DK955856
Clone id TST39A01NGRL0024_D10
Library
Length 572
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0024_D10. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
GTGCAAGTGTGGTTTTTCAGCTTTCCAAGCTCTGCAGCCTTCTCTTAAGAGCAGCACGGT
CAGTTGCAGGTGAAGAGGGTTGGGATCCCCTTGTTCCAGGGATCGCAGTTGGAACCCTTG
TGGAGGTGGATAGAATCCTTCCTGGATCTTTACCTTCTTCTGCTGGACCAATTGTTCTGC
TTGTTAAGGAAGCTGATGGTGATGAAGAGGTCAGGGCTTCAGGAGAGAATGTTACAGGGG
TGATCCTCCTTCAAGAGCTTCCTCATCTCTCACATTTAGGTGTTCGAGCTAGGCAGGAAA
AGGTGGTGTTTGTGACTTGTGAGGATGAGGACAAAGTTGCAAGCCTTCGGCGTTTGGTTG
GAAGCACTGTGAAGCTGGAAGCTAGCGCAGCTTGTGTACTTGTCCATGCACATCGGGAAG
GGGATGATGACAACATAAGTGATCAAGCACGCGAAGTAAGCCCTGTCTCGCCGGCTGCAG
TTAAGCAGAGCAAGTTTGTCCCGAGTCCTTCTGGATCCATCCTTGATCTTGCGGATGCAA
AACTTTGAGACTTCTGGAGCAAAAGCAGTTTC
■■Homology search results ■■ -
sp_hit_id Q6ZY51
Definition sp|Q6ZY51|PWD_ARATH Phosphoglucan, water dikinase, chloroplastic OS=Arabidopsis thaliana
Align length 214
Score (bit) 186.0
E-value 9.0e-47
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955856|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0024_D10, 5'
(572 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6ZY51|PWD_ARATH Phosphoglucan, water dikinase, chloroplastic... 186 9e-47
sp|Q2QTC2|PWD_ORYSJ Phosphoglucan, water dikinase, chloroplastic... 173 5e-43
sp|Q8LPT9|GWD1_CITRE Alpha-glucan water dikinase, chloroplastic ... 58 3e-08
sp|Q9SAC6|GWD1_ARATH Alpha-glucan water dikinase 1, chloroplasti... 58 4e-08
sp|Q9AWA5|GWD1_SOLTU Alpha-glucan water dikinase, chloroplastic ... 55 3e-07
sp|Q9STV0|GWD2_ARATH Alpha-glucan water dikinase 2 OS=Arabidopsi... 54 6e-07
sp|Q54BC9|DYRK2_DICDI Probable serine/threonine-protein kinase d... 35 0.20
sp|A1WZB3|HLDE_HALHL Bifunctional protein hldE OS=Halorhodospira... 33 0.77
sp|Q9KNH7|GLMU_VIBCH Bifunctional protein glmU OS=Vibrio cholera... 32 2.9
sp|A5F461|GLMU_VIBC3 Bifunctional protein glmU OS=Vibrio cholera... 32 2.9
sp|P34515|YMX7_CAEEL Uncharacterized protein K06H7.7 OS=Caenorha... 30 6.5
sp|Q00393|FRHG_METVO Coenzyme F420 hydrogenase subunit gamma OS=... 30 6.5
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=... 30 8.5
sp|Q3J7X3|PQQB_NITOC Coenzyme PQQ synthesis protein B OS=Nitroso... 30 8.5
sp|Q9R0M4|PODXL_MOUSE Podocalyxin-like protein 1 OS=Mus musculus... 30 8.5
sp|P39935|IF4F1_YEAST Eukaryotic initiation factor 4F subunit p1... 30 8.5
sp|Q05AS8|DVL2_XENTR Segment polarity protein dishevelled homolo... 30 8.5
sp|P51142|DVL2_XENLA Segment polarity protein dishevelled homolo... 30 8.5

>sp|Q6ZY51|PWD_ARATH Phosphoglucan, water dikinase, chloroplastic
OS=Arabidopsis thaliana GN=GWD3 PE=1 SV=1
Length = 1196

Score = 186 bits (471), Expect = 9e-47
Identities = 106/214 (49%), Positives = 142/214 (66%), Gaps = 25/214 (11%)
Frame = +3

Query: 3 ASVVFQLSKLCSLLLRAARSVAGEEGWDPLVPGIAVGTLVEVDRILPGSLPS-SAGPIVL 179
A ++FQ+SKLC++LL+A R+ G EGWD +VPG GTLV+V+ I+PGSLP+ S GPI+L
Sbjct: 668 AGIIFQISKLCTVLLKAVRNSLGSEGWDVVVPGSTSGTLVQVESIVPGSLPATSGGPIIL 727

Query: 180 LVKEADGDEEVRASGENVTGVILLQELPHLSHLGVRARQEKVVFVTCEDEDKVASLRRLV 359
LV +ADGDEEV A+ N+ GV+LLQELPHLSHLGVRARQEK+VFVTC+D+DKVA +RRLV
Sbjct: 728 LVNKADGDEEVSAANGNIAGVMLLQELPHLSHLGVRARQEKIVFVTCDDDDKVADIRRLV 787

Query: 360 GSTVKLEASAACVLVHAHREG-------------DDDNISDQAREVSPVS-------PAA 479
G V+LEAS + V + EG D +++S + + +S P +
Sbjct: 788 GKFVRLEASPSHVNLILSTEGRSRTSKSSATKKTDKNSLSKKKTDKKSLSIDDEESKPGS 847

Query: 480 VKQSKFVPS----PSGSILDLADAKL*DFWSKSS 569
+ + S PSG I+ LADA + SKS+
Sbjct: 848 SSSNSLLYSSKDIPSGGIIALADADVPTSGSKSA 881


>sp|Q2QTC2|PWD_ORYSJ Phosphoglucan, water dikinase, chloroplastic
OS=Oryza sativa subsp. japonica GN=GWD3 PE=3 SV=2
Length = 1206

Score = 173 bits (439), Expect = 5e-43
Identities = 89/149 (59%), Positives = 114/149 (76%), Gaps = 1/149 (0%)
Frame = +3

Query: 3 ASVVFQLSKLCSLLLRAARSVAGEEGWDPLVPGIAVGTLVEVDRILPGSLPSSAG-PIVL 179
A +VFQ+SKLC++L +A R V G GWD LVPG+A GTL+ V+RILPGSLPSS P+VL
Sbjct: 685 AGIVFQVSKLCTVLQKAIREVLGSTGWDVLVPGVAHGTLMRVERILPGSLPSSVKEPVVL 744

Query: 180 LVKEADGDEEVRASGENVTGVILLQELPHLSHLGVRARQEKVVFVTCEDEDKVASLRRLV 359
+V +ADGDEEV+A+G+N+ GVILLQELPHLSHLGVRARQE VVFVTCE +D V + L
Sbjct: 745 IVDKADGDEEVKAAGDNIVGVILLQELPHLSHLGVRARQENVVFVTCEYDDTVTDVYLLE 804

Query: 360 GSTVKLEASAACVLVHAHREGDDDNISDQ 446
G ++LEAS+ V + E +D+ +S +
Sbjct: 805 GKYIRLEASSINVNLSIVSEKNDNAVSTE 833


>sp|Q8LPT9|GWD1_CITRE Alpha-glucan water dikinase, chloroplastic
OS=Citrus reticulata GN=R1 PE=2 SV=1
Length = 1475

Score = 58.2 bits (139), Expect = 3e-08
Identities = 48/162 (29%), Positives = 75/162 (46%), Gaps = 3/162 (1%)
Frame = +3

Query: 21 LSKLCSLLLRAARSVAGEEGWDPLVPGIAVGTLVEVDRILPGSLPSSAGPIVLLVKEADG 200
LS L + L R A W + P G + VD +L S P +LL + G
Sbjct: 996 LSLLLNRLDPVLRKTASLGSWQVISPVEVFGYVAVVDELLAVQDKSYDQPTILLARRVKG 1055

Query: 201 DEEVRASGENVTGVILLQELPH-LSHLGVRARQEKVVFVTCEDEDKVASLRRLVGSTVKL 377
+EE+ + T +L ++P LSH+ VRAR KV F TC D + +A L+ G + L
Sbjct: 1056 EEEI----PHGTVAVLTADMPDVLSHVSVRARNCKVCFATCFDPNILADLQSNEGKMLHL 1111

Query: 378 EASAACVL--VHAHREGDDDNISDQAREVSPVSPAAVKQSKF 497
+ ++A + V E D + ++ E P S A+ + +F
Sbjct: 1112 KPTSADIAYSVVEGSELQDSSSANLKEEDGPSSSVALVKKQF 1153


>sp|Q9SAC6|GWD1_ARATH Alpha-glucan water dikinase 1, chloroplastic
OS=Arabidopsis thaliana GN=GWD1 PE=1 SV=2
Length = 1399

Score = 57.8 bits (138), Expect = 4e-08
Identities = 47/178 (26%), Positives = 79/178 (44%), Gaps = 4/178 (2%)
Frame = +3

Query: 21 LSKLCSLLLRAARSVAGEEGWDPLVPGIAVGTLVEVDRILPGSLPSSAGPIVLLVKEADG 200
LS L + L R A W + P VG ++ VD +L + P +++ G
Sbjct: 923 LSSLVNRLDPVLRKTANLGSWQVISPVEVVGYVIVVDELLTVQNKTYDRPTIIVANRVRG 982

Query: 201 DEEVRASGENVTGVILLQELPH-LSHLGVRARQEKVVFVTCEDEDKVASLRRLVGSTVKL 377
+EE+ +L ++P LSH+ VRAR K+ F TC D ++ L+ G + L
Sbjct: 983 EEEIPDGAV----AVLTPDMPDVLSHVSVRARNGKICFATCFDSGILSDLQGKDGKLLSL 1038

Query: 378 EASAACVLVHAHREGDDDNISDQAREVSPVSPAAVKQ---SKFVPSPSGSILDLADAK 542
+ ++A V+ + + + S E +P S + VK+ ++ S DL AK
Sbjct: 1039 QPTSADVVYKEVNDSELSSPSSDNLEDAPPSISLVKKQFAGRYAISSEEFTSDLVGAK 1096


>sp|Q9AWA5|GWD1_SOLTU Alpha-glucan water dikinase, chloroplastic
OS=Solanum tuberosum GN=R1 PE=1 SV=2
Length = 1464

Score = 54.7 bits (130), Expect = 3e-07
Identities = 39/128 (30%), Positives = 61/128 (47%), Gaps = 1/128 (0%)
Frame = +3

Query: 21 LSKLCSLLLRAARSVAGEEGWDPLVPGIAVGTLVEVDRILPGSLPSSAGPIVLLVKEADG 200
LS L + L R A W + P AVG +V VD +L P +L+ K G
Sbjct: 988 LSSLLNRLDPVLRKTANLGSWQIISPVEAVGYVVVVDELLSVQNEIYEKPTILVAKSVKG 1047

Query: 201 DEEVRASGENVTGVILLQELPH-LSHLGVRARQEKVVFVTCEDEDKVASLRRLVGSTVKL 377
+EE+ ++ ++P LSH+ VRAR KV F TC D + +A L+ G + L
Sbjct: 1048 EEEIPDGAV----ALITPDMPDVLSHVSVRARNGKVCFATCFDPNILADLQAKEGRILLL 1103

Query: 378 EASAACVL 401
+ + + ++
Sbjct: 1104 KPTPSDII 1111


>sp|Q9STV0|GWD2_ARATH Alpha-glucan water dikinase 2 OS=Arabidopsis
thaliana GN=GWD2 PE=2 SV=2
Length = 1278

Score = 53.9 bits (128), Expect = 6e-07
Identities = 36/158 (22%), Positives = 75/158 (47%)
Frame = +3

Query: 21 LSKLCSLLLRAARSVAGEEGWDPLVPGIAVGTLVEVDRILPGSLPSSAGPIVLLVKEADG 200
LS L + + R +A W + A G +V V+ ++ + P V++ + G
Sbjct: 805 LSTLVNRFDPSLRKIANLGCWQVISSADAYGFVVCVNELIVVQNKFYSKPTVIIASKVTG 864

Query: 201 DEEVRASGENVTGVILLQELPHLSHLGVRARQEKVVFVTCEDEDKVASLRRLVGSTVKLE 380
+EE+ A V V+ + LSH+ +RAR K F TC D++ +++L+ G + +
Sbjct: 865 EEEIPAG---VVAVLTPSMIDVLSHVSIRARNSKACFATCFDQNVLSNLKSKEGRAISIH 921

Query: 381 ASAACVLVHAHREGDDDNISDQAREVSPVSPAAVKQSK 494
+ +++ +G++ ++S + +S V + + K
Sbjct: 922 TKSTGLVI---SDGNNSDVSVRHIFISSVPRGVISKGK 956


>sp|Q54BC9|DYRK2_DICDI Probable serine/threonine-protein kinase
dyrk2 OS=Dictyostelium discoideum GN=dyrk2 PE=3 SV=1
Length = 915

Score = 35.4 bits (80), Expect = 0.20
Identities = 28/94 (29%), Positives = 46/94 (48%), Gaps = 2/94 (2%)
Frame = -2

Query: 553 KSQSFASARSRMDPEGLGTNLLCLTAAGETGLTSRA*SLMLSSSPSRCAWTSTQAALASS 374
KS S +S+ S + + ++ T L +++ S+ +S+ + TST LASS
Sbjct: 447 KSSSSSSSSSSSSSKSNIASSSSSSSNNLTNLLTQSQSISSTSTSTTTTPTSTSPTLASS 506

Query: 373 FTVL--PTKRRRLATLSSSSQVTNTTFSCLARTP 278
+VL PT +T ++S+ T T SC TP
Sbjct: 507 MSVLSSPTSTTTTSTSTTSTTTTPTKSSCTIITP 540


>sp|A1WZB3|HLDE_HALHL Bifunctional protein hldE OS=Halorhodospira
halophila (strain DSM 244 / SL1) GN=hldE PE=3 SV=1
Length = 477

Score = 33.5 bits (75), Expect = 0.77
Identities = 41/157 (26%), Positives = 68/157 (43%), Gaps = 7/157 (4%)
Frame = +3

Query: 90 LVPGIAVGTLVEVDRILPGSLPSSAGPIVLLVKEADGDEEVRASGENVT---GVILLQEL 260
L P +A ++ + G+LP AG ++ + A V G + G LL
Sbjct: 137 LEPALADAAVLVLSDYAKGALPDPAG-LIEAARRAGRPVLVDPKGADYRRYRGASLLT-- 193

Query: 261 PHLSHLGVRARQEKVVFVTCEDEDKVASLRRLVGSTVKLEA----SAACVLVHAHREGDD 428
P+L+ + V C D D++A R + + ++LEA + A REG
Sbjct: 194 PNLAEF-------EAVVGPCADGDEIAKRARQLAADLELEALLVTRGEAGMTLAPREGVA 246

Query: 429 DNISDQAREVSPVSPAAVKQSKFVPSPSGSILDLADA 539
++ +AREV V+ A + + G+ +DLADA
Sbjct: 247 VHLPTRAREVFDVTGAGDTVIATLAAALGAGVDLADA 283


>sp|Q9KNH7|GLMU_VIBCH Bifunctional protein glmU OS=Vibrio cholerae
GN=glmU PE=3 SV=1
Length = 453

Score = 31.6 bits (70), Expect = 2.9
Identities = 18/50 (36%), Positives = 28/50 (56%)
Frame = +3

Query: 99 GIAVGTLVEVDRILPGSLPSSAGPIVLLVKEADGDEEVRASGENVTGVIL 248
GIA+ T+V D G + GP+V +V++ D EE + E TGV++
Sbjct: 122 GIALLTVVLEDPTGYGRIVRKRGPVVAIVEQKDASEEQKLIKEVNTGVLV 171


>sp|A5F461|GLMU_VIBC3 Bifunctional protein glmU OS=Vibrio cholerae
serotype O1 (strain ATCC 39541 / Ogawa 395 / O395)
GN=glmU PE=3 SV=1
Length = 453

Score = 31.6 bits (70), Expect = 2.9
Identities = 18/50 (36%), Positives = 28/50 (56%)
Frame = +3

Query: 99 GIAVGTLVEVDRILPGSLPSSAGPIVLLVKEADGDEEVRASGENVTGVIL 248
GIA+ T+V D G + GP+V +V++ D EE + E TGV++
Sbjct: 122 GIALLTVVLEDPTGYGRIVRKRGPVVAIVEQKDASEEQKLIKEVNTGVLV 171


tr_hit_id A9RDP4
Definition tr|A9RDP4|A9RDP4_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 196
Score (bit) 189.0
E-value 9.0e-47
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955856|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0024_D10, 5'
(572 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RDP4|A9RDP4_PHYPA Predicted protein OS=Physcomitrella paten... 189 9e-47
tr|Q0WQR4|Q0WQR4_ARATH Putative uncharacterized protein At5g2657... 186 1e-45
tr|B3H4K8|B3H4K8_ARATH Uncharacterized protein At5g26570.2 OS=Ar... 181 2e-44
tr|B8BP85|B8BP85_ORYSI Putative uncharacterized protein OS=Oryza... 176 8e-43
tr|Q0INT3|Q0INT3_ORYSJ Os12g0297500 protein OS=Oryza sativa subs... 173 5e-42
tr|A9RXB2|A9RXB2_PHYPA Predicted protein OS=Physcomitrella paten... 167 3e-40
tr|A3CGL5|A3CGL5_ORYSJ Putative uncharacterized protein OS=Oryza... 154 4e-36
tr|A2ZJR2|A2ZJR2_ORYSI Putative uncharacterized protein OS=Oryza... 149 1e-34
tr|A7Q9L0|A7Q9L0_VITVI Chromosome chr5 scaffold_67, whole genome... 141 2e-32
tr|Q01AI3|Q01AI3_OSTTA Chloroplast alpha-glucan water dikinase i... 122 1e-26
tr|A4RWG0|A4RWG0_OSTLU Predicted protein (Fragment) OS=Ostreococ... 118 3e-25
tr|A8J6C3|A8J6C3_CHLRE Phosphoglucan water dikinase OS=Chlamydom... 104 4e-21
tr|A4S167|A4S167_OSTLU Predicted protein OS=Ostreococcus lucimar... 100 6e-20
tr|Q013R2|Q013R2_OSTTA Phosphoglucan, water dikinase (ISS) (Frag... 85 3e-15
tr|Q013R4|Q013R4_OSTTA Chloroplast alpha-glucan water dikinase i... 77 9e-13
tr|A7QP24|A7QP24_VITVI Chromosome chr1 scaffold_135, whole genom... 68 3e-10
tr|Q0DC10|Q0DC10_ORYSJ Os06g0498400 protein (Fragment) OS=Oryza ... 59 1e-07
tr|B8B2U3|B8B2U3_ORYSI Putative uncharacterized protein OS=Oryza... 59 1e-07
tr|A3BC18|A3BC18_ORYSJ Putative uncharacterized protein OS=Oryza... 59 1e-07
tr|Q0WLI2|Q0WLI2_ARATH Putative uncharacterized protein At1g1076... 58 4e-07
tr|B6KKV7|B6KKV7_TOXGO Phosphoglucan, water dikinase protein, pu... 58 4e-07
tr|Q9SGX4|Q9SGX4_ARATH F20B24.19 OS=Arabidopsis thaliana PE=4 SV=1 56 1e-06
tr|B5B3R3|B5B3R3_SOLLC Glucan water dikinase OS=Solanum lycopers... 54 5e-06
tr|B2M0R3|B2M0R3_SOLTU Starch-granule-bound R1 protein OS=Solanu... 53 1e-05
tr|A4SBZ8|A4SBZ8_OSTLU Predicted protein (Fragment) OS=Ostreococ... 50 1e-04
tr|A4S6H4|A4S6H4_OSTLU Predicted protein OS=Ostreococcus lucimar... 50 1e-04
tr|A8I6T5|A8I6T5_CHLRE R1 protein, alpha-glucan water dikinase O... 49 2e-04
tr|Q6PYX7|Q6PYX7_OSTTA SPR1b (Fragment) OS=Ostreococcus tauri GN... 47 6e-04
tr|Q00X32|Q00X32_OSTTA R1 protein A (IC) OS=Ostreococcus tauri G... 47 6e-04
tr|A9SFX9|A9SFX9_PHYPA Predicted protein OS=Physcomitrella paten... 45 0.002

>tr|A9RDP4|A9RDP4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_104427 PE=4 SV=1
Length = 1094

Score = 189 bits (480), Expect = 9e-47
Identities = 108/196 (55%), Positives = 142/196 (72%), Gaps = 7/196 (3%)
Frame = +3

Query: 3 ASVVFQLSKLCSLLLRAARSVAGEEGWDPLVPGIAVGTLVEVDRILPGSLPSSA-GPIVL 179
ASVVFQ++KLCS LL+A R+ AG +G+D ++PG A GTL+EVDRI+PG+LP+SA GPI+L
Sbjct: 590 ASVVFQVAKLCSFLLKAIRTTAGGDGFDVIMPGRARGTLLEVDRIVPGTLPTSATGPIIL 649

Query: 180 LVKEADGDEEVRASGENVTGVILLQELPHLSHLGVRARQEKVVFVTCEDEDKVASLRRLV 359
LVK+ADGDEEV+A+G NV GVILL ELPHLSHLGVRARQEK+VFVTC+DE++ A+LR L+
Sbjct: 650 LVKQADGDEEVKAAGSNVAGVILLHELPHLSHLGVRARQEKIVFVTCDDEERSANLRTLL 709

Query: 360 GSTVKLEASAACVLVHAHREGDDDNISDQAREVS-PVSP-----AAVKQSKFVPSPSGSI 521
V++ AS V V R+ D+ VS P S KQS V SP G++
Sbjct: 710 NKPVEIVASPESVHVE-FRDALSPQKQDKQESVSEPKSQQKDTITVTKQSVVVRSPPGTV 768

Query: 522 LDLADAKL*DFWSKSS 569
L+L++A + SK++
Sbjct: 769 LNLSEATTENAGSKAA 784


>tr|Q0WQR4|Q0WQR4_ARATH Putative uncharacterized protein At5g26570
(Fragment) OS=Arabidopsis thaliana GN=At5g26570 PE=2
SV=1
Length = 632

Score = 186 bits (471), Expect = 1e-45
Identities = 106/214 (49%), Positives = 142/214 (66%), Gaps = 25/214 (11%)
Frame = +3

Query: 3 ASVVFQLSKLCSLLLRAARSVAGEEGWDPLVPGIAVGTLVEVDRILPGSLPS-SAGPIVL 179
A ++FQ+SKLC++LL+A R+ G EGWD +VPG GTLV+V+ I+PGSLP+ S GPI+L
Sbjct: 104 AGIIFQISKLCTVLLKAVRNSLGSEGWDVVVPGSTSGTLVQVESIVPGSLPATSGGPIIL 163

Query: 180 LVKEADGDEEVRASGENVTGVILLQELPHLSHLGVRARQEKVVFVTCEDEDKVASLRRLV 359
LV +ADGDEEV A+ N+ GV+LLQELPHLSHLGVRARQEK+VFVTC+D+DKVA +RRLV
Sbjct: 164 LVNKADGDEEVSAANGNIAGVMLLQELPHLSHLGVRARQEKIVFVTCDDDDKVADIRRLV 223

Query: 360 GSTVKLEASAACVLVHAHREG-------------DDDNISDQAREVSPVS-------PAA 479
G V+LEAS + V + EG D +++S + + +S P +
Sbjct: 224 GKFVRLEASPSHVNLILSTEGRSRTSKSSATKKTDKNSLSKKKTDKKSLSIDDEESKPGS 283

Query: 480 VKQSKFVPS----PSGSILDLADAKL*DFWSKSS 569
+ + S PSG I+ LADA + SKS+
Sbjct: 284 SSSNSLLYSSKDIPSGGIIALADADVPTSGSKSA 317


>tr|B3H4K8|B3H4K8_ARATH Uncharacterized protein At5g26570.2
OS=Arabidopsis thaliana GN=At5g26570 PE=4 SV=1
Length = 865

Score = 181 bits (460), Expect = 2e-44
Identities = 90/141 (63%), Positives = 114/141 (80%), Gaps = 1/141 (0%)
Frame = +3

Query: 3 ASVVFQLSKLCSLLLRAARSVAGEEGWDPLVPGIAVGTLVEVDRILPGSLPS-SAGPIVL 179
A ++FQ+SKLC++LL+A R+ G EGWD +VPG GTLV+V+ I+PGSLP+ S GPI+L
Sbjct: 668 AGIIFQISKLCTVLLKAVRNSLGSEGWDVVVPGSTSGTLVQVESIVPGSLPATSGGPIIL 727

Query: 180 LVKEADGDEEVRASGENVTGVILLQELPHLSHLGVRARQEKVVFVTCEDEDKVASLRRLV 359
LV +ADGDEEV A+ N+ GV+LLQELPHLSHLGVRARQEK+VFVTC+D+DKVA +RRLV
Sbjct: 728 LVNKADGDEEVSAANGNIAGVMLLQELPHLSHLGVRARQEKIVFVTCDDDDKVADIRRLV 787

Query: 360 GSTVKLEASAACVLVHAHREG 422
G V+LEAS + V + EG
Sbjct: 788 GKFVRLEASPSHVNLILSTEG 808


>tr|B8BP85|B8BP85_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_38056 PE=4 SV=1
Length = 1191

Score = 176 bits (446), Expect = 8e-43
Identities = 91/149 (61%), Positives = 115/149 (77%), Gaps = 1/149 (0%)
Frame = +3

Query: 3 ASVVFQLSKLCSLLLRAARSVAGEEGWDPLVPGIAVGTLVEVDRILPGSLPSSAG-PIVL 179
A +VFQ+SKLC++L +A R V G GWD LVPG+A GTL+ V+RILPGSLPSS P+VL
Sbjct: 670 AGIVFQVSKLCTVLQKAIREVLGSTGWDVLVPGVAHGTLMRVERILPGSLPSSVKEPVVL 729

Query: 180 LVKEADGDEEVRASGENVTGVILLQELPHLSHLGVRARQEKVVFVTCEDEDKVASLRRLV 359
+V +ADGDEEV+A+G+N+ GVILLQELPHLSHLGVRARQEKVVFVTCE +D V + L
Sbjct: 730 IVNKADGDEEVKAAGDNIVGVILLQELPHLSHLGVRARQEKVVFVTCEYDDTVTDVYLLE 789

Query: 360 GSTVKLEASAACVLVHAHREGDDDNISDQ 446
G ++LEAS+ V + E +D+ IS +
Sbjct: 790 GKYIRLEASSINVNLSIVSEKNDNAISTE 818


>tr|Q0INT3|Q0INT3_ORYSJ Os12g0297500 protein OS=Oryza sativa subsp.
japonica GN=Os12g0297500 PE=4 SV=1
Length = 1206

Score = 173 bits (439), Expect = 5e-42
Identities = 89/149 (59%), Positives = 114/149 (76%), Gaps = 1/149 (0%)
Frame = +3

Query: 3 ASVVFQLSKLCSLLLRAARSVAGEEGWDPLVPGIAVGTLVEVDRILPGSLPSSAG-PIVL 179
A +VFQ+SKLC++L +A R V G GWD LVPG+A GTL+ V+RILPGSLPSS P+VL
Sbjct: 685 AGIVFQVSKLCTVLQKAIREVLGSTGWDVLVPGVAHGTLMRVERILPGSLPSSVKEPVVL 744

Query: 180 LVKEADGDEEVRASGENVTGVILLQELPHLSHLGVRARQEKVVFVTCEDEDKVASLRRLV 359
+V +ADGDEEV+A+G+N+ GVILLQELPHLSHLGVRARQE VVFVTCE +D V + L
Sbjct: 745 IVDKADGDEEVKAAGDNIVGVILLQELPHLSHLGVRARQENVVFVTCEYDDTVTDVYLLE 804

Query: 360 GSTVKLEASAACVLVHAHREGDDDNISDQ 446
G ++LEAS+ V + E +D+ +S +
Sbjct: 805 GKYIRLEASSINVNLSIVSEKNDNAVSTE 833


>tr|A9RXB2|A9RXB2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_179025 PE=4 SV=1
Length = 1126

Score = 167 bits (424), Expect = 3e-40
Identities = 95/199 (47%), Positives = 129/199 (64%), Gaps = 20/199 (10%)
Frame = +3

Query: 3 ASVVFQLSKLCSLLLRAARSVAGEEGWDPLVPGIAVGTLVEVDRILPGSLPSS-AGPIVL 179
AS+VFQ+ KLCSLLL+A R G +G+D ++PG A G LVEV+RI P LPSS +GP++L
Sbjct: 602 ASLVFQVVKLCSLLLKAIRRTVGGDGFDAIMPGRAAGRLVEVERIAPSYLPSSDSGPLIL 661

Query: 180 LVKEADGDEEVRASGENVTGVILLQELPHLSHLGVRARQEKVVFVTCEDEDKVASLRRLV 359
LVK+A G+EE++A+G NV GV+L ELPHLSHLGVRAR+E VVFVTC+DE K+ASLR L+
Sbjct: 662 LVKKASGEEEIKATGLNVAGVVLQHELPHLSHLGVRARKENVVFVTCDDEAKIASLRPLL 721

Query: 360 GSTVKLEASAACVLVHAHREGD------------------DDNISDQAREVSPVSPAA-V 482
V++ S+ V V + +D + +S +S A +
Sbjct: 722 NRNVEISGSSEFVHVRPYETPPPQAQQYVGAGLSLKEKMVNDELGPSYIRLSTLSKVADL 781

Query: 483 KQSKFVPSPSGSILDLADA 539
KQSK V SP G++ D++ A
Sbjct: 782 KQSKIVRSPLGTVFDISKA 800


>tr|A3CGL5|A3CGL5_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_034437 PE=4 SV=1
Length = 1089

Score = 154 bits (388), Expect = 4e-36
Identities = 77/118 (65%), Positives = 94/118 (79%), Gaps = 1/118 (0%)
Frame = +3

Query: 21 LSKLCSLLLRAARSVAGEEGWDPLVPGIAVGTLVEVDRILPGSLPSSAG-PIVLLVKEAD 197
+SKLC++L +A R V G GWD LVPG+A GTL+ V+RILPGSLPSS P+VL+V +AD
Sbjct: 615 VSKLCTVLQKAIREVLGSTGWDVLVPGVAHGTLMRVERILPGSLPSSVKEPVVLIVDKAD 674

Query: 198 GDEEVRASGENVTGVILLQELPHLSHLGVRARQEKVVFVTCEDEDKVASLRRLVGSTV 371
GDEEV+A+G+N+ GVILLQELPHLSHLGVRARQE VVFVTCE +D V + L G +
Sbjct: 675 GDEEVKAAGDNIVGVILLQELPHLSHLGVRARQENVVFVTCEYDDTVTDVYLLEGKYI 732


>tr|A2ZJR2|A2ZJR2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_38057 PE=4 SV=1
Length = 166

Score = 149 bits (375), Expect = 1e-34
Identities = 75/116 (64%), Positives = 92/116 (79%), Gaps = 1/116 (0%)
Frame = +3

Query: 36 SLLLRAARSVAGEEGWDPLVPGIAVGTLVEVDRILPGSLPSSAG-PIVLLVKEADGDEEV 212
+LL +A R V G GWD LVPG+A GTL+ V+RILPGSLPSS P+VL+V +ADGDEEV
Sbjct: 50 ALLQKAIREVLGSTGWDVLVPGVAHGTLMRVERILPGSLPSSVKEPVVLIVDKADGDEEV 109

Query: 213 RASGENVTGVILLQELPHLSHLGVRARQEKVVFVTCEDEDKVASLRRLVGSTVKLE 380
+A+G+N+ GVILLQELPHLSHLGVRARQE VVFVTCE +D V + L G ++L+
Sbjct: 110 KAAGDNIVGVILLQELPHLSHLGVRARQENVVFVTCEYDDTVTDVYLLEGKYIRLK 165


>tr|A7Q9L0|A7Q9L0_VITVI Chromosome chr5 scaffold_67, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00033526001
PE=4 SV=1
Length = 1117

Score = 141 bits (356), Expect = 2e-32
Identities = 75/133 (56%), Positives = 99/133 (74%), Gaps = 1/133 (0%)
Frame = +3

Query: 3 ASVVFQLSKLCSLLLRAARSVAGEEGWDPLVPGIAVGTLVEVDRILPGSLPSS-AGPIVL 179
A V+FQ+SKLC+LLL+A RS G +GWD +VPG A GTLV+V+ I+PGSLPSS GP++L
Sbjct: 604 AGVIFQVSKLCTLLLKAVRSTLGSQGWDVIVPGAAHGTLVQVESIIPGSLPSSVTGPVIL 663

Query: 180 LVKEADGDEEVRASGENVTGVILLQELPHLSHLGVRARQEKVVFVTCEDEDKVASLRRLV 359
+V ADGDEEV A+G N+ GV L H+ G ++KVVFVTCED+DK+A +++L
Sbjct: 664 VVNRADGDEEVTAAGSNIMGVNCLTY--HILVSG--PDRQKVVFVTCEDDDKIADIQKLN 719

Query: 360 GSTVKLEASAACV 398
G V+LEAS+A V
Sbjct: 720 GKCVRLEASSAGV 732


>tr|Q01AI3|Q01AI3_OSTTA Chloroplast alpha-glucan water dikinase
isoform 3 (ISS) (Fragment) OS=Ostreococcus tauri
GN=Ot04g04170 PE=4 SV=1
Length = 969

Score = 122 bits (307), Expect = 1e-26
Identities = 68/140 (48%), Positives = 87/140 (62%), Gaps = 1/140 (0%)
Frame = +3

Query: 3 ASVVFQLSKLCSLLLRAARSVAGEEGWDPLVPGIAVGTLVEVDRILPGSLPSSAGPIVLL 182
ASVVFQ +K SLLLR +R + G GWD +V G A+GTL V R+ P S P++LL
Sbjct: 467 ASVVFQSAKFASLLLRVSRRITGAAGWDCVVQGEAIGTLKSVMRLTPEECASFKEPVILL 526

Query: 183 VKEADGDEEVRASGENVTGVILLQELPHLSHLGVRARQEKVVFVTCEDEDKVASLRRLVG 362
V ADGDEEV G V G++L LPHLSHL +RARQ +V + EDE+ V R L+
Sbjct: 527 VANADGDEEVSTCGPYVRGIVLCHALPHLSHLALRARQAQVPLIAVEDENLVDHARSLLD 586

Query: 363 -STVKLEASAACVLVHAHRE 419
STVKL A+A+ + + E
Sbjct: 587 KSTVKLSANASTIKLEETNE 606