DK955694
Clone id TST39A01NGRL0023_M15
Library
Length 583
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_M15. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID
Sequence
CCTTCTCTGCTTTGTTGGGCACGGTTATCCTGCTGTACTCGCCATCGCCACCATGGCTTT
AGTGTTCAAGATCAAACACAAGGAAACCCTGCGCAGGTGGGTGGTCTTGCAAACGTTTCC
AGAGAAGTCTTCGGACTTGTCCCTCACTGTTCACGACCTAGAGTTGAAGGTTCGTGAGCT
CTTTCATTTGGCCAGTAATGATGTTCTGCTCATCACCTATGTGGATAAAGAGGGGGATAT
TGTCACTCTGGCCGACGATCAAGACCTCGTAGATGCCTGCTTTCTGCAAGGCCTAAATCC
TCTCCGATTAGAGGTGAAAACCCTTGAGCATGAAGCGCCAGTTGCAAATAACCCTGCATC
GGCAGTTTTGCGGGACGGAGTCAATAGTGCTGATGCAGCATCACCACTGCCCAATCTAAA
TGATAAGGCTAACCCAGAGCGTACGTCCAGACCTCCATTTCCACAAGCAGCAGCAGATGA
TATCAAACAGTTTCTTTCGAAATGTGCACAGAATATTGATCCTAACCTTCAGCGAGCACT
CTTGATTAAAAACATTCAAAATCTTCAGCCAGCAATTGTGATA
■■Homology search results ■■ -
sp_hit_id Q92734
Definition sp|Q92734|TFG_HUMAN Protein TFG OS=Homo sapiens
Align length 182
Score (bit) 38.5
E-value 0.025
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955694|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0023_M15, 5'
(583 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q92734|TFG_HUMAN Protein TFG OS=Homo sapiens GN=TFG PE=1 SV=2 39 0.025
sp|O13965|MUG70_SCHPO Meiotically up-regulated gene 70 protein O... 36 0.16
sp|Q8BN78|KAISO_MOUSE Transcriptional regulator Kaiso OS=Mus mus... 33 1.4
sp|Q8IXW0|CK035_HUMAN Uncharacterized protein C11orf35 OS=Homo s... 32 1.8
sp|A7MER7|SYS_ENTS8 Seryl-tRNA synthetase OS=Enterobacter sakaza... 32 3.0
sp|Q9BYB0|SHAN3_HUMAN SH3 and multiple ankyrin repeat domains pr... 32 3.0
sp|Q6AE62|MURD_LEIXX UDP-N-acetylmuramoylalanine--D-glutamate li... 32 3.0
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kin... 32 3.0
sp|Q59015|Y1620_METJA Uncharacterized protein MJ1620 OS=Methanoc... 31 3.9
sp|Q2JQL7|PURL_SYNJA Phosphoribosylformylglycinamidine synthase ... 31 3.9
sp|Q6GP17|SU41A_XENLA Histone-lysine N-methyltransferase SUV420H... 31 5.2
sp|Q9Z702|MURG_CHLPN UDP-N-acetylglucosamine--N-acetylmuramyl-(p... 31 5.2
sp|A0QGM8|MASZ_MYCA1 Malate synthase G OS=Mycobacterium avium (s... 31 5.2
sp|O26880|COBQ_METTH Probable cobyric acid synthase OS=Methanoba... 31 5.2
sp|P09217|KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegic... 30 6.7
sp|O19111|KPCZ_RABIT Protein kinase C zeta type OS=Oryctolagus c... 30 6.7
sp|Q05513|KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens ... 30 6.7
sp|Q9QMI0|HBSAG_HBVD4 Large envelope protein OS=Hepatitis B viru... 30 6.7
sp|A1JRH8|AAEB_YERE8 p-hydroxybenzoic acid efflux pump subunit a... 30 6.7
sp|Q468N4|PURQ_METBF Phosphoribosylformylglycinamidine synthase ... 30 8.8
sp|A7TSV7|PAN1_VANPO Actin cytoskeleton-regulatory complex prote... 30 8.8
sp|Q02956|KPCZ_MOUSE Protein kinase C zeta type OS=Mus musculus ... 30 8.8
sp|Q86T24|KAISO_HUMAN Transcriptional regulator Kaiso OS=Homo sa... 30 8.8
sp|P03139|HBSAG_HBVD1 Large envelope protein OS=Hepatitis B viru... 30 8.8
sp|Q4UNH3|DSB_RICFE Putative protein-disulfide oxidoreductase RF... 30 8.8
sp|Q6NZ09|ADRM1_DANRE Proteasomal ubiquitin receptor ADRM1 OS=Da... 30 8.8
sp|Q665H2|AAEB_YERPS p-hydroxybenzoic acid efflux pump subunit a... 30 8.8
sp|A4THF0|AAEB_YERPP p-hydroxybenzoic acid efflux pump subunit a... 30 8.8
sp|Q1CDW7|AAEB_YERPN p-hydroxybenzoic acid efflux pump subunit a... 30 8.8
sp|Q8ZAU8|AAEB_YERPE p-hydroxybenzoic acid efflux pump subunit a... 30 8.8

>sp|Q92734|TFG_HUMAN Protein TFG OS=Homo sapiens GN=TFG PE=1 SV=2
Length = 400

Score = 38.5 bits (88), Expect = 0.025
Identities = 41/182 (22%), Positives = 72/182 (39%), Gaps = 14/182 (7%)
Frame = +2

Query: 59 LVFKIKHKETLRRWVVLQTFPEKSSDLSLTVHDLELKVRELFH--LASNDVLLITYVDKE 232
L+ K + E +RR P + D+ T +L L ++ +F L SND + I Y D++
Sbjct: 11 LIIKAQLGEDIRR------IPIHNEDI--TYDELVLMMQRVFRGKLLSNDEVTIKYKDED 62

Query: 233 GDIVTLADDQDLVDACFLQGLNPLRL------------EVKTLEHEAPVANNPASAVLRD 376
GD++T+ D DL A + L L +VK L E N + +L D
Sbjct: 63 GDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL-D 121

Query: 377 GVNSADAASPLPNLNDKANPERTSRPPFPQAAADDIKQFLSKCAQNIDPNLQRALLIKNI 556
+ P N+ + + ++ Q ++ DP + + KN+
Sbjct: 122 SLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNV 181

Query: 557 QN 562
+
Sbjct: 182 MS 183


>sp|O13965|MUG70_SCHPO Meiotically up-regulated gene 70 protein
OS=Schizosaccharomyces pombe GN=mug70 PE=1 SV=1
Length = 730

Score = 35.8 bits (81), Expect = 0.16
Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 1/59 (1%)
Frame = +2

Query: 146 TVHDLELKVRELFHLASNDVLLITYVDKEGDIVTLADDQDLVDACFLQGLNPL-RLEVK 319
+V DL V E ++ +TY+D EGD+V L D DL +A L L RLEV+
Sbjct: 596 SVSDLRTAVEER---EKEQLVTLTYIDDEGDVVELVSDSDLREAILLARRRGLPRLEVR 651


>sp|Q8BN78|KAISO_MOUSE Transcriptional regulator Kaiso OS=Mus
musculus GN=Zbtb33 PE=1 SV=1
Length = 671

Score = 32.7 bits (73), Expect = 1.4
Identities = 34/152 (22%), Positives = 62/152 (40%), Gaps = 12/152 (7%)
Frame = +2

Query: 110 QTFPEKSSDLSLTVHDLELK-----------VRELFHLASNDVLLITYVDKEGDIVTLAD 256
+T P SSD SL + + + + E F L++ D + + IVT +D
Sbjct: 136 ETLPSSSSDKSLDMEKSKDEAQDNGATVMPIITESFSLSAEDN------EMKKIIVTDSD 189

Query: 257 DQDLVDACFLQGLNPLRLEVKTLEHEAPVANNPASAVLRDGVNSADAAS-PLPNLNDKAN 433
D D D F + P + ++ + V NPAS + + A S P+ N+
Sbjct: 190 DDDDDDVIFCSEILPAKEDLPSNNTATQVQPNPASVAISEVTPCASNNSPPVTNITPTQL 249

Query: 434 PERTSRPPFPQAAADDIKQFLSKCAQNIDPNL 529
P ++ Q + + +S + ++ PN+
Sbjct: 250 PTPVNQATLSQTQGSE-ELLVSSASTHLTPNI 280


>sp|Q8IXW0|CK035_HUMAN Uncharacterized protein C11orf35 OS=Homo
sapiens GN=C11orf35 PE=2 SV=1
Length = 634

Score = 32.3 bits (72), Expect = 1.8
Identities = 16/46 (34%), Positives = 20/46 (43%)
Frame = +2

Query: 326 EHEAPVANNPASAVLRDGVNSADAASPLPNLNDKANPERTSRPPFP 463
EH P PA V DG + + PLP A+ + RPP P
Sbjct: 463 EHRIPRRETPAPRVFADGTDLSIDRFPLPEAGPGADTRKPPRPPRP 508


>sp|A7MER7|SYS_ENTS8 Seryl-tRNA synthetase OS=Enterobacter sakazakii
(strain ATCC BAA-894) GN=serS PE=3 SV=1
Length = 430

Score = 31.6 bits (70), Expect = 3.0
Identities = 20/50 (40%), Positives = 24/50 (48%)
Frame = +2

Query: 287 QGLNPLRLEVKTLEHEAPVANNPASAVLRDGVNSADAASPLPNLNDKANP 436
+ + PLRLEV L E A N A+L + D A LPNL D P
Sbjct: 66 EDIEPLRLEVNKLGEELDAAKNELDALLAE---IRDIALTLPNLPDDEVP 112


>sp|Q9BYB0|SHAN3_HUMAN SH3 and multiple ankyrin repeat domains protein
3 OS=Homo sapiens GN=SHANK3 PE=1 SV=2
Length = 1741

Score = 31.6 bits (70), Expect = 3.0
Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 1/66 (1%)
Frame = +2

Query: 365 VLRDGV-NSADAASPLPNLNDKANPERTSRPPFPQAAADDIKQFLSKCAQNIDPNLQRAL 541
+L+D S DA P P P+R RPP P + ++ F + P +++
Sbjct: 895 ILQDSAPESGDAPRPPPAATPPERPKRRPRPPGPDSPYANLGAFSASLFAPSKPQRRKSP 954

Query: 542 LIKNIQ 559
L+K +Q
Sbjct: 955 LVKQLQ 960


>sp|Q6AE62|MURD_LEIXX UDP-N-acetylmuramoylalanine--D-glutamate
ligase OS=Leifsonia xyli subsp. xyli GN=murD PE=3 SV=1
Length = 517

Score = 31.6 bits (70), Expect = 3.0
Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 5/93 (5%)
Frame = +2

Query: 179 LFHLASNDVLLITYVDKEGDIVTLADDQDLVDACFLQ---GLNPLRLEVKTLEHEAPVAN 349
LF D L+ + + V + D+DL+ + F + GL + ++ EH P A
Sbjct: 398 LFKGVDLDGLVKRHAARLRGAVLIGADRDLLRSAFQRHAPGLPVVEVDADETEHVMPTAV 457

Query: 350 NPASAVLRDG--VNSADAASPLPNLNDKANPER 442
A+A++RDG V A AA+ + +D A R
Sbjct: 458 RLAAALVRDGDTVLLAPAAASMDQFSDYAERGR 490


>sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase
ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2
Length = 666

Score = 31.6 bits (70), Expect = 3.0
Identities = 14/29 (48%), Positives = 17/29 (58%)
Frame = +2

Query: 446 SRPPFPQAAADDIKQFLSKCAQNIDPNLQ 532
S PP P + D K FL KC Q + PNL+
Sbjct: 292 SHPPIPDTLSSDAKDFLLKCLQEV-PNLR 319


>sp|Q59015|Y1620_METJA Uncharacterized protein MJ1620
OS=Methanocaldococcus jannaschii GN=MJ1620 PE=4 SV=1
Length = 505

Score = 31.2 bits (69), Expect = 3.9
Identities = 20/66 (30%), Positives = 36/66 (54%)
Frame = +2

Query: 362 AVLRDGVNSADAASPLPNLNDKANPERTSRPPFPQAAADDIKQFLSKCAQNIDPNLQRAL 541
A+L++GVN ++P + D E+ P FP+ + I+ LSKC +++ +
Sbjct: 242 ALLKEGVNRIVLSAP--DFLDYKRGEKLINPYFPEPNYEAIESLLSKC-KDLADKYNANV 298

Query: 542 LIKNIQ 559
LI+NI+
Sbjct: 299 LIENIK 304


>sp|Q2JQL7|PURL_SYNJA Phosphoribosylformylglycinamidine synthase 2
OS=Synechococcus sp. (strain JA-3-3Ab) GN=purL PE=3 SV=1
Length = 766

Score = 31.2 bits (69), Expect = 3.9
Identities = 22/60 (36%), Positives = 24/60 (40%)
Frame = -2

Query: 510 CAHFERNCLISSAAACGNGGLDVRSGLALSFRLGSGDAASALLTPSRKTADAGLFATGAS 331
C H R + SA C GGL V A L G AS L P D LF G+S
Sbjct: 643 CRHGIRQGWVRSAHDCSEGGLAVALAEAC---LSGGRGASVSLAPGSLPWDQALFGEGSS 699


tr_hit_id A9SHX9
Definition tr|A9SHX9|A9SHX9_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 89
Score (bit) 78.2
E-value 3.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955694|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0023_M15, 5'
(583 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SHX9|A9SHX9_PHYPA Predicted protein OS=Physcomitrella paten... 78 3e-13
tr|Q0ZII2|Q0ZII2_NICPL Joka2 (Fragment) OS=Nicotiana plumbaginif... 75 4e-12
tr|A9NT24|A9NT24_PICSI Putative uncharacterized protein OS=Picea... 73 1e-11
tr|A9NP76|A9NP76_PICSI Putative uncharacterized protein OS=Picea... 72 2e-11
tr|Q6ZH84|Q6ZH84_ORYSJ Os02g0593700 protein OS=Oryza sativa subs... 62 3e-08
tr|A2X6P6|A2X6P6_ORYSI Putative uncharacterized protein OS=Oryza... 62 3e-08
tr|Q7XK43|Q7XK43_ORYSJ Os04g0476800 protein OS=Oryza sativa subs... 58 4e-07
tr|Q01JY6|Q01JY6_ORYSA OSIGBa0116M22.2 protein OS=Oryza sativa G... 58 4e-07
tr|B8AVG3|B8AVG3_ORYSI Putative uncharacterized protein OS=Oryza... 58 4e-07
tr|B8K1X5|B8K1X5_WHEAT Ubiquitin-associated protein OS=Triticum ... 57 6e-07
tr|A9S1V5|A9S1V5_PHYPA Predicted protein OS=Physcomitrella paten... 55 3e-06
tr|Q9SB64|Q9SB64_ARATH Putative uncharacterized protein AT4g2469... 52 2e-05
tr|A5ADS2|A5ADS2_VITVI Putative uncharacterized protein OS=Vitis... 52 2e-05
tr|Q9U1W1|Q9U1W1_CAEEL Protein Y63D3A.5, confirmed by transcript... 46 0.001
tr|Q9DGF6|Q9DGF6_XENLA TRK-fused protein TFG OS=Xenopus laevis P... 45 0.004
tr|Q7ZXX5|Q7ZXX5_XENLA Tfg protein OS=Xenopus laevis GN=tfg PE=2... 45 0.004
tr|Q4R553|Q4R553_MACFA Brain cDNA, clone: QccE-18589, similar to... 42 0.033
tr|Q6GNR3|Q6GNR3_XENLA MGC80940 protein OS=Xenopus laevis GN=MGC... 41 0.056
tr|Q6C8P2|Q6C8P2_YARLI YALI0D18106p OS=Yarrowia lipolytica GN=YA... 40 0.073
tr|A8XU67|A8XU67_CAEBR CBR-TFG-1 protein OS=Caenorhabditis brigg... 40 0.12
tr|Q54EB5|Q54EB5_DICDI Putative uncharacterized protein OS=Dicty... 39 0.16
tr|B6N049|B6N049_BRAFL Putative uncharacterized protein OS=Branc... 39 0.16
tr|B6N021|B6N021_BRAFL Putative uncharacterized protein OS=Branc... 39 0.16
tr|Q1E0A0|Q1E0A0_COCIM Putative uncharacterized protein OS=Cocci... 39 0.16
tr|Q9Z1A1|Q9Z1A1_MOUSE Putative uncharacterized protein OS=Mus m... 39 0.21
tr|Q9D828|Q9D828_MOUSE Putative uncharacterized protein OS=Mus m... 39 0.21
tr|Q6AYR1|Q6AYR1_RAT Trk-fused gene OS=Rattus norvegicus GN=Tfg ... 39 0.28
tr|Q4R1A4|Q4R1A4_RAT TRK-fused gene protein OS=Rattus norvegicus... 39 0.28
tr|Q3SX36|Q3SX36_BOVIN TFG protein OS=Bos taurus GN=TFG PE=2 SV=1 39 0.28
tr|Q8TDJ5|Q8TDJ5_HUMAN Tyrosine-protein kinase receptor OS=Homo ... 39 0.28

>tr|A9SHX9|A9SHX9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_212537 PE=4 SV=1
Length = 732

Score = 78.2 bits (191), Expect = 3e-13
Identities = 41/89 (46%), Positives = 57/89 (64%)
Frame = +2

Query: 62 VFKIKHKETLRRWVVLQTFPEKSSDLSLTVHDLELKVRELFHLASNDVLLITYVDKEGDI 241
VFKIKH + +RR+ V + P D++ + LE +R+ F L ++ L+I Y DK+GD+
Sbjct: 5 VFKIKHGDVVRRFTVQPSVPGGGPDMNFS--QLEDTIRQAFKLPASSDLVINYNDKDGDV 62

Query: 242 VTLADDQDLVDACFLQGLNPLRLEVKTLE 328
VT+A D DL DAC +Q LNPLRL V E
Sbjct: 63 VTMAGDHDLYDACVIQELNPLRLTVTAHE 91


>tr|Q0ZII2|Q0ZII2_NICPL Joka2 (Fragment) OS=Nicotiana
plumbaginifolia PE=2 SV=1
Length = 467

Score = 74.7 bits (182), Expect = 4e-12
Identities = 51/144 (35%), Positives = 80/144 (55%)
Frame = +2

Query: 56 ALVFKIKHKETLRRWVVLQTFPEKSSDLSLTVHDLELKVRELFHLASNDVLLITYVDKEG 235
A+V K+K++ETLRR+ + EK L L + L K+ +LF++A + L++TYVD++G
Sbjct: 1 AIVIKVKYEETLRRFNA-RVINEK---LDLNMDGLSDKIFQLFNIARDAELILTYVDEDG 56

Query: 236 DIVTLADDQDLVDACFLQGLNPLRLEVKTLEHEAPVANNPASAVLRDGVNSADAASPLPN 415
D+VTL DD+DL D Q LNPLR+ V+ N A R S+ +++PL +
Sbjct: 57 DVVTLVDDEDLQDV-MRQDLNPLRISVRL---------NAAERSSRPSSRSSGSSTPLRS 106

Query: 416 LNDKANPERTSRPPFPQAAADDIK 487
+PPFP+ + +K
Sbjct: 107 --------PRVQPPFPKLSTSVLK 122


>tr|A9NT24|A9NT24_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 174

Score = 72.8 bits (177), Expect = 1e-11
Identities = 50/128 (39%), Positives = 73/128 (57%)
Frame = +2

Query: 53 MALVFKIKHKETLRRWVVLQTFPEKSSDLSLTVHDLELKVRELFHLASNDVLLITYVDKE 232
MALV K+K++ LRR + LQ E ++++ L+ K+RELF L N + ITY D++
Sbjct: 1 MALVVKVKYQGILRR-LTLQLREEYVPEINMDA--LKCKIRELFKLNPNADMSITYTDED 57

Query: 233 GDIVTLADDQDLVDACFLQGLNPLRLEVKTLEHEAPVANNPASAVLRDGVNSADAASPLP 412
GD+VT+ADD D +DA QGLNPLRL+V +A P+ NS +++P
Sbjct: 58 GDVVTMADDVDFLDA-VRQGLNPLRLDVS-------LATEPS--------NSERSSTPAE 101

Query: 413 NLNDKANP 436
N+ P
Sbjct: 102 QRNEGMEP 109


>tr|A9NP76|A9NP76_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 174

Score = 72.4 bits (176), Expect = 2e-11
Identities = 50/128 (39%), Positives = 72/128 (56%)
Frame = +2

Query: 53 MALVFKIKHKETLRRWVVLQTFPEKSSDLSLTVHDLELKVRELFHLASNDVLLITYVDKE 232
M LV K+K++ LRR + LQ E ++++ L+ K+RELF L N + ITY D++
Sbjct: 1 MTLVVKVKYQGILRR-LTLQLREEYVPEINMDA--LKCKIRELFKLNPNADMSITYTDED 57

Query: 233 GDIVTLADDQDLVDACFLQGLNPLRLEVKTLEHEAPVANNPASAVLRDGVNSADAASPLP 412
GD+VT+ADD D +DA QGLNPLRL+V +A P+ NS ++SP
Sbjct: 58 GDVVTMADDVDFLDA-VRQGLNPLRLDVS-------LATEPS--------NSERSSSPAE 101

Query: 413 NLNDKANP 436
N+ P
Sbjct: 102 QRNEGMEP 109


>tr|Q6ZH84|Q6ZH84_ORYSJ Os02g0593700 protein OS=Oryza sativa subsp.
japonica GN=OJ1067_B01.6-1 PE=2 SV=1
Length = 845

Score = 61.6 bits (148), Expect = 3e-08
Identities = 36/87 (41%), Positives = 51/87 (58%)
Frame = +2

Query: 59 LVFKIKHKETLRRWVVLQTFPEKSSDLSLTVHDLELKVRELFHLASNDVLLITYVDKEGD 238
+V K+K+ ETL+R+ P+ S +LS L K+ F S+ ++TY D++GD
Sbjct: 21 VVLKVKYGETLKRFGGYVQGPQFSLNLSA----LRSKIASAFKFGSDVDFILTYTDEDGD 76

Query: 239 IVTLADDQDLVDACFLQGLNPLRLEVK 319
IV L DD DL DA Q LNPLR+ V+
Sbjct: 77 IVMLDDDDDLHDAAIHQKLNPLRINVQ 103


>tr|A2X6P6|A2X6P6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_07886 PE=4 SV=1
Length = 845

Score = 61.6 bits (148), Expect = 3e-08
Identities = 36/87 (41%), Positives = 51/87 (58%)
Frame = +2

Query: 59 LVFKIKHKETLRRWVVLQTFPEKSSDLSLTVHDLELKVRELFHLASNDVLLITYVDKEGD 238
+V K+K+ ETL+R+ P+ S +LS L K+ F S+ ++TY D++GD
Sbjct: 21 VVLKVKYGETLKRFGGYVQGPQFSLNLSA----LRSKIASAFKFGSDVDFILTYTDEDGD 76

Query: 239 IVTLADDQDLVDACFLQGLNPLRLEVK 319
IV L DD DL DA Q LNPLR+ V+
Sbjct: 77 IVMLDDDDDLHDAAIHQKLNPLRINVQ 103


>tr|Q7XK43|Q7XK43_ORYSJ Os04g0476800 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0044K18.2 PE=4 SV=1
Length = 881

Score = 57.8 bits (138), Expect = 4e-07
Identities = 34/87 (39%), Positives = 47/87 (54%)
Frame = +2

Query: 59 LVFKIKHKETLRRWVVLQTFPEKSSDLSLTVHDLELKVRELFHLASNDVLLITYVDKEGD 238
LV K+K TL+R+ P DL+L L K+ F + ++TY D++GD
Sbjct: 18 LVVKVKFGGTLKRFTAFVNGPH--FDLNLAA--LRSKIASAFKFNPDTEFVLTYTDEDGD 73

Query: 239 IVTLADDQDLVDACFLQGLNPLRLEVK 319
+V L DD DL DA Q LNPLR+ V+
Sbjct: 74 VVILDDDSDLCDAAISQRLNPLRINVE 100


>tr|Q01JY6|Q01JY6_ORYSA OSIGBa0116M22.2 protein OS=Oryza sativa
GN=OSIGBa0116M22.2 PE=4 SV=1
Length = 881

Score = 57.8 bits (138), Expect = 4e-07
Identities = 34/87 (39%), Positives = 47/87 (54%)
Frame = +2

Query: 59 LVFKIKHKETLRRWVVLQTFPEKSSDLSLTVHDLELKVRELFHLASNDVLLITYVDKEGD 238
LV K+K TL+R+ P DL+L L K+ F + ++TY D++GD
Sbjct: 18 LVVKVKFGGTLKRFTAFVNGPH--FDLNLAA--LRSKIASAFKFNPDTEFVLTYTDEDGD 73

Query: 239 IVTLADDQDLVDACFLQGLNPLRLEVK 319
+V L DD DL DA Q LNPLR+ V+
Sbjct: 74 VVILDDDSDLCDAAISQRLNPLRINVE 100


>tr|B8AVG3|B8AVG3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_16310 PE=4 SV=1
Length = 881

Score = 57.8 bits (138), Expect = 4e-07
Identities = 34/87 (39%), Positives = 47/87 (54%)
Frame = +2

Query: 59 LVFKIKHKETLRRWVVLQTFPEKSSDLSLTVHDLELKVRELFHLASNDVLLITYVDKEGD 238
LV K+K TL+R+ P DL+L L K+ F + ++TY D++GD
Sbjct: 18 LVVKVKFGGTLKRFTAFVNGPH--FDLNLAA--LRSKIASAFKFNPDTEFVLTYTDEDGD 73

Query: 239 IVTLADDQDLVDACFLQGLNPLRLEVK 319
+V L DD DL DA Q LNPLR+ V+
Sbjct: 74 VVILDDDSDLCDAAISQRLNPLRINVE 100


>tr|B8K1X5|B8K1X5_WHEAT Ubiquitin-associated protein OS=Triticum
aestivum GN=UBA PE=2 SV=1
Length = 870

Score = 57.4 bits (137), Expect = 6e-07
Identities = 31/87 (35%), Positives = 50/87 (57%)
Frame = +2

Query: 59 LVFKIKHKETLRRWVVLQTFPEKSSDLSLTVHDLELKVRELFHLASNDVLLITYVDKEGD 238
+V K+K+ +TL+R+ + +L + L K+ F A + ++TY D++GD
Sbjct: 21 VVVKVKYGDTLKRF----NGYVNGTHFTLNLSALRSKIASAFKFAPDADFILTYTDEDGD 76

Query: 239 IVTLADDQDLVDACFLQGLNPLRLEVK 319
+V L DD+DL DA Q LNPLR+ V+
Sbjct: 77 VVMLDDDEDLHDAAIHQKLNPLRINVQ 103