DK955516
Clone id TST39A01NGRL0023_E23
Library
Length 566
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_E23. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
GAATACATTGCTCCCCTCCTACACGTCCCTTTCCAATGCTTGCATACTTCTGTTCCTCAT
TCAATCTCTGGATCGGATTGCTCAATGTCTTGTATGTGCGTGAATTAAAATTAAAAAGAT
TAAGCCTGTTCCAAAAGTTGAGTCACTATACACAGGCTATCTGGAGCAGGCATTTTGCAA
GCTATCCAATGGTGCTGATTCAGATACCCATGTGTAATGAGAAAGAGGTTTACCAGCAGT
CTATTGGGGCAGTTGCAACAGATGAACTGGCCACGGTATACAACGTTGGAGCAAATTTTG
GATGATTCGGACGACAAAGAAACACAATCATTGATAAGGGCGGAGGTGCAGAAGTGGCAT
CAAATAGGGCTCAGGATTTTGTACAGGCATCGTACCCTTCGAACAGGATACAAGGCAGGA
AATCTGAAGTCTGCAATGAGCTGTGACTATGTCCGGGATTATGAATTTTGTGGCCATTTT
TTGATGCCGATTTTTCAGCCTCAGCCCAGACTTTCTCAAGCGAACTATCATCCCTTTTTA
GGAGAATGATGAACTAAGCTTGGTGC
■■Homology search results ■■ -
sp_hit_id Q69L19
Definition sp|Q69L19|CSLC2_ORYSJ Probable xyloglucan glycosyltransferase 2 OS=Oryza sativa subsp. japonica
Align length 83
Score (bit) 108.0
E-value 7.0e-36
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955516|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0023_E23, 5'
(566 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q69L19|CSLC2_ORYSJ Probable xyloglucan glycosyltransferase 2 ... 108 7e-36
sp|Q7PC70|CSLC2_ORYSI Probable xyloglucan glycosyltransferase 2 ... 108 7e-36
sp|Q9SB75|CSLC5_ARATH Probable xyloglucan glycosyltransferase 5 ... 104 2e-35
sp|Q9SJA2|CSLC8_ARATH Probable xyloglucan glycosyltransferase 8 ... 103 6e-31
sp|Q9SRT3|CSLC6_ARATH Probable xyloglucan glycosyltransferase 6 ... 108 1e-30
sp|Q6AU53|CSLC9_ORYSJ Probable xyloglucan glycosyltransferase 9 ... 110 4e-29
sp|Q7PC69|CSLC3_ORYSJ Probable xyloglucan glycosyltransferase 3 ... 113 1e-28
sp|Q9ZQB9|CSLCC_ARATH Probable xyloglucan glycosyltransferase 12... 104 9e-28
sp|Q6L538|CSLC7_ORYSJ Probable xyloglucan glycosyltransferase 7 ... 105 9e-28
sp|Q9LJP4|CSLC4_ARATH Xyloglucan glycosyltransferase 4 OS=Arabid... 103 1e-26
sp|Q84Z01|CSLCA_ORYSJ Putative xyloglucan glycosyltransferase 10... 110 6e-24
sp|A2YHR9|CSLCA_ORYSI Putative xyloglucan glycosyltransferase 10... 110 6e-24
sp|Q8LIY0|CSLC1_ORYSJ Probable xyloglucan glycosyltransferase 1 ... 107 3e-23
sp|Q7PC76|CSLA1_ORYSJ Glucomannan 4-beta-mannosyltransferase 1 O... 66 3e-17
sp|Q67VS7|CSLA9_ORYSJ Probable mannan synthase 9 OS=Oryza sativa... 66 4e-17
sp|Q7XIF5|CSLA7_ORYSJ Probable mannan synthase 7 OS=Oryza sativa... 69 5e-17
sp|Q7PC73|CSLA5_ORYSJ Probable mannan synthase 5 OS=Oryza sativa... 64 9e-17
sp|Q6YWK8|CSLAB_ORYSJ Probable mannan synthase 11 OS=Oryza sativ... 65 9e-17
sp|Q9LZR3|CSLA9_ARATH Glucomannan 4-beta-mannosyltransferase 9 O... 58 2e-15
sp|Q67X45|CSLA3_ORYSJ Probable mannan synthase 3 OS=Oryza sativa... 60 3e-15
sp|Q9FNI7|CSLA2_ARATH Glucomannan 4-beta-mannosyltransferase 2 O... 62 3e-15
sp|Q9T0L2|CSLAF_ARATH Probable mannan synthase 15 OS=Arabidopsis... 60 4e-15
sp|Q84W54|CSLA1_ARATH Probable mannan synthase 1 OS=Arabidopsis ... 58 6e-15
sp|Q9LF09|CSLAB_ARATH Probable mannan synthase 11 OS=Arabidopsis... 56 4e-13
sp|Q9LQC9|CSLA3_ARATH Probable mannan synthase 3 OS=Arabidopsis ... 68 4e-11
sp|Q6Z2T9|CSLA6_ORYSJ Probable mannan synthase 6 OS=Oryza sativa... 67 6e-11
sp|Q6UDF0|CSLA1_CYATE Mannan synthase 1 OS=Cyamopsis tetragonolo... 65 2e-10
sp|Q9LR87|CSLAA_ARATH Probable mannan synthase 10 OS=Arabidopsis... 61 3e-09
sp|Q9ZQN8|CSLA7_ARATH Probable mannan synthase 7 OS=Arabidopsis ... 60 6e-09
sp|Q84W06|CSLAE_ARATH Probable mannan synthase 14 OS=Arabidopsis... 59 2e-08

>sp|Q69L19|CSLC2_ORYSJ Probable xyloglucan glycosyltransferase 2
OS=Oryza sativa subsp. japonica GN=CSLC2 PE=2 SV=2
Length = 698

Score = 108 bits (270), Expect(3) = 7e-36
Identities = 53/83 (63%), Positives = 61/83 (73%)
Frame = +1

Query: 259 QMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYRHRTLRTGYKAGNLKSAM 438
Q++WPR L Q+LDDS D+ Q LI+AEV KW G+ I+YRHR LRTGYKAGNLKSAM
Sbjct: 257 QLDWPREKFLIQVLDDSSDESIQLLIKAEVSKWSHQGVNIVYRHRVLRTGYKAGNLKSAM 316

Query: 439 SCDYVRDYEFCGHFLMPIFQPQP 507
SCDYV+DYEF F FQP P
Sbjct: 317 SCDYVKDYEFVAIFDAD-FQPTP 338



Score = 45.4 bits (106), Expect(3) = 7e-36
Identities = 19/23 (82%), Positives = 22/23 (95%)
Frame = +3

Query: 183 YPMVLIQIPMCNEKEVYQQSIGA 251
+PMVL+QIPMCNEKEVY+QSI A
Sbjct: 232 HPMVLVQIPMCNEKEVYEQSISA 254



Score = 37.4 bits (85), Expect(3) = 7e-36
Identities = 16/23 (69%), Positives = 19/23 (82%)
Frame = +2

Query: 29 LSNACILLFLIQSLDRIAQCLVC 97
LS ACILLF+IQS+DR+ CL C
Sbjct: 185 LSKACILLFVIQSMDRLVLCLGC 207



Score = 30.0 bits (66), Expect = 8.3
Identities = 19/33 (57%), Positives = 21/33 (63%)
Frame = +2

Query: 467 FVAIF*CRFFSLSPDFLKRTIIPF*ENDELSLV 565
FVAIF F +PDFLK+TI F N EL LV
Sbjct: 326 FVAIFDADF-QPTPDFLKKTIPHFEGNPELGLV 357


>sp|Q7PC70|CSLC2_ORYSI Probable xyloglucan glycosyltransferase 2
OS=Oryza sativa subsp. indica GN=CSLC2 PE=2 SV=1
Length = 698

Score = 108 bits (270), Expect(3) = 7e-36
Identities = 53/83 (63%), Positives = 61/83 (73%)
Frame = +1

Query: 259 QMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYRHRTLRTGYKAGNLKSAM 438
Q++WPR L Q+LDDS D+ Q LI+AEV KW G+ I+YRHR LRTGYKAGNLKSAM
Sbjct: 257 QLDWPREKFLIQVLDDSSDESIQLLIKAEVSKWSHQGVNIVYRHRVLRTGYKAGNLKSAM 316

Query: 439 SCDYVRDYEFCGHFLMPIFQPQP 507
SCDYV+DYEF F FQP P
Sbjct: 317 SCDYVKDYEFVAIFDAD-FQPTP 338



Score = 45.4 bits (106), Expect(3) = 7e-36
Identities = 19/23 (82%), Positives = 22/23 (95%)
Frame = +3

Query: 183 YPMVLIQIPMCNEKEVYQQSIGA 251
+PMVL+QIPMCNEKEVY+QSI A
Sbjct: 232 HPMVLVQIPMCNEKEVYEQSISA 254



Score = 37.4 bits (85), Expect(3) = 7e-36
Identities = 16/23 (69%), Positives = 19/23 (82%)
Frame = +2

Query: 29 LSNACILLFLIQSLDRIAQCLVC 97
LS ACILLF+IQS+DR+ CL C
Sbjct: 185 LSKACILLFVIQSMDRLVLCLGC 207



Score = 30.0 bits (66), Expect = 8.3
Identities = 19/33 (57%), Positives = 21/33 (63%)
Frame = +2

Query: 467 FVAIF*CRFFSLSPDFLKRTIIPF*ENDELSLV 565
FVAIF F +PDFLK+TI F N EL LV
Sbjct: 326 FVAIFDADF-QPTPDFLKKTIPHFEGNPELGLV 357


>sp|Q9SB75|CSLC5_ARATH Probable xyloglucan glycosyltransferase 5
OS=Arabidopsis thaliana GN=CSLC5 PE=2 SV=1
Length = 692

Score = 104 bits (259), Expect(3) = 2e-35
Identities = 50/83 (60%), Positives = 61/83 (73%)
Frame = +1

Query: 259 QMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYRHRTLRTGYKAGNLKSAM 438
Q++WP+ L Q+LDDS+D+ Q LI+AEV KW Q G+ I+YRHR +RTGYKAGNLKSAM
Sbjct: 251 QLDWPKDRILVQVLDDSNDESIQQLIKAEVAKWSQKGVNIIYRHRLVRTGYKAGNLKSAM 310

Query: 439 SCDYVRDYEFCGHFLMPIFQPQP 507
SCDYV YE+ F FQP P
Sbjct: 311 SCDYVEAYEYVAIFDAD-FQPTP 332



Score = 48.1 bits (113), Expect(3) = 2e-35
Identities = 20/26 (76%), Positives = 24/26 (92%)
Frame = +3

Query: 177 ASYPMVLIQIPMCNEKEVYQQSIGAV 254
+ YPMVL+QIPMCNE+EVY+QSI AV
Sbjct: 224 SEYPMVLVQIPMCNEREVYEQSISAV 249



Score = 37.0 bits (84), Expect(3) = 2e-35
Identities = 16/30 (53%), Positives = 21/30 (70%)
Frame = +2

Query: 8 LLPSYTSLSNACILLFLIQSLDRIAQCLVC 97
+ P +LS CI+LFLIQS+DR+ CL C
Sbjct: 168 IAPPIKALSKFCIVLFLIQSVDRLVLCLGC 197


>sp|Q9SJA2|CSLC8_ARATH Probable xyloglucan glycosyltransferase 8
OS=Arabidopsis thaliana GN=CSLC8 PE=2 SV=1
Length = 690

Score = 103 bits (258), Expect(2) = 6e-31
Identities = 48/74 (64%), Positives = 56/74 (75%)
Frame = +1

Query: 259 QMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYRHRTLRTGYKAGNLKSAM 438
Q++WP+ L Q+LDDSDD+ Q LIR EV KW Q G+ I+YRHR +RTGYKAGNLKSAM
Sbjct: 251 QLDWPKDRLLVQVLDDSDDESIQELIRDEVTKWSQKGVNIIYRHRLVRTGYKAGNLKSAM 310

Query: 439 SCDYVRDYEFCGHF 480
SCDYV YEF F
Sbjct: 311 SCDYVEAYEFVAIF 324



Score = 50.4 bits (119), Expect(2) = 6e-31
Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 3/86 (3%)
Frame = +3

Query: 6 HCSPPTRP---FPMLAYFCSSFNLWIGLLNVLYVRELKLKRLSLFQKLSHYTQAIWSRHF 176
+ +PP + F ++ + S + I L L++ K K++ H+ +
Sbjct: 167 YIAPPIKALSKFCIVLFLVQSVDRLILCLGCLWI---KFKKIKPRIDEEHFRNDDFEGSG 223

Query: 177 ASYPMVLIQIPMCNEKEVYQQSIGAV 254
+ YPMVL+QIPMCNE+EVY+QSI AV
Sbjct: 224 SEYPMVLVQIPMCNEREVYEQSISAV 249


>sp|Q9SRT3|CSLC6_ARATH Probable xyloglucan glycosyltransferase 6
OS=Arabidopsis thaliana GN=CSLC6 PE=1 SV=1
Length = 682

Score = 108 bits (271), Expect(3) = 1e-30
Identities = 53/110 (48%), Positives = 72/110 (65%), Gaps = 1/110 (0%)
Frame = +1

Query: 154 RLSGAGI-LQAIQWC*FRYPCVMRKRFTSSLLGQLQQMNWPRYTTLEQILDDSDDKETQS 330
+L G G+ L+ + P K +G + ++WPR L Q+LDDS + + Q
Sbjct: 209 KLVGEGVRLEDYPMVIVQIPMCNEKEVYQQSIGAVCMLDWPRERMLVQVLDDSSELDVQQ 268

Query: 331 LIRAEVQKWHQIGLRILYRHRTLRTGYKAGNLKSAMSCDYVRDYEFCGHF 480
LI+AEVQKW Q G+RI+YRHR +RTGYKAGNLK+AM+C+YV+DYEF F
Sbjct: 269 LIKAEVQKWQQRGVRIVYRHRLIRTGYKAGNLKAAMNCEYVKDYEFVAIF 318



Score = 37.0 bits (84), Expect(3) = 1e-30
Identities = 17/30 (56%), Positives = 21/30 (70%)
Frame = +2

Query: 8 LLPSYTSLSNACILLFLIQSLDRIAQCLVC 97
L P SL+N CI+LFLIQS+DR+ L C
Sbjct: 161 LAPPLQSLTNVCIVLFLIQSVDRLVLVLGC 190



Score = 27.3 bits (59), Expect(3) = 1e-30
Identities = 17/33 (51%), Positives = 21/33 (63%)
Frame = +2

Query: 467 FVAIF*CRFFSLSPDFLKRTIIPF*ENDELSLV 565
FVAIF F DFLK+T+ F N+EL+LV
Sbjct: 314 FVAIFDADF-QPPADFLKKTVPHFKGNEELALV 345


>sp|Q6AU53|CSLC9_ORYSJ Probable xyloglucan glycosyltransferase 9
OS=Oryza sativa subsp. japonica GN=CSLC9 PE=2 SV=2
Length = 595

Score = 110 bits (275), Expect(2) = 4e-29
Identities = 56/100 (56%), Positives = 64/100 (64%)
Frame = +1

Query: 208 PCVMRKRFTSSLLGQLQQMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYR 387
P K + + ++WPR L Q+LDDSDD TQ+LIR EV KW Q G RI+YR
Sbjct: 145 PMCNEKEVYQQSIAAVCNLDWPRSNFLVQVLDDSDDPTTQTLIREEVLKWQQNGARIVYR 204

Query: 388 HRTLRTGYKAGNLKSAMSCDYVRDYEFCGHFLMPIFQPQP 507
HR LR GYKAGNLKSAMSC YV+DYEF F FQP P
Sbjct: 205 HRVLRDGYKAGNLKSAMSCSYVKDYEFVAIFDAD-FQPNP 243



Score = 37.7 bits (86), Expect(2) = 4e-29
Identities = 16/28 (57%), Positives = 21/28 (75%)
Frame = +2

Query: 14 PSYTSLSNACILLFLIQSLDRIAQCLVC 97
P L++AC++LFLIQS DR+ QCL C
Sbjct: 82 PFIQFLTDACVVLFLIQSADRLIQCLGC 109



Score = 50.8 bits (120), Expect = 5e-06
Identities = 23/26 (88%), Positives = 24/26 (92%)
Frame = +3

Query: 177 ASYPMVLIQIPMCNEKEVYQQSIGAV 254
A YPMVL+QIPMCNEKEVYQQSI AV
Sbjct: 135 AYYPMVLVQIPMCNEKEVYQQSIAAV 160



Score = 35.0 bits (79), Expect = 0.26
Identities = 20/33 (60%), Positives = 23/33 (69%)
Frame = +2

Query: 467 FVAIF*CRFFSLSPDFLKRTIIPF*ENDELSLV 565
FVAIF F +PDFLKRT+ F +NDEL LV
Sbjct: 231 FVAIFDADF-QPNPDFLKRTVPHFKDNDELGLV 262


>sp|Q7PC69|CSLC3_ORYSJ Probable xyloglucan glycosyltransferase 3
OS=Oryza sativa subsp. japonica GN=CSLC3 PE=2 SV=1
Length = 745

Score = 113 bits (283), Expect(2) = 1e-28
Identities = 59/112 (52%), Positives = 70/112 (62%)
Frame = +1

Query: 208 PCVMRKRFTSSLLGQLQQMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYR 387
P K + + + Q++WPR L Q+LDDSDD+ Q LI+AEV KW Q G+ I+YR
Sbjct: 268 PMCNEKEVYETSISHVCQIDWPRERMLVQVLDDSDDETCQMLIKAEVTKWSQRGVNIIYR 327

Query: 388 HRTLRTGYKAGNLKSAMSCDYVRDYEFCGHFLMPIFQPQPRLSQANYHPFLG 543
HR RTGYKAGNLKSAMSCDYVRDYEF F FQP P + F G
Sbjct: 328 HRLNRTGYKAGNLKSAMSCDYVRDYEFVAIFDAD-FQPNPDFLKLTVPHFKG 378



Score = 32.7 bits (73), Expect(2) = 1e-28
Identities = 13/23 (56%), Positives = 17/23 (73%)
Frame = +2

Query: 29 LSNACILLFLIQSLDRIAQCLVC 97
LS CI LF++QS+DR+ CL C
Sbjct: 206 LSGFCIALFMVQSVDRLVLCLGC 228



Score = 42.0 bits (97), Expect = 0.002
Identities = 18/24 (75%), Positives = 21/24 (87%)
Frame = +3

Query: 183 YPMVLIQIPMCNEKEVYQQSIGAV 254
+PMVLIQ+PMCNEKEVY+ SI V
Sbjct: 260 FPMVLIQMPMCNEKEVYETSISHV 283


>sp|Q9ZQB9|CSLCC_ARATH Probable xyloglucan glycosyltransferase 12
OS=Arabidopsis thaliana GN=CSLC12 PE=1 SV=1
Length = 699

Score = 104 bits (260), Expect(2) = 9e-28
Identities = 53/100 (53%), Positives = 64/100 (64%)
Frame = +1

Query: 208 PCVMRKRFTSSLLGQLQQMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYR 387
P K + + ++WP+ L QILDDSDD TQSLI+ EV KW ++G RI+YR
Sbjct: 248 PMCNEKEVYQQSIAAVCNLDWPKGKILIQILDDSDDPITQSLIKEEVHKWQKLGARIVYR 307

Query: 388 HRTLRTGYKAGNLKSAMSCDYVRDYEFCGHFLMPIFQPQP 507
HR R GYKAGNLKSAM+C YV+DYEF F FQP P
Sbjct: 308 HRVNREGYKAGNLKSAMNCSYVKDYEFVAIFDAD-FQPLP 346



Score = 38.9 bits (89), Expect(2) = 9e-28
Identities = 17/30 (56%), Positives = 21/30 (70%)
Frame = +2

Query: 8 LLPSYTSLSNACILLFLIQSLDRIAQCLVC 97
L P L+N CI+LFL+QSLDR+ CL C
Sbjct: 182 LAPPLQFLANGCIVLFLVQSLDRLILCLGC 211



Score = 47.8 bits (112), Expect = 4e-05
Identities = 22/26 (84%), Positives = 23/26 (88%)
Frame = +3

Query: 177 ASYPMVLIQIPMCNEKEVYQQSIGAV 254
A PMVL+QIPMCNEKEVYQQSI AV
Sbjct: 238 AFLPMVLVQIPMCNEKEVYQQSIAAV 263



Score = 32.7 bits (73), Expect = 1.3
Identities = 19/33 (57%), Positives = 23/33 (69%)
Frame = +2

Query: 467 FVAIF*CRFFSLSPDFLKRTIIPF*ENDELSLV 565
FVAIF F L PDFLK+TI F +N+E+ LV
Sbjct: 334 FVAIFDADFQPL-PDFLKKTIPHFKDNEEIGLV 365


>sp|Q6L538|CSLC7_ORYSJ Probable xyloglucan glycosyltransferase 7
OS=Oryza sativa subsp. japonica GN=CSLC7 PE=2 SV=1
Length = 688

Score = 105 bits (262), Expect(2) = 9e-28
Identities = 54/112 (48%), Positives = 73/112 (65%)
Frame = +1

Query: 211 CVMRKRFTSSLLGQLQQMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYRH 390
C R+ + S+ G + ++WP+ L Q+LDDSDD T +LI+ EV+KW + G+RI+YRH
Sbjct: 239 CNEREVYQQSI-GAVCNLDWPKSNFLVQVLDDSDDATTSALIKEEVEKWQREGVRIIYRH 297

Query: 391 RTLRTGYKAGNLKSAMSCDYVRDYEFCGHFLMPIFQPQPRLSQANYHPFLGE 546
R +R GYKAGNLKSAM+C YV+DYEF F FQPQ + F G+
Sbjct: 298 RVIRDGYKAGNLKSAMNCSYVKDYEFVVIFDAD-FQPQADFLKRTVPHFKGK 348



Score = 38.1 bits (87), Expect(2) = 9e-28
Identities = 15/30 (50%), Positives = 21/30 (70%)
Frame = +2

Query: 8 LLPSYTSLSNACILLFLIQSLDRIAQCLVC 97
L P L+NAC+ LF++QS+DR+ CL C
Sbjct: 171 LAPPLQFLTNACVALFMVQSIDRLVLCLGC 200



Score = 50.1 bits (118), Expect = 8e-06
Identities = 21/24 (87%), Positives = 24/24 (100%)
Frame = +3

Query: 183 YPMVLIQIPMCNEKEVYQQSIGAV 254
YPMVL+Q+PMCNE+EVYQQSIGAV
Sbjct: 229 YPMVLVQMPMCNEREVYQQSIGAV 252


>sp|Q9LJP4|CSLC4_ARATH Xyloglucan glycosyltransferase 4
OS=Arabidopsis thaliana GN=CSLC4 PE=2 SV=1
Length = 673

Score = 103 bits (256), Expect(2) = 1e-26
Identities = 54/111 (48%), Positives = 69/111 (62%)
Frame = +1

Query: 211 CVMRKRFTSSLLGQLQQMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYRH 390
C R+ + S+ G Q++WP+ L Q+LDDSDD Q LI+ EV W + G+ I+YRH
Sbjct: 208 CNEREVYEQSI-GAASQLDWPKDRILIQVLDDSDDPNLQLLIKEEVSVWAEKGVNIIYRH 266

Query: 391 RTLRTGYKAGNLKSAMSCDYVRDYEFCGHFLMPIFQPQPRLSQANYHPFLG 543
R +RTGYKAGNLKSAM+CDYV+DYEF F F P P + F G
Sbjct: 267 RLIRTGYKAGNLKSAMTCDYVKDYEFVTIFDAD-FTPNPDFLKKTVPHFKG 316



Score = 37.0 bits (84), Expect(2) = 1e-26
Identities = 17/30 (56%), Positives = 20/30 (66%)
Frame = +2

Query: 8 LLPSYTSLSNACILLFLIQSLDRIAQCLVC 97
+ P SLS C +LFLIQSLDR+ CL C
Sbjct: 144 IAPLVISLSRFCTVLFLIQSLDRLVLCLGC 173



Score = 49.7 bits (117), Expect = 1e-05
Identities = 21/27 (77%), Positives = 26/27 (96%)
Frame = +3

Query: 177 ASYPMVLIQIPMCNEKEVYQQSIGAVA 257
+S+PMVLIQIPMCNE+EVY+QSIGA +
Sbjct: 196 SSFPMVLIQIPMCNEREVYEQSIGAAS 222


tr_hit_id Q9M3I0
Definition tr|Q9M3I0|Q9M3I0_CICAR Putative glucosyltransferase (Fragment) OS=Cicer arietinum
Align length 83
Score (bit) 108.0
E-value 3.0e-35
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955516|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0023_E23, 5'
(566 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9M3I0|Q9M3I0_CICAR Putative glucosyltransferase (Fragment) O... 108 3e-35
tr|A7PVM1|A7PVM1_VITVI Chromosome chr9 scaffold_33, whole genome... 105 6e-34
tr|A9RKZ7|A9RKZ7_PHYPA Cellulose synthase-like C5, glycosyltrans... 107 8e-34
tr|A7NUD0|A7NUD0_VITVI Chromosome chr18 scaffold_1, whole genome... 102 1e-33
tr|Q09HS3|Q09HS3_PHYPA Cellulose synthase-like C1 OS=Physcomitre... 109 1e-33
tr|A9T4K1|A9T4K1_PHYPA Cellulose synthase-like C1, glycosyltrans... 109 1e-33
tr|A5AYF9|A5AYF9_VITVI Putative uncharacterized protein OS=Vitis... 103 1e-33
tr|A9TYJ5|A9TYJ5_PHYPA Cellulose synthase-like C4, glycosyltrans... 100 7e-32
tr|Q09HS1|Q09HS1_PHYPA Cellulose synthase-like C3 OS=Physcomitre... 100 3e-31
tr|A9T492|A9T492_PHYPA Cellulose synthase-like C3, glycosyltrans... 100 3e-31
tr|A5AQY0|A5AQY0_VITVI Putative uncharacterized protein OS=Vitis... 116 2e-30
tr|A7R208|A7R208_VITVI Chromosome undetermined scaffold_390, who... 116 2e-30
tr|A3AN34|A3AN34_ORYSJ Putative uncharacterized protein OS=Oryza... 110 4e-28
tr|B8AKJ4|B8AKJ4_ORYSI Putative uncharacterized protein OS=Oryza... 110 4e-28
tr|A3BR77|A3BR77_ORYSJ Putative uncharacterized protein OS=Oryza... 113 2e-27
tr|B8B8S5|B8B8S5_ORYSI Putative uncharacterized protein OS=Oryza... 113 2e-27
tr|A2Y6F0|A2Y6F0_ORYSI Putative uncharacterized protein OS=Oryza... 105 1e-26
tr|A5AGR2|A5AGR2_VITVI Putative uncharacterized protein OS=Vitis... 109 1e-26
tr|A7PME8|A7PME8_VITVI Chromosome chr14 scaffold_21, whole genom... 109 1e-26
tr|A5BPE5|A5BPE5_VITVI Putative uncharacterized protein (Chromos... 107 3e-26
tr|Q09HS2|Q09HS2_PHYPA Cellulose synthase-like C2 OS=Physcomitre... 105 4e-25
tr|A9RNK0|A9RNK0_PHYPA Cellulose synthase-like C2, glycosyltrans... 105 4e-25
tr|A9TG96|A9TG96_PHYPA Cellulose synthase-like C6, glycosyltrans... 102 6e-24
tr|A6N4C3|A6N4C3_PHYPA Cellulose synthase-like protein C4 OS=Phy... 102 6e-24
tr|A9SKW9|A9SKW9_PHYPA Cellulose synthase-like C7, glycosyltrans... 102 9e-24
tr|B4FVD7|B4FVD7_MAIZE Putative uncharacterized protein OS=Zea m... 111 3e-23
tr|B7F7S0|B7F7S0_ORYSJ cDNA clone:J033097L05, full insert sequen... 110 5e-23
tr|A3CA27|A3CA27_ORYSJ Putative uncharacterized protein OS=Oryza... 110 7e-23
tr|A2ZY67|A2ZY67_ORYSJ Putative uncharacterized protein OS=Oryza... 107 3e-22
tr|A2WVG0|A2WVG0_ORYSI Putative uncharacterized protein OS=Oryza... 107 3e-22

>tr|Q9M3I0|Q9M3I0_CICAR Putative glucosyltransferase (Fragment)
OS=Cicer arietinum PE=2 SV=1
Length = 589

Score = 108 bits (270), Expect(3) = 3e-35
Identities = 52/83 (62%), Positives = 63/83 (75%)
Frame = +1

Query: 259 QMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYRHRTLRTGYKAGNLKSAM 438
Q++WPR L Q+LDDS+D+ Q LI+AEV KW+Q G+ I+YRHR +RTGYKAGNL SAM
Sbjct: 148 QIDWPRDRLLIQVLDDSNDESIQWLIKAEVSKWNQKGINIIYRHRLVRTGYKAGNLNSAM 207

Query: 439 SCDYVRDYEFCGHFLMPIFQPQP 507
SCDYV+DYEF F FQP P
Sbjct: 208 SCDYVKDYEFVAIFDAD-FQPNP 229



Score = 48.1 bits (113), Expect(3) = 3e-35
Identities = 20/25 (80%), Positives = 24/25 (96%)
Frame = +3

Query: 180 SYPMVLIQIPMCNEKEVYQQSIGAV 254
+YPMVL+QIPMCNE+EVY+QSI AV
Sbjct: 122 NYPMVLVQIPMCNEREVYEQSISAV 146



Score = 35.8 bits (81), Expect(3) = 3e-35
Identities = 15/30 (50%), Positives = 21/30 (70%)
Frame = +2

Query: 8 LLPSYTSLSNACILLFLIQSLDRIAQCLVC 97
+ P +LS C++LFLIQS+DR+ CL C
Sbjct: 65 IAPPIQALSKFCVVLFLIQSVDRMLLCLGC 94


>tr|A7PVM1|A7PVM1_VITVI Chromosome chr9 scaffold_33, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00025276001
PE=4 SV=1
Length = 693

Score = 105 bits (261), Expect(3) = 6e-34
Identities = 50/83 (60%), Positives = 61/83 (73%)
Frame = +1

Query: 259 QMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYRHRTLRTGYKAGNLKSAM 438
Q++WP+ L Q+LDDSDD+ Q LI+ EV KW Q G+ I+YRHR +RTGYKAGNLKSAM
Sbjct: 253 QLDWPKDRLLIQVLDDSDDESIQWLIKGEVSKWSQKGINIIYRHRLVRTGYKAGNLKSAM 312

Query: 439 SCDYVRDYEFCGHFLMPIFQPQP 507
+CDYV+ YEF F FQP P
Sbjct: 313 NCDYVKAYEFVAIFDAD-FQPNP 334



Score = 47.8 bits (112), Expect(3) = 6e-34
Identities = 20/24 (83%), Positives = 23/24 (95%)
Frame = +3

Query: 183 YPMVLIQIPMCNEKEVYQQSIGAV 254
YPMVL+QIPMCNE+EVY+QSI AV
Sbjct: 228 YPMVLVQIPMCNEREVYEQSISAV 251



Score = 35.4 bits (80), Expect(3) = 6e-34
Identities = 16/30 (53%), Positives = 20/30 (66%)
Frame = +2

Query: 8 LLPSYTSLSNACILLFLIQSLDRIAQCLVC 97
+ PS LS+ C+ LFLIQS DR+ CL C
Sbjct: 170 IAPSIQVLSSFCVALFLIQSADRMLLCLGC 199


>tr|A9RKZ7|A9RKZ7_PHYPA Cellulose synthase-like C5,
glycosyltransferase family 2 OS=Physcomitrella patens
subsp. patens GN=cslC5 PE=4 SV=1
Length = 686

Score = 107 bits (268), Expect(3) = 8e-34
Identities = 54/98 (55%), Positives = 64/98 (65%), Gaps = 13/98 (13%)
Frame = +1

Query: 259 QMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYRHRTLRTGYKAGNLKSAM 438
Q++WP+ L Q+LDDSDD ETQ LI AEV KWH G+ I+YRHR RTGYKAGNL+SAM
Sbjct: 244 QIDWPKNRMLVQVLDDSDDVETQELIAAEVHKWHLKGVNIIYRHRENRTGYKAGNLRSAM 303

Query: 439 SCDYVRDYEFCGHF-------------LMPIFQPQPRL 513
C+YV+DYEF F MP F+ QP L
Sbjct: 304 ECEYVKDYEFVAIFDADFQPKSDFLKRSMPHFKGQPEL 341



Score = 48.1 bits (113), Expect(3) = 8e-34
Identities = 21/24 (87%), Positives = 23/24 (95%)
Frame = +3

Query: 183 YPMVLIQIPMCNEKEVYQQSIGAV 254
YPMVLIQIPMCNE+EVY+QSI AV
Sbjct: 219 YPMVLIQIPMCNEREVYEQSISAV 242



Score = 32.0 bits (71), Expect(3) = 8e-34
Identities = 13/28 (46%), Positives = 20/28 (71%)
Frame = +2

Query: 14 PSYTSLSNACILLFLIQSLDRIAQCLVC 97
P+ +++CI+LFL+QS DRI Q + C
Sbjct: 163 PALQLAADSCIVLFLVQSADRITQFMGC 190


>tr|A7NUD0|A7NUD0_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00014999001
PE=4 SV=1
Length = 699

Score = 102 bits (255), Expect(3) = 1e-33
Identities = 49/82 (59%), Positives = 59/82 (71%)
Frame = +1

Query: 262 MNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYRHRTLRTGYKAGNLKSAMS 441
++WP+ + L Q+LDDSDD TQ +I+ EV KW Q G ILYRHR +R GYKAGNLKSAM+
Sbjct: 266 LDWPKSSILIQVLDDSDDPVTQLMIKEEVTKWQQEGAHILYRHRVIRDGYKAGNLKSAMN 325

Query: 442 CDYVRDYEFCGHFLMPIFQPQP 507
C YV+DYEF F FQP P
Sbjct: 326 CSYVKDYEFVAIFDAD-FQPTP 346



Score = 44.7 bits (104), Expect(3) = 1e-33
Identities = 19/23 (82%), Positives = 21/23 (91%)
Frame = +3

Query: 183 YPMVLIQIPMCNEKEVYQQSIGA 251
+P VL+QIPMCNEKEVYQQSI A
Sbjct: 240 FPRVLVQIPMCNEKEVYQQSIAA 262



Score = 40.0 bits (92), Expect(3) = 1e-33
Identities = 18/30 (60%), Positives = 22/30 (73%)
Frame = +2

Query: 8 LLPSYTSLSNACILLFLIQSLDRIAQCLVC 97
L P L+NACI+LFLIQS+DR+ CL C
Sbjct: 184 LAPPLQFLANACIVLFLIQSVDRLVLCLGC 213



Score = 33.5 bits (75), Expect = 8.3
Identities = 19/33 (57%), Positives = 23/33 (69%)
Frame = +2

Query: 467 FVAIF*CRFFSLSPDFLKRTIIPF*ENDELSLV 565
FVAIF F +PDFLKRT+ F +N+EL LV
Sbjct: 334 FVAIFDADF-QPTPDFLKRTVPHFKDNEELGLV 365


>tr|Q09HS3|Q09HS3_PHYPA Cellulose synthase-like C1 OS=Physcomitrella
patens GN=CslC1 PE=2 SV=1
Length = 693

Score = 109 bits (272), Expect(3) = 1e-33
Identities = 56/98 (57%), Positives = 64/98 (65%), Gaps = 13/98 (13%)
Frame = +1

Query: 259 QMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYRHRTLRTGYKAGNLKSAM 438
Q++WPR L Q+LDDSDD ETQ LI AEV KW G+ I+YRHR RTGYKAGNL+SAM
Sbjct: 245 QIDWPRTRMLVQVLDDSDDVETQELIAAEVHKWQLKGVNIVYRHRENRTGYKAGNLRSAM 304

Query: 439 SCDYVRDYEFCGHF-------------LMPIFQPQPRL 513
CDYVRDYEF F MP F+ QP+L
Sbjct: 305 ECDYVRDYEFVAIFDADFQPKADFLKRSMPHFKDQPKL 342



Score = 48.1 bits (113), Expect(3) = 1e-33
Identities = 21/24 (87%), Positives = 23/24 (95%)
Frame = +3

Query: 183 YPMVLIQIPMCNEKEVYQQSIGAV 254
YPMVLIQIPMCNE+EVY+QSI AV
Sbjct: 220 YPMVLIQIPMCNEREVYEQSISAV 243



Score = 30.0 bits (66), Expect(3) = 1e-33
Identities = 13/24 (54%), Positives = 18/24 (75%)
Frame = +2

Query: 14 PSYTSLSNACILLFLIQSLDRIAQ 85
P+ +++CI+LFLIQS DRI Q
Sbjct: 164 PALQLAADSCIVLFLIQSADRITQ 187


>tr|A9T4K1|A9T4K1_PHYPA Cellulose synthase-like C1,
glycosyltransferase family 2 OS=Physcomitrella patens
subsp. patens GN=cslC1 PE=4 SV=1
Length = 693

Score = 109 bits (272), Expect(3) = 1e-33
Identities = 56/98 (57%), Positives = 64/98 (65%), Gaps = 13/98 (13%)
Frame = +1

Query: 259 QMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYRHRTLRTGYKAGNLKSAM 438
Q++WPR L Q+LDDSDD ETQ LI AEV KW G+ I+YRHR RTGYKAGNL+SAM
Sbjct: 245 QIDWPRTRMLVQVLDDSDDVETQELIAAEVHKWQLKGVNIVYRHRENRTGYKAGNLRSAM 304

Query: 439 SCDYVRDYEFCGHF-------------LMPIFQPQPRL 513
CDYVRDYEF F MP F+ QP+L
Sbjct: 305 ECDYVRDYEFVAIFDADFQPKADFLKRSMPHFKDQPKL 342



Score = 48.1 bits (113), Expect(3) = 1e-33
Identities = 21/24 (87%), Positives = 23/24 (95%)
Frame = +3

Query: 183 YPMVLIQIPMCNEKEVYQQSIGAV 254
YPMVLIQIPMCNE+EVY+QSI AV
Sbjct: 220 YPMVLIQIPMCNEREVYEQSISAV 243



Score = 30.0 bits (66), Expect(3) = 1e-33
Identities = 13/24 (54%), Positives = 18/24 (75%)
Frame = +2

Query: 14 PSYTSLSNACILLFLIQSLDRIAQ 85
P+ +++CI+LFLIQS DRI Q
Sbjct: 164 PALQLAADSCIVLFLIQSADRITQ 187


>tr|A5AYF9|A5AYF9_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_007479 PE=4 SV=1
Length = 661

Score = 103 bits (258), Expect(3) = 1e-33
Identities = 50/83 (60%), Positives = 60/83 (72%)
Frame = +1

Query: 259 QMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYRHRTLRTGYKAGNLKSAM 438
Q++WP+ L Q+LDDSDD+ Q LI+ EV KW Q G I+YRHR +RTGYKAGNLKSAM
Sbjct: 221 QLDWPKDRLLIQVLDDSDDESIQWLIKGEVSKWSQKGXNIIYRHRLVRTGYKAGNLKSAM 280

Query: 439 SCDYVRDYEFCGHFLMPIFQPQP 507
+CDYV+ YEF F FQP P
Sbjct: 281 NCDYVKAYEFVAIFDAD-FQPNP 302



Score = 47.8 bits (112), Expect(3) = 1e-33
Identities = 20/24 (83%), Positives = 23/24 (95%)
Frame = +3

Query: 183 YPMVLIQIPMCNEKEVYQQSIGAV 254
YPMVL+QIPMCNE+EVY+QSI AV
Sbjct: 196 YPMVLVQIPMCNEREVYEQSISAV 219



Score = 35.4 bits (80), Expect(3) = 1e-33
Identities = 16/30 (53%), Positives = 20/30 (66%)
Frame = +2

Query: 8 LLPSYTSLSNACILLFLIQSLDRIAQCLVC 97
+ PS LS+ C+ LFLIQS DR+ CL C
Sbjct: 138 IAPSIQVLSSFCVALFLIQSADRMLLCLGC 167


>tr|A9TYJ5|A9TYJ5_PHYPA Cellulose synthase-like C4,
glycosyltransferase family 2 OS=Physcomitrella patens
subsp. patens GN=cslC4 PE=4 SV=1
Length = 695

Score = 100 bits (250), Expect(3) = 7e-32
Identities = 49/83 (59%), Positives = 59/83 (71%)
Frame = +1

Query: 259 QMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYRHRTLRTGYKAGNLKSAM 438
Q++WP+ L Q+LDDS D ET+ LI+ EV KW Q G I YRHR RTGYKAGN+KSAM
Sbjct: 248 QLDWPQSRILIQVLDDSSDVETRFLIKGEVNKWQQKGANIKYRHRPDRTGYKAGNMKSAM 307

Query: 439 SCDYVRDYEFCGHFLMPIFQPQP 507
CDYV++YEF F FQP+P
Sbjct: 308 QCDYVKNYEFVAIFDAD-FQPKP 329



Score = 45.8 bits (107), Expect(3) = 7e-32
Identities = 19/24 (79%), Positives = 23/24 (95%)
Frame = +3

Query: 183 YPMVLIQIPMCNEKEVYQQSIGAV 254
+PMVL+QIPMCNE+EVY+QSI AV
Sbjct: 223 HPMVLVQIPMCNEREVYEQSIAAV 246



Score = 34.7 bits (78), Expect(3) = 7e-32
Identities = 17/32 (53%), Positives = 21/32 (65%)
Frame = +2

Query: 2 NTLLPSYTSLSNACILLFLIQSLDRIAQCLVC 97
N + P+ L+N CI LFLIQS+DRI L C
Sbjct: 163 NYIAPALQKLTNFCIGLFLIQSVDRIVLFLGC 194


>tr|Q09HS1|Q09HS1_PHYPA Cellulose synthase-like C3 OS=Physcomitrella
patens GN=CslC3 PE=2 SV=1
Length = 693

Score = 100 bits (250), Expect(3) = 3e-31
Identities = 48/82 (58%), Positives = 60/82 (73%)
Frame = +1

Query: 259 QMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYRHRTLRTGYKAGNLKSAM 438
Q++WP+ L Q+LDDS D ET+ LI++EV KW Q G+ I+YRHR RTGYKAGN+KSAM
Sbjct: 247 QLDWPKSRILIQVLDDSSDVETRFLIKSEVSKWQQKGVNIVYRHRVNRTGYKAGNMKSAM 306

Query: 439 SCDYVRDYEFCGHFLMPIFQPQ 504
CDYV+ YEF F FQP+
Sbjct: 307 QCDYVKKYEFVAIFDAD-FQPK 327



Score = 46.2 bits (108), Expect(3) = 3e-31
Identities = 19/26 (73%), Positives = 24/26 (92%)
Frame = +3

Query: 177 ASYPMVLIQIPMCNEKEVYQQSIGAV 254
+ +PMVL+QIPMCNE+EVY+QSI AV
Sbjct: 220 SGHPMVLVQIPMCNEREVYEQSISAV 245



Score = 32.0 bits (71), Expect(3) = 3e-31
Identities = 15/30 (50%), Positives = 20/30 (66%)
Frame = +2

Query: 8 LLPSYTSLSNACILLFLIQSLDRIAQCLVC 97
+ P+ L++ CI LFLIQS+DRI L C
Sbjct: 164 IAPTLQKLTDFCIWLFLIQSVDRIVLFLGC 193


>tr|A9T492|A9T492_PHYPA Cellulose synthase-like C3,
glycosyltransferase family 2 OS=Physcomitrella patens
subsp. patens GN=cslC3 PE=4 SV=1
Length = 693

Score = 100 bits (250), Expect(3) = 3e-31
Identities = 48/82 (58%), Positives = 60/82 (73%)
Frame = +1

Query: 259 QMNWPRYTTLEQILDDSDDKETQSLIRAEVQKWHQIGLRILYRHRTLRTGYKAGNLKSAM 438
Q++WP+ L Q+LDDS D ET+ LI++EV KW Q G+ I+YRHR RTGYKAGN+KSAM
Sbjct: 247 QLDWPKSRILIQVLDDSSDVETRFLIKSEVSKWQQKGVNIVYRHRVNRTGYKAGNMKSAM 306

Query: 439 SCDYVRDYEFCGHFLMPIFQPQ 504
CDYV+ YEF F FQP+
Sbjct: 307 QCDYVKKYEFVAIFDAD-FQPK 327



Score = 46.2 bits (108), Expect(3) = 3e-31
Identities = 19/26 (73%), Positives = 24/26 (92%)
Frame = +3

Query: 177 ASYPMVLIQIPMCNEKEVYQQSIGAV 254
+ +PMVL+QIPMCNE+EVY+QSI AV
Sbjct: 220 SGHPMVLVQIPMCNEREVYEQSISAV 245



Score = 32.0 bits (71), Expect(3) = 3e-31
Identities = 15/30 (50%), Positives = 20/30 (66%)
Frame = +2

Query: 8 LLPSYTSLSNACILLFLIQSLDRIAQCLVC 97
+ P+ L++ CI LFLIQS+DRI L C
Sbjct: 164 IAPTLQKLTDFCIWLFLIQSVDRIVLFLGC 193