q54NZ5|CUL3_DICDI Cullin-3 OS=Dictyostelium discoideum GN=cul... 63 6e-10
sp|O60999|CUL1_DICDI Cullin-1 OS=Dictyostelium discoideum GN=cul... 62 8e-10
sp|Q9JJ31|CUL5_RAT Cullin-5 OS=Rattus norvegicus GN=Cul5 PE=1 SV=3 62 1e-09
sp|Q29425|CUL5_RABIT Cullin-5 OS=Oryctolagus cuniculus GN=CUL5 P... 62 1e-09
sp|Q9D5V5|CUL5_MOUSE Cullin-5 OS=Mus musculus GN=Cul5 PE=2 SV=3 62 1e-09
sp|Q93034|CUL5_HUMAN Cullin-5 OS=Homo sapiens GN=CUL5 PE=1 SV=4 62 1e-09
sp|Q5RB36|CUL5_PONAB Cullin-5 OS=Pongo abelii GN=CUL5 PE=2 SV=3 61 2e-09
sp|Q21346|CUL6_CAEEL Cullin-6 OS=Caenorhabditis elegans GN=cul-6... 60 3e-09
sp|Q23639|CUL5_CAEEL Cullin-5 OS=Caenorhabditis elegans GN=cul-5... 60 3e-09
sp|O13790|CUL1_SCHPO Cullin-1 OS=Schizosaccharomyces pombe GN=cu... 59 7e-09
sp|Q9XZJ3|CUL2_DICDI Cullin-2 OS=Dictyostelium discoideum GN=cul... 59 9e-09
sp|Q17391|CUL3_CAEEL Cullin-3 OS=Caenorhabditis elegans GN=cul-3... 57 4e-08

>sp|Q94AH6|CUL1_ARATH Cullin-1 OS=Arabidopsis thaliana GN=CUL1 PE=1
SV=1
Length = 738

Score = 223 bits (569), Expect = 2e-58
Identities = 113/147 (76%), Positives = 128/147 (87%)
Frame = +3

Query: 3 IANIFKKHVTDEGMALVKQAEDAASNKKAEKKDLIGGSDQAFVRNVIELHDKYLQYVSEC 182
+ANIFK+HVT EG ALV+QAED A+N+ A + +Q +R VIELHDKY+ YV+EC
Sbjct: 300 VANIFKQHVTAEGNALVQQAEDTATNQVANTASV---QEQVLIRKVIELHDKYMVYVTEC 356

Query: 183 FVHNSLFHKALKEAFEVFCNKGVGGSSSAELLATFCDNLLKKGGSEKLSDEAIEDTLEKV 362
F +++LFHKALKEAFE+FCNK V GSSSAELLATFCDN+LKKGGSEKLSDEAIEDTLEKV
Sbjct: 357 FQNHTLFHKALKEAFEIFCNKTVAGSSSAELLATFCDNILKKGGSEKLSDEAIEDTLEKV 416

Query: 363 VKLLAYISDKDLFAEFYRKKLARRLLF 443
VKLLAYISDKDLFAEFYRKKLARRLLF
Sbjct: 417 VKLLAYISDKDLFAEFYRKKLARRLLF 443


>sp|Q5R4G6|CUL1_PONAB Cullin-1 OS=Pongo abelii GN=CUL1 PE=2 SV=1
Length = 776

Score = 83.6 bits (205), Expect = 3e-16
Identities = 53/153 (34%), Positives = 85/153 (55%), Gaps = 7/153 (4%)
Frame = +3

Query: 3 IANIFKKHVTDEGMALVKQAEDAASNKKAEKKDLIGGSDQAFVRNVIELHDKYLQYVSEC 182
+ + + H+ ++G+A +++ +AA N + +V+ V+++H KY V
Sbjct: 336 LKKLLETHIHNQGLAAIEKCGEAALN-----------DPKMYVQTVLDVHKKYNALVMSA 384

Query: 183 FVHNSLFHKALKEAFEVFCNKGV------GGSSSAELLATFCDNLLKKGGSEKLSDEA-I 341
F +++ F AL +A F N S S ELLA +CD+LLKK S K +EA +
Sbjct: 385 FNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKK--SSKNPEEAEL 442

Query: 342 EDTLEKVVKLLAYISDKDLFAEFYRKKLARRLL 440
EDTL +V+ + YI DKD+F +FY K LA+RL+
Sbjct: 443 EDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLV 475


>sp|Q9WTX6|CUL1_MOUSE Cullin-1 OS=Mus musculus GN=Cul1 PE=1 SV=1
Length = 776

Score = 83.6 bits (205), Expect = 3e-16
Identities = 53/153 (34%), Positives = 85/153 (55%), Gaps = 7/153 (4%)
Frame = +3

Query: 3 IANIFKKHVTDEGMALVKQAEDAASNKKAEKKDLIGGSDQAFVRNVIELHDKYLQYVSEC 182
+ + + H+ ++G+A +++ +AA N + +V+ V+++H KY V
Sbjct: 336 LKKLLETHIHNQGLAAIEKCGEAALN-----------DPKMYVQTVLDVHKKYNALVMSA 384

Query: 183 FVHNSLFHKALKEAFEVFCNKGV------GGSSSAELLATFCDNLLKKGGSEKLSDEA-I 341
F +++ F AL +A F N S S ELLA +CD+LLKK S K +EA +
Sbjct: 385 FNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKK--SSKNPEEAEL 442

Query: 342 EDTLEKVVKLLAYISDKDLFAEFYRKKLARRLL 440
EDTL +V+ + YI DKD+F +FY K LA+RL+
Sbjct: 443 EDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLV 475


>sp|Q13616|CUL1_HUMAN Cullin-1 OS=Homo sapiens GN=CUL1 PE=1 SV=2
Length = 776

Score = 83.6 bits (205), Expect = 3e-16
Identities = 53/153 (34%), Positives = 85/153 (55%), Gaps = 7/153 (4%)
Frame = +3

Query: 3 IANIFKKHVTDEGMALVKQAEDAASNKKAEKKDLIGGSDQAFVRNVIELHDKYLQYVSEC 182
+ + + H+ ++G+A +++ +AA N + +V+ V+++H KY V
Sbjct: 336 LKKLLETHIHNQGLAAIEKCGEAALN-----------DPKMYVQTVLDVHKKYNALVMSA 384

Query: 183 FVHNSLFHKALKEAFEVFCNKGV------GGSSSAELLATFCDNLLKKGGSEKLSDEA-I 341
F +++ F AL +A F N S S ELLA +CD+LLKK S K +EA +
Sbjct: 385 FNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKK--SSKNPEEAEL 442

Query: 342 EDTLEKVVKLLAYISDKDLFAEFYRKKLARRLL 440
EDTL +V+ + YI DKD+F +FY K LA+RL+
Sbjct: 443 EDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLV 475


>sp|Q13620|CUL4B_HUMAN Cullin-4B OS=Homo sapiens GN=CUL4B PE=1 SV=3
Length = 895

Score = 78.6 bits (192), Expect = 1e-14
Identities = 42/108 (38%), Positives = 65/108 (60%)
Frame = +3

Query: 117 DQAFVRNVIELHDKYLQYVSECFVHNSLFHKALKEAFEVFCNKGVGGSSSAELLATFCDN 296
D+ V+ +++ DK + CF+ N F A+KEAFE F NK + AEL+A + D+
Sbjct: 494 DKTMVQELLDFKDKVDHIIDICFLKNEKFINAMKEAFETFINKRP--NKPAELIAKYVDS 551

Query: 297 LLKKGGSEKLSDEAIEDTLEKVVKLLAYISDKDLFAEFYRKKLARRLL 440
L+ G E +DE +E L+K++ + +I KD+F FY+K LA+RLL
Sbjct: 552 KLRAGNKEA-TDEELEKMLDKIMIIFRFIYGKDVFEAFYKKDLAKRLL 598


>sp|Q24311|CUL1_DROME Cullin homolog 1 OS=Drosophila melanogaster
GN=lin19 PE=1 SV=2
Length = 774

Score = 77.0 bits (188), Expect = 3e-14
Identities = 50/153 (32%), Positives = 81/153 (52%), Gaps = 7/153 (4%)
Frame = +3

Query: 3 IANIFKKHVTDEGMALVKQA--EDAASNKKAEKKDLIGGSDQAFVRNVIELHDKYLQYVS 176
+ +I + H+ +G + + DAA++ K +V+ ++++H KY V
Sbjct: 335 LKSILENHILHQGTEAIAKCCTTDAANDPKT------------YVQTILDVHKKYNALVL 382

Query: 177 ECFVHNSLFHKALKEAFEVFCNKGV-----GGSSSAELLATFCDNLLKKGGSEKLSDEAI 341
F +++ F AL +A F N V S S ELLA +CD LLKK S+ D+ +
Sbjct: 383 TAFNNDNGFVAALDKACGKFINSNVVTIANSASKSPELLAKYCDLLLKKS-SKNPEDKEL 441

Query: 342 EDTLEKVVKLLAYISDKDLFAEFYRKKLARRLL 440
ED L +V+ + YI DKD+F ++Y K LA+RL+
Sbjct: 442 EDNLNQVMVVFKYIEDKDVFQKYYSKMLAKRLV 474


>sp|Q13619|CUL4A_HUMAN Cullin-4A OS=Homo sapiens GN=CUL4A PE=1 SV=3
Length = 759

Score = 75.9 bits (185), Expect = 7e-14
Identities = 42/108 (38%), Positives = 64/108 (59%)
Frame = +3

Query: 117 DQAFVRNVIELHDKYLQYVSECFVHNSLFHKALKEAFEVFCNKGVGGSSSAELLATFCDN 296
D+ V+++++ DK + CF N F +KE+FE F NK + AEL+A D+
Sbjct: 358 DKDMVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRP--NKPAELIAKHVDS 415

Query: 297 LLKKGGSEKLSDEAIEDTLEKVVKLLAYISDKDLFAEFYRKKLARRLL 440
L+ G E +DE +E TL+K++ L +I KD+F FY+K LA+RLL
Sbjct: 416 KLRAGNKEA-TDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLL 462


>sp|Q9D4H8|CUL2_MOUSE Cullin-2 OS=Mus musculus GN=Cul2 PE=1 SV=2
Length = 745

Score = 75.1 bits (183), Expect = 1e-13
Identities = 48/143 (33%), Positives = 76/143 (53%), Gaps = 2/143 (1%)
Frame = +3

Query: 18 KKHVTDEGMALVKQAEDAASNKKAEKKDLIGGSDQAFVRNVIELHDKYLQYVSECFVHNS 197
+KH+ DEG+ A SN E + FV +V+E+H K++Q ++ +
Sbjct: 316 QKHIHDEGLR-------ATSNLTQEHMPTL------FVESVLEVHGKFVQLINTVLNGDQ 362

Query: 198 LFHKALKEAFEVFCNKGVGGS--SSAELLATFCDNLLKKGGSEKLSDEAIEDTLEKVVKL 371
F AL +A N S + ELLA +CDNLLKK ++ +++ +ED L + +
Sbjct: 363 HFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKS-AKGMTENEVEDKLTSFITV 421

Query: 372 LAYISDKDLFAEFYRKKLARRLL 440
YI DKD+F +FY + LA+RL+
Sbjct: 422 FKYIDDKDVFQKFYARMLAKRLI 444


>sp|Q3TCH7|CUL4A_MOUSE Cullin-4A OS=Mus musculus GN=Cul4a PE=2 SV=1
Length = 759

Score = 74.3 bits (181), Expect = 2e-13
Identities = 42/108 (38%), Positives = 63/108 (58%)
Frame = +3

Query: 117 DQAFVRNVIELHDKYLQYVSECFVHNSLFHKALKEAFEVFCNKGVGGSSSAELLATFCDN 296
D+ V+++++ DK V CF N F +KE+FE F NK + AEL+A D+
Sbjct: 358 DKDMVQDLLDFKDKVDHVVEVCFQRNERFINLMKESFETFINKRP--NKPAELIAKHVDS 415

Query: 297 LLKKGGSEKLSDEAIEDTLEKVVKLLAYISDKDLFAEFYRKKLARRLL 440
L+ G E +DE +E L+K++ L +I KD+F FY+K LA+RLL
Sbjct: 416 KLRAGNKEA-TDEELERILDKIMILFRFIHGKDVFEAFYKKDLAKRLL 462


>sp|Q17389|CUL1_CAEEL Cullin-1 OS=Caenorhabditis elegans GN=cul-1
PE=1 SV=1
Length = 780

Score = 73.9 bits (180), Expect = 3e-13
Identities = 49/152 (32%), Positives = 82/152 (53%), Gaps = 11/152 (7%)
Frame = +3

Query: 18 KKHVTDEG-MALVKQAEDAASNKKAEKKDLIGGSDQAFVRNVIELHDKYLQYVSECFVHN 194
+ H+ EG AL + A +AA++ K +V+ ++E+H++Y V+ F +
Sbjct: 342 ENHIAKEGHQALERVAMEAATDAKL------------YVKTLLEVHERYQSLVNRSFKNE 389

Query: 195 SLFHKALKEAFEVFCNKGVGG---------SSSAELLATFCDNLLKKGGSEKLSDEA-IE 344
F ++L +A F N + SAELLA +CD LL+K S K+ DEA +E
Sbjct: 390 PGFMQSLDKAATSFINNNAVTKRAPPQAQLTKSAELLARYCDQLLRK--SSKMPDEAELE 447

Query: 345 DTLEKVVKLLAYISDKDLFAEFYRKKLARRLL 440
+ K++ + YI DKD+F++FY K ++RL+
Sbjct: 448 ELQTKIMVVFKYIDDKDVFSKFYTKMFSKRLI 479


tr_hit_id A9T066
Definition tr|A9T066|A9T066_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 147
Score (bit) 259.0
E-value 5.0e-68
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955496|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0023_E01, 5'
(445 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9T066|A9T066_PHYPA Predicted protein OS=Physcomitrella paten... 259 5e-68
tr|A9T788|A9T788_PHYPA Predicted protein OS=Physcomitrella paten... 257 2e-67
tr|A9T5R6|A9T5R6_PHYPA Predicted protein OS=Physcomitrella paten... 257 2e-67
tr|B8LQB2|B8LQB2_PICSI Putative uncharacterized protein OS=Picea... 253 4e-66
tr|Q711G6|Q711G6_TOBAC Cullin 1C (Fragment) OS=Nicotiana tabacum... 249 5e-65
tr|A7NW32|A7NW32_VITVI Chromosome chr5 scaffold_2, whole genome ... 249 5e-65
tr|Q94I77|Q94I77_ORYSA Putative cullin OS=Oryza sativa GN=OSJNBa... 245 7e-64
tr|Q5ZC88|Q5ZC88_ORYSJ cDNA clone:001-033-G02, full insert seque... 245 7e-64
tr|B8A885|B8A885_ORYSI Putative uncharacterized protein OS=Oryza... 245 7e-64
tr|A2ZT67|A2ZT67_ORYSJ Putative uncharacterized protein OS=Oryza... 245 7e-64
tr|Q8LP18|Q8LP18_PEA Cullin-like protein1 OS=Pisum sativum GN=cu... 244 2e-63
tr|A0ELU7|A0ELU7_PETIN Cullin 1-like protein C OS=Petunia integr... 243 3e-63
tr|Q65XE3|Q65XE3_ORYSJ Putative cullin 1 OS=Oryza sativa subsp. ... 241 2e-62
tr|Q0DKQ0|Q0DKQ0_ORYSJ Os05g0149600 protein OS=Oryza sativa subs... 241 2e-62
tr|B8AY43|B8AY43_ORYSI Putative uncharacterized protein OS=Oryza... 241 2e-62
tr|A3B003|A3B003_ORYSJ Putative uncharacterized protein OS=Oryza... 241 2e-62
tr|Q93VH7|Q93VH7_ORYSJ Cullin-like protein (CUL1) OS=Oryza sativ... 225 1e-57
tr|Q711G7|Q711G7_TOBAC Cullin 1B OS=Nicotiana tabacum GN=cul1B P... 222 6e-57
tr|A0ELU8|A0ELU8_PETIN Cullin 1-like protein G OS=Petunia integr... 221 1e-56
tr|A8IW43|A8IW43_CHLRE Cullin OS=Chlamydomonas reinhardtii GN=CU... 206 6e-52
tr|A7PTX0|A7PTX0_VITVI Chromosome chr7 scaffold_31, whole genome... 205 8e-52
tr|A2WQ18|A2WQ18_ORYSI Putative uncharacterized protein OS=Oryza... 205 1e-51
tr|Q93VL5|Q93VL5_ORYSJ Cullin-like protein (Os01g0369200 protein... 202 5e-51
tr|Q7G8Y4|Q7G8Y4_ORYSA Putative cullin OS=Oryza sativa GN=OSJNBa... 202 5e-51
tr|A2ZT68|A2ZT68_ORYSJ Putative uncharacterized protein OS=Oryza... 202 5e-51
tr|Q9SRZ0|Q9SRZ0_ARATH F22D16.2 protein OS=Arabidopsis thaliana ... 189 8e-47
tr|Q711G8|Q711G8_TOBAC Cullin 1A OS=Nicotiana tabacum GN=cul1A P... 189 8e-47
tr|Q015Y9|Q015Y9_OSTTA Cullin-like protein1 (ISS) OS=Ostreococcu... 185 8e-46
tr|A4RZK4|A4RZK4_OSTLU Predicted protein OS=Ostreococcus lucimar... 175 9e-43
tr|B7G601|B7G601_PHATR CULlin protein 1 OS=Phaeodactylum tricorn... 128 1e-28

>tr|A9T066|A9T066_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_167405 PE=3 SV=1
Length = 743

Score = 259 bits (662), Expect = 5e-68
Identities = 131/147 (89%), Positives = 138/147 (93%)
Frame = +3

Query: 3 IANIFKKHVTDEGMALVKQAEDAASNKKAEKKDLIGGSDQAFVRNVIELHDKYLQYVSEC 182
+A IFK HVT+EG ALVKQAEDAA NKKAEKKD +G +QAFVR VIELHDKYLQYVSEC
Sbjct: 302 VAAIFKLHVTEEGTALVKQAEDAAGNKKAEKKDTVGVQEQAFVRKVIELHDKYLQYVSEC 361

Query: 183 FVHNSLFHKALKEAFEVFCNKGVGGSSSAELLATFCDNLLKKGGSEKLSDEAIEDTLEKV 362
FV++SLFHKALKEAFEVFCNKGV GS+SAELLATFCDNLLKKGGSEKLSDEAIEDTLEKV
Sbjct: 362 FVNHSLFHKALKEAFEVFCNKGVAGSTSAELLATFCDNLLKKGGSEKLSDEAIEDTLEKV 421

Query: 363 VKLLAYISDKDLFAEFYRKKLARRLLF 443
VKLLAYISDKDLFAEFYRKKLARRLLF
Sbjct: 422 VKLLAYISDKDLFAEFYRKKLARRLLF 448


>tr|A9T788|A9T788_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192315 PE=3 SV=1
Length = 743

Score = 257 bits (657), Expect = 2e-67
Identities = 128/147 (87%), Positives = 140/147 (95%)
Frame = +3

Query: 3 IANIFKKHVTDEGMALVKQAEDAASNKKAEKKDLIGGSDQAFVRNVIELHDKYLQYVSEC 182
+A IF++HVT EG ALVKQAEDAASNKKAE+KD++G +QAFVR VIELHDKYLQYVS+C
Sbjct: 302 VAAIFREHVTGEGTALVKQAEDAASNKKAERKDIVGVQEQAFVRKVIELHDKYLQYVSDC 361

Query: 183 FVHNSLFHKALKEAFEVFCNKGVGGSSSAELLATFCDNLLKKGGSEKLSDEAIEDTLEKV 362
F+++SLFHKALKEAFEVFCNKGV GS+SAELLATFCDNLLKKGGSEKLSDEAIEDTLEKV
Sbjct: 362 FLNHSLFHKALKEAFEVFCNKGVAGSTSAELLATFCDNLLKKGGSEKLSDEAIEDTLEKV 421

Query: 363 VKLLAYISDKDLFAEFYRKKLARRLLF 443
VKLLAYISDKDLFAEFYRKKLARRLLF
Sbjct: 422 VKLLAYISDKDLFAEFYRKKLARRLLF 448


>tr|A9T5R6|A9T5R6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_107536 PE=3 SV=1
Length = 745

Score = 257 bits (657), Expect = 2e-67
Identities = 128/147 (87%), Positives = 138/147 (93%)
Frame = +3

Query: 3 IANIFKKHVTDEGMALVKQAEDAASNKKAEKKDLIGGSDQAFVRNVIELHDKYLQYVSEC 182
+A+IFK+HVT+EG ALVKQAEDA SNK+AEKKD +G +Q FVR VIELHDKYLQYVSEC
Sbjct: 304 VASIFKQHVTEEGTALVKQAEDAVSNKRAEKKDTVGVQEQVFVRKVIELHDKYLQYVSEC 363

Query: 183 FVHNSLFHKALKEAFEVFCNKGVGGSSSAELLATFCDNLLKKGGSEKLSDEAIEDTLEKV 362
F ++SLFHKALKEAFEVFCNKGV GS+SAELLATFCDNLLKKGGSEKLSDEAIEDTLEKV
Sbjct: 364 FANHSLFHKALKEAFEVFCNKGVAGSTSAELLATFCDNLLKKGGSEKLSDEAIEDTLEKV 423

Query: 363 VKLLAYISDKDLFAEFYRKKLARRLLF 443
VKLLAYISDKDLFAEFYRKKLARRLLF
Sbjct: 424 VKLLAYISDKDLFAEFYRKKLARRLLF 450


>tr|B8LQB2|B8LQB2_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 744

Score = 253 bits (645), Expect = 4e-66
Identities = 125/147 (85%), Positives = 138/147 (93%)
Frame = +3

Query: 3 IANIFKKHVTDEGMALVKQAEDAASNKKAEKKDLIGGSDQAFVRNVIELHDKYLQYVSEC 182
++ IFK+HVT EG +LVK AEDAASNKKAEKKD++G +QAFVR VIELHDKYLQYV+EC
Sbjct: 303 VSLIFKQHVTGEGTSLVKHAEDAASNKKAEKKDVVGAQEQAFVRKVIELHDKYLQYVNEC 362

Query: 183 FVHNSLFHKALKEAFEVFCNKGVGGSSSAELLATFCDNLLKKGGSEKLSDEAIEDTLEKV 362
F+++SLFHKALKEAFEVFCNKGV GS+SAELLATFCDN+LKKGGSEKLSDE IEDTLEKV
Sbjct: 363 FMNHSLFHKALKEAFEVFCNKGVAGSTSAELLATFCDNILKKGGSEKLSDEDIEDTLEKV 422

Query: 363 VKLLAYISDKDLFAEFYRKKLARRLLF 443
VKLLAYISDKDLFAEFYRKKLARRLLF
Sbjct: 423 VKLLAYISDKDLFAEFYRKKLARRLLF 449


>tr|Q711G6|Q711G6_TOBAC Cullin 1C (Fragment) OS=Nicotiana tabacum
GN=cul1C PE=2 SV=1
Length = 447

Score = 249 bits (636), Expect = 5e-65
Identities = 124/147 (84%), Positives = 137/147 (93%)
Frame = +3

Query: 3 IANIFKKHVTDEGMALVKQAEDAASNKKAEKKDLIGGSDQAFVRNVIELHDKYLQYVSEC 182
+A+IFK+HVT EG ALVKQAEDAASNKKAEK+D++G +Q FVR VIELHDKYL YV+ C
Sbjct: 6 VASIFKQHVTAEGTALVKQAEDAASNKKAEKRDVVGLQEQVFVRKVIELHDKYLAYVNNC 65

Query: 183 FVHNSLFHKALKEAFEVFCNKGVGGSSSAELLATFCDNLLKKGGSEKLSDEAIEDTLEKV 362
F +++LFHKALKEAFEVFCNKGV GSSSAELLATFCDN+LKKGGSEKLSDEAIE+TLEKV
Sbjct: 66 FQNHTLFHKALKEAFEVFCNKGVAGSSSAELLATFCDNILKKGGSEKLSDEAIEETLEKV 125

Query: 363 VKLLAYISDKDLFAEFYRKKLARRLLF 443
VKLLAYISDKDLFAEFYRKKLARRLLF
Sbjct: 126 VKLLAYISDKDLFAEFYRKKLARRLLF 152


>tr|A7NW32|A7NW32_VITVI Chromosome chr5 scaffold_2, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00019763001
PE=3 SV=1
Length = 744

Score = 249 bits (636), Expect = 5e-65
Identities = 123/147 (83%), Positives = 138/147 (93%)
Frame = +3

Query: 3 IANIFKKHVTDEGMALVKQAEDAASNKKAEKKDLIGGSDQAFVRNVIELHDKYLQYVSEC 182
++NIFK+HVT EG ALVKQAEDAASNKKA+K+D++G +Q FVR VIELHDKYL YV++C
Sbjct: 303 VSNIFKQHVTAEGTALVKQAEDAASNKKADKRDVVGLQEQVFVRKVIELHDKYLAYVNDC 362

Query: 183 FVHNSLFHKALKEAFEVFCNKGVGGSSSAELLATFCDNLLKKGGSEKLSDEAIEDTLEKV 362
F +++LFHKALKEAFEVFCNKGV GSSSAELLATFCDN+LKKGGSEKLSDEAIE+TLEKV
Sbjct: 363 FNNHTLFHKALKEAFEVFCNKGVAGSSSAELLATFCDNILKKGGSEKLSDEAIEETLEKV 422

Query: 363 VKLLAYISDKDLFAEFYRKKLARRLLF 443
VKLLAYISDKDLFAEFYRKKLARRLLF
Sbjct: 423 VKLLAYISDKDLFAEFYRKKLARRLLF 449


>tr|Q94I77|Q94I77_ORYSA Putative cullin OS=Oryza sativa
GN=OSJNBa0010P20.16 PE=3 SV=1
Length = 750

Score = 245 bits (626), Expect = 7e-64
Identities = 120/147 (81%), Positives = 136/147 (92%)
Frame = +3

Query: 3 IANIFKKHVTDEGMALVKQAEDAASNKKAEKKDLIGGSDQAFVRNVIELHDKYLQYVSEC 182
++ IFK+HVT+EG ALVKQAEDAASNKK EKK+++G +Q FVR +IELHDKY+ YV++C
Sbjct: 309 VSQIFKQHVTNEGTALVKQAEDAASNKKPEKKEIVGLQEQVFVRKIIELHDKYVAYVTDC 368

Query: 183 FVHNSLFHKALKEAFEVFCNKGVGGSSSAELLATFCDNLLKKGGSEKLSDEAIEDTLEKV 362
F ++LFHKALKEAFEVFCNKGV GSSSAELLATFCDN+LKKGGSEKLSDEAIEDTLEKV
Sbjct: 369 FQGHTLFHKALKEAFEVFCNKGVSGSSSAELLATFCDNILKKGGSEKLSDEAIEDTLEKV 428

Query: 363 VKLLAYISDKDLFAEFYRKKLARRLLF 443
V+LLAYISDKDLFAEFYRKKLARRLLF
Sbjct: 429 VRLLAYISDKDLFAEFYRKKLARRLLF 455


>tr|Q5ZC88|Q5ZC88_ORYSJ cDNA clone:001-033-G02, full insert sequence
OS=Oryza sativa subsp. japonica GN=P0043B10.31 PE=2 SV=1
Length = 744

Score = 245 bits (626), Expect = 7e-64
Identities = 120/147 (81%), Positives = 136/147 (92%)
Frame = +3

Query: 3 IANIFKKHVTDEGMALVKQAEDAASNKKAEKKDLIGGSDQAFVRNVIELHDKYLQYVSEC 182
++ IFK+HVT+EG ALVKQAEDAASNKK EKK+++G +Q FVR +IELHDKY+ YV++C
Sbjct: 303 VSQIFKQHVTNEGTALVKQAEDAASNKKPEKKEIVGLQEQVFVRKIIELHDKYVAYVTDC 362

Query: 183 FVHNSLFHKALKEAFEVFCNKGVGGSSSAELLATFCDNLLKKGGSEKLSDEAIEDTLEKV 362
F ++LFHKALKEAFEVFCNKGV GSSSAELLATFCDN+LKKGGSEKLSDEAIEDTLEKV
Sbjct: 363 FQGHTLFHKALKEAFEVFCNKGVSGSSSAELLATFCDNILKKGGSEKLSDEAIEDTLEKV 422

Query: 363 VKLLAYISDKDLFAEFYRKKLARRLLF 443
V+LLAYISDKDLFAEFYRKKLARRLLF
Sbjct: 423 VRLLAYISDKDLFAEFYRKKLARRLLF 449


>tr|B8A885|B8A885_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_01951 PE=4 SV=1
Length = 711

Score = 245 bits (626), Expect = 7e-64
Identities = 120/147 (81%), Positives = 136/147 (92%)
Frame = +3

Query: 3 IANIFKKHVTDEGMALVKQAEDAASNKKAEKKDLIGGSDQAFVRNVIELHDKYLQYVSEC 182
++ IFK+HVT+EG ALVKQAEDAASNKK EKK+++G +Q FVR +IELHDKY+ YV++C
Sbjct: 270 VSQIFKQHVTNEGTALVKQAEDAASNKKPEKKEIVGLQEQVFVRKIIELHDKYVAYVTDC 329

Query: 183 FVHNSLFHKALKEAFEVFCNKGVGGSSSAELLATFCDNLLKKGGSEKLSDEAIEDTLEKV 362
F ++LFHKALKEAFEVFCNKGV GSSSAELLATFCDN+LKKGGSEKLSDEAIEDTLEKV
Sbjct: 330 FQGHTLFHKALKEAFEVFCNKGVSGSSSAELLATFCDNILKKGGSEKLSDEAIEDTLEKV 389

Query: 363 VKLLAYISDKDLFAEFYRKKLARRLLF 443
V+LLAYISDKDLFAEFYRKKLARRLLF
Sbjct: 390 VRLLAYISDKDLFAEFYRKKLARRLLF 416


>tr|A2ZT67|A2ZT67_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_001739 PE=3 SV=1
Length = 750

Score = 245 bits (626), Expect = 7e-64
Identities = 120/147 (81%), Positives = 136/147 (92%)
Frame = +3

Query: 3 IANIFKKHVTDEGMALVKQAEDAASNKKAEKKDLIGGSDQAFVRNVIELHDKYLQYVSEC 182
++ IFK+HVT+EG ALVKQAEDAASNKK EKK+++G +Q FVR +IELHDKY+ YV++C
Sbjct: 309 VSQIFKQHVTNEGTALVKQAEDAASNKKPEKKEIVGLQEQVFVRKIIELHDKYVAYVTDC 368

Query: 183 FVHNSLFHKALKEAFEVFCNKGVGGSSSAELLATFCDNLLKKGGSEKLSDEAIEDTLEKV 362
F ++LFHKALKEAFEVFCNKGV GSSSAELLATFCDN+LKKGGSEKLSDEAIEDTLEKV
Sbjct: 369 FQGHTLFHKALKEAFEVFCNKGVSGSSSAELLATFCDNILKKGGSEKLSDEAIEDTLEKV 428

Query: 363 VKLLAYISDKDLFAEFYRKKLARRLLF 443
V+LLAYISDKDLFAEFYRKKLARRLLF
Sbjct: 429 VRLLAYISDKDLFAEFYRKKLARRLLF 455