DK955918
Clone id TST39A01NGRL0024_G03
Library
Length 626
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0024_G03. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID
Sequence
GTGACACAGAAAGCTATGGACTTCTAATCGCGAGATGGATCATTAGTTTCAGCTTTCAAG
CTACGTCTTCCCCGTCCCTGCCCGATCTCTGCTAGCATTTCCTGTTCCATATCGATTCTT
ACCCGGCTGCGTTTTGCCATTGGTGATCCTGCCCTCCAATGCTTGCTATTGCTCCTTACC
CTTCTGTAGCTCCTTATGGGTAACTCGTTCGGATGCTCAGCATCTGGGGAGAGACTAGTT
TCTGCAGCTCGAGATGGGGACCTCGTTGAAGCTCGTGCTTTGCTGGAGTTCAACCCATTG
CTGGCAAGATACTCCACTTTTGGGGCTCTAAATTCTCCCCTCCATTTTGCAGCAGCCAAG
GGCCATAATGAGATAGTAAACCTGCTGTTAGAGCACGGCGCTGATGTAAACATCCGGAAT
TACTGTGGTCAGACTGCTCTGATGCAAGCTTGTCGCTATGGACATTGGGAAGTTGTTCAA
ACATTACTTCTTTACAAAGGAAACGTAAGTAGAGCTGATTATCTCAACAGGCGAACCGCT
TTTCATTTTGCTGCTGTCAATGGTCATGCCCGCTGTATCAGGCTTCTGGTCTCTGACTAC
ATTCCTAGTGTACCTTATCGCTGGAG
■■Homology search results ■■ -
sp_hit_id B2RXR6
Definition sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus
Align length 90
Score (bit) 75.1
E-value 3.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955918|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0024_G03, 5'
(626 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 reg... 75 3e-13
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 reg... 75 3e-13
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 reg... 74 6e-13
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 reg... 74 8e-13
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 ... 73 1e-12
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 reg... 73 1e-12
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=1 70 1e-11
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=... 69 3e-11
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=... 68 3e-11
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=... 68 3e-11
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=... 68 4e-11
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 67 7e-11
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 2... 66 1e-10
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila... 65 2e-10
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 reg... 65 3e-10
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing pr... 65 4e-10
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 64 8e-10
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 2... 64 8e-10
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing p... 64 8e-10
sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g1236... 63 1e-09
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 5... 63 1e-09
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing pr... 63 1e-09
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 1... 63 1e-09
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 1... 63 1e-09
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium di... 62 2e-09
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Ra... 62 2e-09
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat doma... 62 2e-09
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-prot... 62 3e-09
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus m... 62 3e-09
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo ... 62 3e-09

>sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6
regulatory ankyrin repeat subunit B OS=Mus musculus
GN=Ankrd44 PE=2 SV=1
Length = 993

Score = 75.1 bits (183), Expect = 3e-13
Identities = 37/90 (41%), Positives = 56/90 (62%)
Frame = +1

Query: 322 GALNSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKG 501
GAL SPLH AA GH++ + +LL+ D++IR+ G+TAL A GH E V+ L+
Sbjct: 565 GALKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALYLAAFKGHTECVEALVNQGA 624

Query: 502 NVSRADYLNRRTAFHFAAVNGHARCIRLLV 591
++ D + +RT H + +NGH C+RLL+
Sbjct: 625 SIFVKDNVTKRTPLHASVINGHTLCLRLLL 654



Score = 55.8 bits (133), Expect = 2e-07
Identities = 32/89 (35%), Positives = 48/89 (53%), Gaps = 3/89 (3%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGAD---VNIRNYCGQTALMQACRYGHWEVVQTLLLYKGN 504
+PLH + GH + LLLE + V++++ GQT LM A YGH + V LL + N
Sbjct: 636 TPLHASVINGHTLCLRLLLETADNPEVVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEAN 695

Query: 505 VSRADYLNRRTAFHFAAVNGHARCIRLLV 591
V D + TA H + GH C+++L+
Sbjct: 696 VDAVDIVG-CTALHRGIMTGHEECVQMLL 723



Score = 53.9 bits (128), Expect = 7e-07
Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 1/89 (1%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH AA+ G +V LL G +++ N G TAL AC G VV L+ Y NV++
Sbjct: 208 TPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQ 267

Query: 514 ADYLNRRTAFHFAAVNGH-ARCIRLLVSD 597
+ + T HFAA + H A C+ LLV++
Sbjct: 268 PNN-SGFTPLHFAAASTHGALCLELLVNN 295



Score = 53.1 bits (126), Expect = 1e-06
Identities = 34/86 (39%), Positives = 47/86 (54%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PL A A GH + V+LLLE A+V+ + G TAL + GH E VQ LL + ++
Sbjct: 672 TPLMLAVAYGHIDAVSLLLEKEANVDAVDIVGCTALHRGIMTGHEECVQMLLEQEASILC 731

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLV 591
D RT H+AA GHA + L+
Sbjct: 732 KD-SRGRTPLHYAAARGHATWLNELL 756



Score = 52.8 bits (125), Expect = 1e-06
Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 1/88 (1%)
Frame = +1

Query: 334 SPLHFAAAKGHNEI-VNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVS 510
+PLHFAAA H + + LL+ +GADVNI++ G++ L +G + QTL+ G +
Sbjct: 274 TPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEID 333

Query: 511 RADYLNRRTAFHFAAVNGHARCIRLLVS 594
D + T H AA +GH I L++
Sbjct: 334 CVD-KDGNTPLHVAARHGHELLINTLIT 360



Score = 52.0 bits (123), Expect = 2e-06
Identities = 31/87 (35%), Positives = 48/87 (55%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH AAA + +++ + VN+ + G+TAL A GH E+V LL N++
Sbjct: 109 TPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINA 168

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVS 594
D +RR A H+AA GH + LL++
Sbjct: 169 FDKKDRR-ALHWAAYMGHLDVVALLIN 194



Score = 51.6 bits (122), Expect = 3e-06
Identities = 41/123 (33%), Positives = 58/123 (47%), Gaps = 4/123 (3%)
Frame = +1

Query: 235 LVSAARDGDLVEARALLEFNPLLARYSTFGALNS----PLHFAAAKGHNEIVNLLLEHGA 402
LV A GD E R L+ + AL+S PLH AA G EI+ LL+ GA
Sbjct: 12 LVQAIFSGDPEEIRMLIH------KTEDVNALDSEKRTPLHVAAFLGDAEIIELLILSGA 65

Query: 403 DVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIR 582
VN ++ T L +A E VQ L+ + +V+ D N +T H AA N +C
Sbjct: 66 RVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARD-KNWQTPLHVAAANKAVKCAE 124

Query: 583 LLV 591
+++
Sbjct: 125 VII 127



Score = 51.6 bits (122), Expect = 3e-06
Identities = 31/87 (35%), Positives = 47/87 (54%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH A A E V +L++H ADVN R+ QT L A + + ++ +V+
Sbjct: 76 TPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNV 135

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVS 594
+D RTA H AA+NGH + LL++
Sbjct: 136 SD-RGGRTALHHAALNGHMEMVNLLLA 161



Score = 50.1 bits (118), Expect = 9e-06
Identities = 34/97 (35%), Positives = 49/97 (50%), Gaps = 4/97 (4%)
Frame = +1

Query: 334 SPLHFAAAKGH----NEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKG 501
+PLH+AAA+GH NE++ + L D +++ G T L AC G+ ++ LL K
Sbjct: 738 TPLHYAAARGHATWLNELLQIALSE-EDCCLKDNQGYTPLHWACYNGNENCIEVLLEQK- 795

Query: 502 NVSRADYLNRRTAFHFAAVNGHARCIRLLVSDYIPSV 612
R N T H A +NGH C LL+ PS+
Sbjct: 796 -CFRKFIGNPFTPLHCAIINGHESCASLLLGAIDPSI 831



Score = 49.7 bits (117), Expect = 1e-05
Identities = 32/85 (37%), Positives = 45/85 (52%)
Frame = +1

Query: 340 LHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRAD 519
LH AA GH E+VNLLL GA++N + + AL A GH +VV L+ + V+ D
Sbjct: 144 LHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKD 203

Query: 520 YLNRRTAFHFAAVNGHARCIRLLVS 594
T H AA NG ++ L++
Sbjct: 204 -KKGYTPLHAAASNGQISVVKHLLN 227



Score = 49.7 bits (117), Expect = 1e-05
Identities = 31/82 (37%), Positives = 45/82 (54%)
Frame = +1

Query: 316 TFGALNSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLY 495
TFG + LH AAA G+ E + LL GAD + ++ CG+T L A H+ ++ L+
Sbjct: 403 TFG--RTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTT 460

Query: 496 KGNVSRADYLNRRTAFHFAAVN 561
NV+ D RTA H+AA +
Sbjct: 461 GANVNETDDWG-RTALHYAAAS 481



Score = 48.9 bits (115), Expect = 2e-05
Identities = 28/86 (32%), Positives = 43/86 (50%)
Frame = +1

Query: 337 PLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRA 516
PLH AA H++ LL G +++ + G+T L A G+ E ++ L + +
Sbjct: 375 PLHLAALNAHSDCCRKLLSSGFEIDTPDTFGRTCLHAAAAGGNVECIKLLQSSGADFHKK 434

Query: 517 DYLNRRTAFHFAAVNGHARCIRLLVS 594
D RT H+AA N H CI+ LV+
Sbjct: 435 DKCG-RTPLHYAAANCHFHCIKALVT 459



Score = 47.4 bits (111), Expect = 6e-05
Identities = 32/88 (36%), Positives = 42/88 (47%), Gaps = 4/88 (4%)
Frame = +1

Query: 340 LHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRAD 519
LH AA H E + LLL H A VN + G+TALM A G V L+ N ++AD
Sbjct: 843 LHAAAFGDHAECLQLLLRHDAQVNAVDNSGKTALMMAAENGQAGAVDILV----NSAQAD 898

Query: 520 YL----NRRTAFHFAAVNGHARCIRLLV 591
+ T H A GH +C L++
Sbjct: 899 LTVKDKDLNTPLHLAISKGHEKCALLIL 926



Score = 47.0 bits (110), Expect = 8e-05
Identities = 32/110 (29%), Positives = 52/110 (47%)
Frame = +1

Query: 235 LVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNI 414
L +AA +G + + LL + + +G N+ LH A G + +VN L+++GA+VN
Sbjct: 210 LHAAASNGQISVVKHLLNLGVEIDEINVYG--NTALHIACYNGQDAVVNELIDYGANVNQ 267

Query: 415 RNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNG 564
N G T L A H + LL+ G + ++ H AV+G
Sbjct: 268 PNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHG 317



Score = 47.0 bits (110), Expect = 8e-05
Identities = 30/88 (34%), Positives = 39/88 (44%)
Frame = +1

Query: 331 NSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVS 510
N+PLH AA GH ++N L+ GAD L A H + + LL +
Sbjct: 340 NTPLHVAARHGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEID 399

Query: 511 RADYLNRRTAFHFAAVNGHARCIRLLVS 594
D RT H AA G+ CI+LL S
Sbjct: 400 TPDTFG-RTCLHAAAAGGNVECIKLLQS 426



Score = 38.5 bits (88), Expect = 0.028
Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 3/57 (5%)
Frame = +1

Query: 328 LNSPLHFAAAKGHNEIVNLLLEHGAD---VNIRNYCGQTALMQACRYGHWEVVQTLL 489
LN+PLH A +KGH + L+L+ D +N +N QT L A R G VV+ LL
Sbjct: 906 LNTPLHLAISKGHEKCALLILDKIQDESLINAKNSALQTPLHIAARNGLKVVVEELL 962



Score = 36.2 bits (82), Expect = 0.14
Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 2/78 (2%)
Frame = +1

Query: 376 VNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVS--RADYLNRRTAFHF 549
+ LL++ A+ +IR+ G ++ A YGH + ++ LLL + N +D ++ H
Sbjct: 515 LEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLE-LLLERTNTGFEESDGGALKSPLHL 573

Query: 550 AAVNGHARCIRLLVSDYI 603
AA NGH + + +L+ +
Sbjct: 574 AAYNGHHQALEVLLQSLV 591


>sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6
regulatory ankyrin repeat subunit B OS=Gallus gallus
GN=ANKRD44 PE=2 SV=1
Length = 990

Score = 75.1 bits (183), Expect = 3e-13
Identities = 40/104 (38%), Positives = 61/104 (58%)
Frame = +1

Query: 280 LLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRY 459
LLE N + S A SPLH AA GH++ + +LL+ D++I++ G+TAL A
Sbjct: 551 LLEKNSNMFEESDSSATKSPLHLAAYNGHHQALEVLLQSLVDLDIKDEKGRTALDLAAFK 610

Query: 460 GHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIRLLV 591
GH E V+ L+ +V+ D + +RT H + +NGH C+RLL+
Sbjct: 611 GHAECVEALISQGASVTVKDNVTKRTPLHASVINGHTPCLRLLL 654



Score = 60.8 bits (146), Expect = 5e-09
Identities = 35/90 (38%), Positives = 50/90 (55%), Gaps = 4/90 (4%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH AA H E + LLL H A VN ++ G+TALM A + GH V L+ N+++
Sbjct: 838 TPLHAAAFADHVECLQLLLSHSAQVNAVDHAGKTALMMAAQNGHVGAVDFLV----NIAK 893

Query: 514 ADYLNR----RTAFHFAAVNGHARCIRLLV 591
AD R T+ H A+ GH +C L++
Sbjct: 894 ADLTLRDKDSNTSLHLASSKGHEKCALLIL 923



Score = 58.9 bits (141), Expect = 2e-08
Identities = 32/86 (37%), Positives = 47/86 (54%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH + GH + LLLE + ++ + GQT LM A YGH + V LL + +V
Sbjct: 636 TPLHASVINGHTPCLRLLLEVADNPDVTDAKGQTPLMLAVAYGHIDAVSLLLEKEASVDA 695

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLV 591
AD L TA H + GH C+++L+
Sbjct: 696 ADLLG-CTALHRGIMTGHEECVQMLL 720



Score = 57.4 bits (137), Expect = 6e-08
Identities = 37/89 (41%), Positives = 50/89 (56%), Gaps = 1/89 (1%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH AA+ G IV LL G +++ N G TAL AC G VV L+ Y NV++
Sbjct: 208 TPLHAAASNGQINIVKHLLNLGVEIDEMNIYGNTALHIACYNGQDSVVNELIDYGANVNQ 267

Query: 514 ADYLNRRTAFHFAAVNGH-ARCIRLLVSD 597
+ N T HFAA + H A C+ LLV++
Sbjct: 268 PNN-NGFTPLHFAAASTHGALCLELLVNN 295



Score = 52.8 bits (125), Expect = 1e-06
Identities = 31/87 (35%), Positives = 48/87 (55%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH AAA + +++ + VN+ + G+TAL A GH E+V LL N++
Sbjct: 109 TPLHVAAANKALKCAEIIIPMLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINA 168

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVS 594
D +RR A H+AA GH + LL++
Sbjct: 169 FDKKDRR-ALHWAAYMGHLEVVALLIN 194



Score = 52.0 bits (123), Expect = 2e-06
Identities = 31/87 (35%), Positives = 47/87 (54%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH A A E V +L++H ADVN R+ QT L A + + ++ +V+
Sbjct: 76 TPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKALKCAEIIIPMLSSVNV 135

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVS 594
+D RTA H AA+NGH + LL++
Sbjct: 136 SD-RGGRTALHHAALNGHVEMVNLLLA 161



Score = 51.6 bits (122), Expect = 3e-06
Identities = 32/88 (36%), Positives = 48/88 (54%), Gaps = 1/88 (1%)
Frame = +1

Query: 334 SPLHFAAAKGHNEI-VNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVS 510
+PLHFAAA H + + LL+ +GADVNI++ G++ L +G + QTL+ G +
Sbjct: 274 TPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEID 333

Query: 511 RADYLNRRTAFHFAAVNGHARCIRLLVS 594
D + T H AA GH I L++
Sbjct: 334 CVD-KDGNTPLHVAARYGHELLINTLIT 360



Score = 50.8 bits (120), Expect = 6e-06
Identities = 33/85 (38%), Positives = 45/85 (52%)
Frame = +1

Query: 340 LHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRAD 519
LH AA GH E+VNLLL GA++N + + AL A GH EVV L+ + V+ D
Sbjct: 144 LHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLEVVALLINHGAEVTCKD 203

Query: 520 YLNRRTAFHFAAVNGHARCIRLLVS 594
T H AA NG ++ L++
Sbjct: 204 -KKGYTPLHAAASNGQINIVKHLLN 227



Score = 50.4 bits (119), Expect = 7e-06
Identities = 27/87 (31%), Positives = 45/87 (51%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
SPLH A G L+++G +++ + G T L A RYGH ++ TL+ + ++
Sbjct: 308 SPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLITSGADTAK 367

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVS 594
++ H AA+N H+ C R L+S
Sbjct: 368 CG-IHNMFPLHLAALNAHSDCCRKLLS 393



Score = 50.4 bits (119), Expect = 7e-06
Identities = 31/90 (34%), Positives = 47/90 (52%), Gaps = 4/90 (4%)
Frame = +1

Query: 334 SPLHFAAAKGH----NEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKG 501
+PLHFAAA+GH +E++ + L D ++++ G T L AC GH ++ LL K
Sbjct: 735 TPLHFAAARGHATWLSELLQIALSE-EDCSLKDNQGYTPLHWACYNGHENCIEVLLEQK- 792

Query: 502 NVSRADYLNRRTAFHFAAVNGHARCIRLLV 591
R Y N + H A +N H C +L+
Sbjct: 793 -FFRKFYGNSFSPLHCAVINDHENCASMLI 821



Score = 48.5 bits (114), Expect = 3e-05
Identities = 28/86 (32%), Positives = 43/86 (50%)
Frame = +1

Query: 337 PLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRA 516
PLH AA H++ LL G +++ + G+T L A G+ E ++ L + ++
Sbjct: 375 PLHLAALNAHSDCCRKLLSSGFEIDTPDSFGRTCLHAAAAGGNVECIKLLQSSGADFNKK 434

Query: 517 DYLNRRTAFHFAAVNGHARCIRLLVS 594
D RT H+AA N H CI LV+
Sbjct: 435 D-KRGRTPLHYAAANCHFHCIETLVT 459



Score = 46.6 bits (109), Expect = 1e-04
Identities = 30/88 (34%), Positives = 39/88 (44%)
Frame = +1

Query: 331 NSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVS 510
N+PLH AA GH ++N L+ GAD L A H + + LL +
Sbjct: 340 NTPLHVAARYGHELLINTLITSGADTAKCGIHNMFPLHLAALNAHSDCCRKLLSSGFEID 399

Query: 511 RADYLNRRTAFHFAAVNGHARCIRLLVS 594
D RT H AA G+ CI+LL S
Sbjct: 400 TPDSFG-RTCLHAAAAGGNVECIKLLQS 426



Score = 46.2 bits (108), Expect = 1e-04
Identities = 27/74 (36%), Positives = 40/74 (54%)
Frame = +1

Query: 340 LHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRAD 519
LH AAA G+ E + LL GAD N ++ G+T L A H+ ++TL+ N++ D
Sbjct: 409 LHAAAAGGNVECIKLLQSSGADFNKKDKRGRTPLHYAAANCHFHCIETLVTTGANINETD 468

Query: 520 YLNRRTAFHFAAVN 561
RT H+AA +
Sbjct: 469 DWG-RTPLHYAAAS 481



Score = 45.4 bits (106), Expect = 2e-04
Identities = 32/110 (29%), Positives = 52/110 (47%)
Frame = +1

Query: 235 LVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNI 414
L +AA +G + + LL + + +G N+ LH A G + +VN L+++GA+VN
Sbjct: 210 LHAAASNGQINIVKHLLNLGVEIDEMNIYG--NTALHIACYNGQDSVVNELIDYGANVNQ 267

Query: 415 RNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNG 564
N G T L A H + LL+ G + ++ H AV+G
Sbjct: 268 PNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHG 317



Score = 43.9 bits (102), Expect = 7e-04
Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 2/87 (2%)
Frame = +1

Query: 340 LHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTA--LMQACRYGHWEVVQTLLLYKGNVSR 513
+H+AAA GH + + LLLE +++ + T L A GH + ++ LL ++
Sbjct: 536 VHYAAAYGHRQCLELLLEKNSNMFEESDSSATKSPLHLAAYNGHHQALEVLLQSLVDLDI 595

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVS 594
D R TA AA GHA C+ L+S
Sbjct: 596 KDEKGR-TALDLAAFKGHAECVEALIS 621



Score = 40.4 bits (93), Expect = 0.007
Identities = 29/87 (33%), Positives = 40/87 (45%), Gaps = 3/87 (3%)
Frame = +1

Query: 340 LHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLL---LYKGNVS 510
LH GH E V +LLE + ++ G+T L A GH + LL L + + S
Sbjct: 704 LHRGIMTGHEECVQMLLEKEVSILCKDARGRTPLHFAAARGHATWLSELLQIALSEEDCS 763

Query: 511 RADYLNRRTAFHFAAVNGHARCIRLLV 591
D T H+A NGH CI +L+
Sbjct: 764 LKDN-QGYTPLHWACYNGHENCIEVLL 789



Score = 37.7 bits (86), Expect = 0.049
Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 1/77 (1%)
Frame = +1

Query: 376 VNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNV-SRADYLNRRTAFHFA 552
+ LL++ A+ +I++ G + A YGH + ++ LL N+ +D ++ H A
Sbjct: 515 LEFLLQNDANPSIQDKEGYNTVHYAAAYGHRQCLELLLEKNSNMFEESDSSATKSPLHLA 574

Query: 553 AVNGHARCIRLLVSDYI 603
A NGH + + +L+ +
Sbjct: 575 AYNGHHQALEVLLQSLV 591



Score = 32.7 bits (73), Expect = 1.6
Identities = 42/155 (27%), Positives = 58/155 (37%), Gaps = 33/155 (21%)
Frame = +1

Query: 226 GERLVSAARDGDLVEARALLE-----FNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLL 390
G + AA G VE LL+ FN R T PLH+AAA H + L+
Sbjct: 405 GRTCLHAAAAGGNVECIKLLQSSGADFNKKDKRGRT------PLHYAAANCHFHCIETLV 458

Query: 391 EHGADVNIRNYCGQTALMQAC----------------------RYGHWE------VVQTL 486
GA++N + G+T L A R + ++ L
Sbjct: 459 TTGANINETDDWGRTPLHYAAASDMDRKKNILGNSHENAEELERTSEMKEKEAALCLEFL 518

Query: 487 LLYKGNVSRADYLNRRTAFHFAAVNGHARCIRLLV 591
L N S D T H+AA GH +C+ LL+
Sbjct: 519 LQNDANPSIQDKEGYNTV-HYAAAYGHRQCLELLL 552



Score = 32.7 bits (73), Expect = 1.6
Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 3/56 (5%)
Frame = +1

Query: 331 NSPLHFAAAKGHNEIVNLLLEHGAD---VNIRNYCGQTALMQACRYGHWEVVQTLL 489
N+ LH A++KGH + L+L+ + +N +N QT L A R G VV+ LL
Sbjct: 904 NTSLHLASSKGHEKCALLILDKIQEQSLINAKNNSLQTPLHIAARNGLKMVVEELL 959


>sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6
regulatory ankyrin repeat subunit A OS=Homo sapiens
GN=ANKRD28 PE=1 SV=4
Length = 1086

Score = 73.9 bits (180), Expect = 6e-13
Identities = 36/91 (39%), Positives = 55/91 (60%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
SPLH AA GH++ + +L++ D+++RN G+T L A GH E V L+ ++
Sbjct: 585 SPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILV 644

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVSDYIP 606
DY+ +RT H AA NGH+ C+RLL+ + P
Sbjct: 645 KDYILKRTPIHAAATNGHSECLRLLIGNAEP 675



Score = 56.2 bits (134), Expect = 1e-07
Identities = 34/87 (39%), Positives = 50/87 (57%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH AAA + L+ ++VN+ + G+TAL A GH E+V+ LL N++
Sbjct: 142 TPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINA 201

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVS 594
D +RR A H+AA GH ++LLVS
Sbjct: 202 FDKKDRR-AIHWAAYMGHIEVVKLLVS 227



Score = 54.7 bits (130), Expect = 4e-07
Identities = 34/89 (38%), Positives = 48/89 (53%), Gaps = 3/89 (3%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGAD---VNIRNYCGQTALMQACRYGHWEVVQTLLLYKGN 504
+P+H AA GH+E + LL+ + V+I++ GQT LM + GH + V +LL N
Sbjct: 652 TPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGAN 711

Query: 505 VSRADYLNRRTAFHFAAVNGHARCIRLLV 591
V D RTA H AV GH C+ L+
Sbjct: 712 VDAKDKWG-RTALHRGAVTGHEECVDALL 739



Score = 53.9 bits (128), Expect = 7e-07
Identities = 34/87 (39%), Positives = 47/87 (54%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH A A E V +LL+H ADVN R+ QT L A + + L+ NV+
Sbjct: 109 TPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNV 168

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVS 594
+D RTA H AA +GH ++LL+S
Sbjct: 169 SDRAG-RTALHHAAFSGHGEMVKLLLS 194



Score = 53.1 bits (126), Expect = 1e-06
Identities = 33/92 (35%), Positives = 47/92 (51%), Gaps = 4/92 (4%)
Frame = +1

Query: 340 LHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLL----LYKGNV 507
LH A GH E V+ LL+HGA +R+ G+T + + GH V+ LL N
Sbjct: 723 LHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANP 782

Query: 508 SRADYLNRRTAFHFAAVNGHARCIRLLVSDYI 603
+ AD + TA H+A NGH C+ LL+ +
Sbjct: 783 ATADN-HGYTALHWACYNGHETCVELLLEQEV 813



Score = 52.4 bits (124), Expect = 2e-06
Identities = 32/88 (36%), Positives = 48/88 (54%), Gaps = 1/88 (1%)
Frame = +1

Query: 334 SPLHFAAAKGHNEI-VNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVS 510
+PLHFAAA H + + LL+ +GADVN+++ G+T L +G + QT ++ G V
Sbjct: 307 TPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQT-IIQSGAVI 365

Query: 511 RADYLNRRTAFHFAAVNGHARCIRLLVS 594
+ N T H AA GH I L++
Sbjct: 366 DCEDKNGNTPLHIAARYGHELLINTLIT 393



Score = 52.0 bits (123), Expect = 2e-06
Identities = 43/119 (36%), Positives = 57/119 (47%)
Frame = +1

Query: 235 LVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNI 414
LV A +GD E RAL+ F + +PLH AA G EI+ LL+ GA VN
Sbjct: 45 LVQAIFNGDPDEVRALI-FKKEDVNFQD-NEKRTPLHAAAYLGDAEIIELLILSGARVNA 102

Query: 415 RNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIRLLV 591
++ T L +A E VQ LL + +V+ D N +T H AA N +C LV
Sbjct: 103 KDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARD-KNWQTPLHIAAANKAVKCAEALV 160



Score = 49.3 bits (116), Expect = 2e-05
Identities = 34/89 (38%), Positives = 45/89 (50%), Gaps = 1/89 (1%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH AA+ G +V LL+ G D+N N G T L AC Y +VV L+ G +
Sbjct: 241 TPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVAC-YNGQDVVVNELIDCGAIVN 299

Query: 514 ADYLNRRTAFHFAAVNGH-ARCIRLLVSD 597
T HFAA + H A C+ LLV +
Sbjct: 300 QKNEKGFTPLHFAAASTHGALCLELLVGN 328



Score = 49.3 bits (116), Expect = 2e-05
Identities = 30/88 (34%), Positives = 42/88 (47%)
Frame = +1

Query: 331 NSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVS 510
N+PLH AA GH ++N L+ GAD R G L A G + + LL ++
Sbjct: 373 NTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDID 432

Query: 511 RADYLNRRTAFHFAAVNGHARCIRLLVS 594
D RT H AA G+ C+ LL++
Sbjct: 433 TPDDFG-RTCLHAAAAGGNLECLNLLLN 459



Score = 48.1 bits (113), Expect = 4e-05
Identities = 29/86 (33%), Positives = 39/86 (45%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH AA H E + LLL H A VN + G+T LM A G V+ L+
Sbjct: 858 TPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELT 917

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLV 591
++ TA H A GH L++
Sbjct: 918 LQDNSKNTALHLACSKGHETSALLIL 943



Score = 47.8 bits (112), Expect = 5e-05
Identities = 34/100 (34%), Positives = 51/100 (51%), Gaps = 1/100 (1%)
Frame = +1

Query: 295 PLLARYSTFG-ALNSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWE 471
PLL+ + A + LH AA GH E+V LLL GA++N + + A+ A GH E
Sbjct: 161 PLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIE 220

Query: 472 VVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIRLLV 591
VV+ L+ + V+ D T H AA +G ++ L+
Sbjct: 221 VVKLLVSHGAEVTCKD-KKSYTPLHAAASSGMISVVKYLL 259



Score = 44.3 bits (103), Expect = 5e-04
Identities = 33/110 (30%), Positives = 52/110 (47%)
Frame = +1

Query: 235 LVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNI 414
L +AA G + + LL+ + + +G N+PLH A G + +VN L++ GA VN
Sbjct: 243 LHAAASSGMISVVKYLLDLGVDMNEPNAYG--NTPLHVACYNGQDVVVNELIDCGAIVNQ 300

Query: 415 RNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNG 564
+N G T L A H + LL+ G + +T H A++G
Sbjct: 301 KNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHG 350



Score = 44.3 bits (103), Expect = 5e-04
Identities = 27/85 (31%), Positives = 43/85 (50%)
Frame = +1

Query: 337 PLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRA 516
PLH AA G ++ LL G D++ + G+T L A G+ E + LL + ++
Sbjct: 408 PLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKK 467

Query: 517 DYLNRRTAFHFAAVNGHARCIRLLV 591
D R+ H+AA N + +C+ LV
Sbjct: 468 DKFG-RSPLHYAAANCNYQCLFALV 491



Score = 43.9 bits (102), Expect = 7e-04
Identities = 25/87 (28%), Positives = 44/87 (50%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH A G +++ GA ++ + G T L A RYGH ++ TL+ + ++
Sbjct: 341 TPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAK 400

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVS 594
++ H AA++G + C R L+S
Sbjct: 401 RG-IHGMFPLHLAALSGFSDCCRKLLS 426



Score = 43.9 bits (102), Expect = 7e-04
Identities = 27/78 (34%), Positives = 38/78 (48%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PL + GH + V LL GA+V+ ++ G+TAL + GH E V LL +
Sbjct: 688 TPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLL 747

Query: 514 ADYLNRRTAFHFAAVNGH 567
D RT H +A GH
Sbjct: 748 RD-SRGRTPIHLSAACGH 764



Score = 40.4 bits (93), Expect = 0.007
Identities = 32/95 (33%), Positives = 42/95 (44%), Gaps = 3/95 (3%)
Frame = +1

Query: 331 NSPLHFAAAKGHNEIVNLLLEHGAD---VNIRNYCGQTALMQACRYGHWEVVQTLLLYKG 501
N+ LH A +KGH L+LE D +N N QT L A R G VVQ LL
Sbjct: 924 NTALHLACSKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGA 983

Query: 502 NVSRADYLNRRTAFHFAAVNGHARCIRLLVSDYIP 606
+V D A A A C+ L+++ +P
Sbjct: 984 SVLAVDENGYTPALACAPNKDVADCLALILATMMP 1018



Score = 39.3 bits (90), Expect = 0.017
Identities = 37/122 (30%), Positives = 55/122 (45%), Gaps = 1/122 (0%)
Frame = +1

Query: 235 LVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNI 414
L +AA G+L LL + FG SPLH+AAA + + + L+ GA VN
Sbjct: 442 LHAAAAGGNLECLNLLLNTGADFNKKDKFG--RSPLHYAAANCNYQCLFALVGSGASVND 499

Query: 415 RNYCGQTALMQACRYG-HWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIRLLV 591
+ G T L A + ++ LL N D A H++A GH C++L+
Sbjct: 500 LDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRD-KQGYNAVHYSAAYGHRLCLQLIA 558

Query: 592 SD 597
S+
Sbjct: 559 SE 560



Score = 39.3 bits (90), Expect = 0.017
Identities = 34/98 (34%), Positives = 50/98 (51%), Gaps = 7/98 (7%)
Frame = +1

Query: 340 LHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQA---CRYGHWEVVQTLLLYKGNVS 510
LH AAA G+ E +NLLL GAD N ++ G++ L A C Y Q L G+ +
Sbjct: 442 LHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNY------QCLFALVGSGA 495

Query: 511 RADYLNRR--TAFHFAAVNG-HARCIR-LLVSDYIPSV 612
+ L+ R T H+AA + +C+ LL +D P +
Sbjct: 496 SVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGI 533


>sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6
regulatory ankyrin repeat subunit A OS=Mus musculus
GN=Ankrd28 PE=1 SV=1
Length = 1053

Score = 73.6 bits (179), Expect = 8e-13
Identities = 36/91 (39%), Positives = 55/91 (60%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
SPLH AA GH++ + +L++ D+++RN G+T L A GH E V L+ ++
Sbjct: 552 SPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILV 611

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVSDYIP 606
DY+ +RT H AA NGH+ C+RLL+ + P
Sbjct: 612 KDYVLKRTPIHAAATNGHSECLRLLIGNAEP 642



Score = 55.8 bits (133), Expect = 2e-07
Identities = 34/87 (39%), Positives = 50/87 (57%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH AAA + L+ ++VN+ + G+TAL A GH E+V+ LL N++
Sbjct: 109 TPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINA 168

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVS 594
D +RR A H+AA GH ++LLVS
Sbjct: 169 FDKKDRR-AIHWAAYMGHIEVVKLLVS 194



Score = 54.7 bits (130), Expect = 4e-07
Identities = 34/87 (39%), Positives = 48/87 (55%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH A A E V +LL+H ADVN R+ QT L A + ++L+ NV+
Sbjct: 76 TPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNV 135

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVS 594
+D RTA H AA +GH ++LL+S
Sbjct: 136 SDRAG-RTALHHAAFSGHGEMVKLLLS 161



Score = 54.7 bits (130), Expect = 4e-07
Identities = 34/89 (38%), Positives = 48/89 (53%), Gaps = 3/89 (3%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGAD---VNIRNYCGQTALMQACRYGHWEVVQTLLLYKGN 504
+P+H AA GH+E + LL+ + V+I++ GQT LM + GH + V +LL N
Sbjct: 619 TPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGAN 678

Query: 505 VSRADYLNRRTAFHFAAVNGHARCIRLLV 591
V D RTA H AV GH C+ L+
Sbjct: 679 VDAKDKWG-RTALHRGAVTGHEECVDALL 706



Score = 52.4 bits (124), Expect = 2e-06
Identities = 32/88 (36%), Positives = 48/88 (54%), Gaps = 1/88 (1%)
Frame = +1

Query: 334 SPLHFAAAKGHNEI-VNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVS 510
+PLHFAAA H + + LL+ +GADVN+++ G+T L +G + QT ++ G V
Sbjct: 274 TPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQT-IIQSGAVI 332

Query: 511 RADYLNRRTAFHFAAVNGHARCIRLLVS 594
+ N T H AA GH I L++
Sbjct: 333 DCEDKNGNTPLHIAARYGHELLINTLIT 360



Score = 52.0 bits (123), Expect = 2e-06
Identities = 31/87 (35%), Positives = 45/87 (51%), Gaps = 3/87 (3%)
Frame = +1

Query: 340 LHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRAD 519
LH A GH E V+ LL+HGA +R+ G+T + + GH V+ LL +V
Sbjct: 690 LHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANP 749

Query: 520 YL---NRRTAFHFAAVNGHARCIRLLV 591
+ + TA H+A NGH C+ LL+
Sbjct: 750 AVVDNHGYTALHWACYNGHETCVELLL 776



Score = 51.2 bits (121), Expect = 4e-06
Identities = 43/119 (36%), Positives = 57/119 (47%)
Frame = +1

Query: 235 LVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNI 414
LV A +GD E RAL+ F + +PLH AA G EI+ LL+ GA VN
Sbjct: 12 LVQAIFNGDPDEVRALI-FKKEDVNFQD-NEKRTPLHAAAYLGDAEIIELLILSGARVNA 69

Query: 415 RNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIRLLV 591
++ T L +A E VQ LL + +V+ D N +T H AA N +C LV
Sbjct: 70 KDSKWLTPLHRAVASCSEEAVQILLKHSADVNARD-KNWQTPLHIAAANKAVKCAESLV 127



Score = 51.2 bits (121), Expect = 4e-06
Identities = 35/89 (39%), Positives = 47/89 (52%), Gaps = 1/89 (1%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH AA+ G +V LL+ G D+N N G T L AC G VV L+ NV++
Sbjct: 208 TPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQ 267

Query: 514 ADYLNRRTAFHFAAVNGH-ARCIRLLVSD 597
+ T HFAA + H A C+ LLV +
Sbjct: 268 KNE-KGFTPLHFAAASTHGALCLELLVGN 295



Score = 49.3 bits (116), Expect = 2e-05
Identities = 30/88 (34%), Positives = 42/88 (47%)
Frame = +1

Query: 331 NSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVS 510
N+PLH AA GH ++N L+ GAD R G L A G + + LL ++
Sbjct: 340 NTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDID 399

Query: 511 RADYLNRRTAFHFAAVNGHARCIRLLVS 594
D RT H AA G+ C+ LL++
Sbjct: 400 TPDDFG-RTCLHAAAAGGNLECLNLLLN 426



Score = 47.8 bits (112), Expect = 5e-05
Identities = 34/100 (34%), Positives = 51/100 (51%), Gaps = 1/100 (1%)
Frame = +1

Query: 295 PLLARYSTFG-ALNSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWE 471
PLL+ + A + LH AA GH E+V LLL GA++N + + A+ A GH E
Sbjct: 128 PLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIE 187

Query: 472 VVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIRLLV 591
VV+ L+ + V+ D T H AA +G ++ L+
Sbjct: 188 VVKLLVSHGAEVTCKD-KKSYTPLHAAASSGMISVVKYLL 226



Score = 45.8 bits (107), Expect = 2e-04
Identities = 33/110 (30%), Positives = 53/110 (48%)
Frame = +1

Query: 235 LVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNI 414
L +AA G + + LL+ + + +G N+PLH A G + +VN L++ GA+VN
Sbjct: 210 LHAAASSGMISVVKYLLDLGVDMNEPNAYG--NTPLHVACYNGQDVVVNELIDCGANVNQ 267

Query: 415 RNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNG 564
+N G T L A H + LL+ G + +T H A++G
Sbjct: 268 KNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHG 317



Score = 45.4 bits (106), Expect = 2e-04
Identities = 28/86 (32%), Positives = 38/86 (44%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH AA H E + LLL A VN + G+T LM A G V+ L+
Sbjct: 825 TPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLT 884

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLV 591
++ TA H A GH L++
Sbjct: 885 LQDKSKNTALHLACGKGHETSALLIL 910



Score = 44.3 bits (103), Expect = 5e-04
Identities = 27/85 (31%), Positives = 43/85 (50%)
Frame = +1

Query: 337 PLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRA 516
PLH AA G ++ LL G D++ + G+T L A G+ E + LL + ++
Sbjct: 375 PLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKK 434

Query: 517 DYLNRRTAFHFAAVNGHARCIRLLV 591
D R+ H+AA N + +C+ LV
Sbjct: 435 DKFG-RSPLHYAAANCNYQCLFALV 458



Score = 43.9 bits (102), Expect = 7e-04
Identities = 25/87 (28%), Positives = 44/87 (50%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH A G +++ GA ++ + G T L A RYGH ++ TL+ + ++
Sbjct: 308 TPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAK 367

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVS 594
++ H AA++G + C R L+S
Sbjct: 368 RG-IHGMFPLHLAALSGFSDCCRKLLS 393



Score = 43.9 bits (102), Expect = 7e-04
Identities = 27/78 (34%), Positives = 38/78 (48%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PL + GH + V LL GA+V+ ++ G+TAL + GH E V LL +
Sbjct: 655 TPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLL 714

Query: 514 ADYLNRRTAFHFAAVNGH 567
D RT H +A GH
Sbjct: 715 RD-SRGRTPIHLSAACGH 731



Score = 40.0 bits (92), Expect = 0.010
Identities = 32/95 (33%), Positives = 41/95 (43%), Gaps = 3/95 (3%)
Frame = +1

Query: 331 NSPLHFAAAKGHNEIVNLLLEHGAD---VNIRNYCGQTALMQACRYGHWEVVQTLLLYKG 501
N+ LH A KGH L+LE D +N N QT L A R G VVQ LL
Sbjct: 891 NTALHLACGKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGA 950

Query: 502 NVSRADYLNRRTAFHFAAVNGHARCIRLLVSDYIP 606
+V D A A A C+ L+++ +P
Sbjct: 951 SVLAVDENGYTPALACAPNKDVADCLALILATMMP 985



Score = 39.3 bits (90), Expect = 0.017
Identities = 37/122 (30%), Positives = 55/122 (45%), Gaps = 1/122 (0%)
Frame = +1

Query: 235 LVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNI 414
L +AA G+L LL + FG SPLH+AAA + + + L+ GA VN
Sbjct: 409 LHAAAAGGNLECLNLLLNTGADFNKKDKFG--RSPLHYAAANCNYQCLFALVGSGASVND 466

Query: 415 RNYCGQTALMQACRYG-HWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIRLLV 591
+ G T L A + ++ LL N D A H++A GH C++L+
Sbjct: 467 LDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRD-KQGYNAVHYSAAYGHRLCLQLIA 525

Query: 592 SD 597
S+
Sbjct: 526 SE 527



Score = 39.3 bits (90), Expect = 0.017
Identities = 34/98 (34%), Positives = 50/98 (51%), Gaps = 7/98 (7%)
Frame = +1

Query: 340 LHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQA---CRYGHWEVVQTLLLYKGNVS 510
LH AAA G+ E +NLLL GAD N ++ G++ L A C Y Q L G+ +
Sbjct: 409 LHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNY------QCLFALVGSGA 462

Query: 511 RADYLNRR--TAFHFAAVNG-HARCIR-LLVSDYIPSV 612
+ L+ R T H+AA + +C+ LL +D P +
Sbjct: 463 SVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGI 500



Score = 34.7 bits (78), Expect = 0.41
Identities = 39/147 (26%), Positives = 54/147 (36%), Gaps = 34/147 (23%)
Frame = +1

Query: 256 GDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEH------------- 396
G L+++ ++ NP + + AL H+A GH V LLLE
Sbjct: 736 GALLQSATSVDANPAVVDNHGYTAL----HWACYNGHETCVELLLEQDVFQKIDGNAFSP 791

Query: 397 --------------------GAD-VNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
GA VN + G+T L A H E +Q LL V+
Sbjct: 792 LHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNS 851

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVS 594
AD +T AA NG + +LVS
Sbjct: 852 ADSTG-KTPLMMAAENGQTNTVEMLVS 877


>sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1
SV=1
Length = 1166

Score = 73.2 bits (178), Expect = 1e-12
Identities = 47/131 (35%), Positives = 69/131 (52%)
Frame = +1

Query: 199 GNSFGCSASGERLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIV 378
G S G S + +L+ AA+ GD+ + L + R G ++PLHFAA +V
Sbjct: 484 GISLGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCR-DIEGRQSTPLHFAAGYNRVSVV 542

Query: 379 NLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAV 558
LL+HGADV+ ++ G L AC YGH+EV + L+ + V+ AD L + T H AA
Sbjct: 543 EYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVAD-LWKFTPLHEAAA 601

Query: 559 NGHARCIRLLV 591
G +LL+
Sbjct: 602 KGKYEICKLLL 612



Score = 67.8 bits (164), Expect = 4e-11
Identities = 46/131 (35%), Positives = 68/131 (51%), Gaps = 1/131 (0%)
Frame = +1

Query: 223 SGERLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGA 402
+ L A R+GD+ + L+ + +R T G ++PLHFAA G ++V LL++GA
Sbjct: 24 AARELFEACRNGDVERVKRLVTPEKVNSR-DTAGRKSTPLHFAAGFGRKDVVEYLLQNGA 82

Query: 403 DVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHAR-CI 579
+V R+ G L AC +GH EVV LL + + + D N T H AA+ G CI
Sbjct: 83 NVQARDDGGLIPLHNACSFGHAEVVNLLLRHGADPNARDNWN-YTPLHEAAIKGKIDVCI 141

Query: 580 RLLVSDYIPSV 612
LL P++
Sbjct: 142 VLLQHGAEPTI 152



Score = 63.5 bits (153), Expect = 8e-10
Identities = 44/123 (35%), Positives = 66/123 (53%), Gaps = 1/123 (0%)
Frame = +1

Query: 229 ERLVSAARDGDLVEARALLEFNPLLAR-YSTFGALNSPLHFAAAKGHNEIVNLLLEHGAD 405
+ L+ +AR G+ + ALL PL +++ G ++PLH AA +IV LLL+HGAD
Sbjct: 179 DELLESARSGNEEKMMALL--TPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGAD 236

Query: 406 VNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIRL 585
V+ ++ L AC YGH+EV + L+ + V+ D L + T H AA L
Sbjct: 237 VHAKDKGDLVPLHNACSYGHYEVTELLVKHGACVNAMD-LWQFTPLHEAASKNRVEVCSL 295

Query: 586 LVS 594
L+S
Sbjct: 296 LLS 298



Score = 59.3 bits (142), Expect = 2e-08
Identities = 41/120 (34%), Positives = 59/120 (49%)
Frame = +1

Query: 235 LVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNI 414
L+ AA+ G L + L + + R T G ++PLH AA + E+ LL+HGADVN
Sbjct: 649 LLDAAKKGCLARVKKLSSPDNVNCR-DTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNA 707

Query: 415 RNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIRLLVS 594
++ G L A YGH +V L+ Y V+ D T H AA G + LL++
Sbjct: 708 QDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKW-AFTPLHEAAQKGRTQLCALLLA 766



Score = 48.9 bits (115), Expect = 2e-05
Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 3/126 (2%)
Frame = +1

Query: 226 GERLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGH---NEIVNLLLEH 396
G L+ AAR+ D+ + L + + + LH AAA + +I LLL
Sbjct: 332 GHSLLQAAREADVTRIKKHLSLE--MVNFKHPQTHETALHCAAASPYPKRKQICELLLRK 389

Query: 397 GADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARC 576
GA++N + T L A H +VV+ ++ ++ V+ D L + T+ H AA GH +
Sbjct: 390 GANINEKTKEFLTPLHVASEKAHNDVVEVVVKHEAKVNALDNLGQ-TSLHRAAYCGHLQT 448

Query: 577 IRLLVS 594
RLL+S
Sbjct: 449 CRLLLS 454



Score = 48.9 bits (115), Expect = 2e-05
Identities = 22/54 (40%), Positives = 35/54 (64%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLY 495
+PLH A+ K HN++V ++++H A VN + GQT+L +A GH + + LL Y
Sbjct: 402 TPLHVASEKAHNDVVEVVVKHEAKVNALDNLGQTSLHRAAYCGHLQTCRLLLSY 455



Score = 42.4 bits (98), Expect = 0.002
Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 20/106 (18%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTA--------------------LMQAC 453
+PLH AA KG ++ +LL+HGA+ IRN G+TA L+++
Sbjct: 126 TPLHEAAIKGKIDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDELLESA 185

Query: 454 RYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIRLLV 591
R G+ E + LL A + T H AA + ++LL+
Sbjct: 186 RSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLL 231



Score = 42.0 bits (97), Expect = 0.003
Identities = 26/69 (37%), Positives = 38/69 (55%)
Frame = +1

Query: 235 LVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNI 414
L +AA G + A L+++N + + +PLH AA KG ++ LLL HGAD +
Sbjct: 716 LHNAASYGHVDVAALLIKYNACVNATDKWAF--TPLHEAAQKGRTQLCALLLAHGADPTL 773

Query: 415 RNYCGQTAL 441
+N GQT L
Sbjct: 774 KNQEGQTPL 782



Score = 41.2 bits (95), Expect = 0.004
Identities = 21/36 (58%), Positives = 24/36 (66%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTAL 441
+PLH AAAKG EI LLL+HGAD +N G T L
Sbjct: 594 TPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPL 629



Score = 39.7 bits (91), Expect = 0.013
Identities = 22/53 (41%), Positives = 28/53 (52%)
Frame = +1

Query: 337 PLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLY 495
PLH A + GH E+ LL++HGA VN + T L +A EV LL Y
Sbjct: 247 PLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSY 299



Score = 34.3 bits (77), Expect = 0.54
Identities = 18/53 (33%), Positives = 30/53 (56%)
Frame = +1

Query: 337 PLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLY 495
PLH AA+ GH ++ LL+++ A VN + T L +A + G ++ LL +
Sbjct: 715 PLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAH 767



Score = 32.7 bits (73), Expect = 1.6
Identities = 15/36 (41%), Positives = 24/36 (66%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTAL 441
+PLH AA+K E+ +LLL +GAD + N ++A+
Sbjct: 279 TPLHEAASKNRVEVCSLLLSYGADPTLLNCHNKSAI 314



Score = 30.4 bits (67), Expect = 7.7
Identities = 17/34 (50%), Positives = 20/34 (58%)
Frame = +1

Query: 340 LHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTAL 441
LH AA GH + LLL +G D NI + G TAL
Sbjct: 437 LHRAAYCGHLQTCRLLLSYGCDPNIISLQGFTAL 470


>sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6
regulatory ankyrin repeat subunit B OS=Homo sapiens
GN=ANKRD44 PE=1 SV=3
Length = 993

Score = 73.2 bits (178), Expect = 1e-12
Identities = 37/93 (39%), Positives = 56/93 (60%)
Frame = +1

Query: 313 STFGALNSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLL 492
S GA SPLH AA GH++ + +LL+ D++IR+ G+TAL A GH E V+ L+
Sbjct: 562 SDSGATKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALDLAAFKGHTECVEALIN 621

Query: 493 YKGNVSRADYLNRRTAFHFAAVNGHARCIRLLV 591
++ D + +RT H + +NGH C+RLL+
Sbjct: 622 QGASIFVKDNVTKRTPLHASVINGHTLCLRLLL 654



Score = 57.0 bits (136), Expect = 8e-08
Identities = 33/93 (35%), Positives = 49/93 (52%), Gaps = 3/93 (3%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGAD---VNIRNYCGQTALMQACRYGHWEVVQTLLLYKGN 504
+PLH + GH + LLLE + V++++ GQT LM A YGH + V LL + N
Sbjct: 636 TPLHASVINGHTLCLRLLLEIADNPEAVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEAN 695

Query: 505 VSRADYLNRRTAFHFAAVNGHARCIRLLVSDYI 603
V D L TA H + GH C+++L+ +
Sbjct: 696 VDTVDILG-CTALHRGIMTGHEECVQMLLEQEV 727



Score = 55.8 bits (133), Expect = 2e-07
Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 1/89 (1%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH AA+ G +V LL G +++ N G TAL AC G VV L+ Y NV++
Sbjct: 208 TPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQ 267

Query: 514 ADYLNRRTAFHFAAVNGH-ARCIRLLVSD 597
+ N T HFAA + H A C+ LLV++
Sbjct: 268 PNN-NGFTPLHFAAASTHGALCLELLVNN 295



Score = 52.0 bits (123), Expect = 2e-06
Identities = 31/87 (35%), Positives = 47/87 (54%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH A A E V +L++H ADVN R+ QT L A + + ++ +V+
Sbjct: 76 TPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNV 135

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVS 594
+D RTA H AA+NGH + LL++
Sbjct: 136 SD-RGGRTALHHAALNGHVEMVNLLLA 161



Score = 51.6 bits (122), Expect = 3e-06
Identities = 32/88 (36%), Positives = 48/88 (54%), Gaps = 1/88 (1%)
Frame = +1

Query: 334 SPLHFAAAKGHNEI-VNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVS 510
+PLHFAAA H + + LL+ +GADVNI++ G++ L +G + QTL+ G +
Sbjct: 274 TPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEID 333

Query: 511 RADYLNRRTAFHFAAVNGHARCIRLLVS 594
D + T H AA GH I L++
Sbjct: 334 CVD-KDGNTPLHVAARYGHELLINTLIT 360



Score = 51.6 bits (122), Expect = 3e-06
Identities = 33/79 (41%), Positives = 44/79 (55%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PL A A GH + V+LLLE A+V+ + G TAL + GH E VQ LL + ++
Sbjct: 672 TPLMLAVAYGHIDAVSLLLEKEANVDTVDILGCTALHRGIMTGHEECVQMLLEQEVSILC 731

Query: 514 ADYLNRRTAFHFAAVNGHA 570
D RT H+AA GHA
Sbjct: 732 KD-SRGRTPLHYAAARGHA 749



Score = 51.2 bits (121), Expect = 4e-06
Identities = 31/87 (35%), Positives = 48/87 (55%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH AAA + +++ + VN+ + G+TAL A GH E+V LL N++
Sbjct: 109 TPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINA 168

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVS 594
D +RR A H+AA GH + LL++
Sbjct: 169 FDKKDRR-ALHWAAYMGHLDVVALLIN 194



Score = 51.2 bits (121), Expect = 4e-06
Identities = 29/74 (39%), Positives = 42/74 (56%)
Frame = +1

Query: 340 LHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRAD 519
LH AAA G+ E + LL GAD + ++ CG+T L A H+ ++TL+ NV+ D
Sbjct: 409 LHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNETD 468

Query: 520 YLNRRTAFHFAAVN 561
RTA H+AA +
Sbjct: 469 DWG-RTALHYAAAS 481



Score = 50.8 bits (120), Expect = 6e-06
Identities = 41/123 (33%), Positives = 58/123 (47%), Gaps = 4/123 (3%)
Frame = +1

Query: 235 LVSAARDGDLVEARALL----EFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGA 402
LV A GD E R L+ + N L + T PLH AA G EI+ LL+ GA
Sbjct: 12 LVQAIFSGDPEEIRMLIHKTEDVNTLDSEKRT------PLHVAAFLGDAEIIELLILSGA 65

Query: 403 DVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIR 582
VN ++ T L +A E VQ L+ + +V+ D N +T H AA N +C
Sbjct: 66 RVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARD-KNWQTPLHVAAANKAVKCAE 124

Query: 583 LLV 591
+++
Sbjct: 125 VII 127



Score = 50.8 bits (120), Expect = 6e-06
Identities = 33/90 (36%), Positives = 44/90 (48%), Gaps = 4/90 (4%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
+PLH AA H E + LLL H A VN + G+TALM A G V L+ N ++
Sbjct: 841 TPLHAAAFADHVECLQLLLRHSAPVNAVDNSGKTALMMAAENGQAGAVDILV----NSAQ 896

Query: 514 ADYL----NRRTAFHFAAVNGHARCIRLLV 591
AD + T H A GH +C L++
Sbjct: 897 ADLTVKDKDLNTPLHLACSKGHEKCALLIL 926



Score = 50.1 bits (118), Expect = 9e-06
Identities = 27/87 (31%), Positives = 45/87 (51%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSR 513
SPLH A G L+++G +++ + G T L A RYGH ++ TL+ + ++
Sbjct: 308 SPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLITSGADTAK 367

Query: 514 ADYLNRRTAFHFAAVNGHARCIRLLVS 594
++ H AA+N H+ C R L+S
Sbjct: 368 CG-IHSMFPLHLAALNAHSDCCRKLLS 393



Score = 49.7 bits (117), Expect = 1e-05
Identities = 32/85 (37%), Positives = 45/85 (52%)
Frame = +1

Query: 340 LHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRAD 519
LH AA GH E+VNLLL GA++N + + AL A GH +VV L+ + V+ D
Sbjct: 144 LHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKD 203

Query: 520 YLNRRTAFHFAAVNGHARCIRLLVS 594
T H AA NG ++ L++
Sbjct: 204 -KKGYTPLHAAASNGQINVVKHLLN 227



Score = 48.1 bits (113), Expect = 4e-05
Identities = 28/86 (32%), Positives = 42/86 (48%)
Frame = +1

Query: 337 PLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRA 516
PLH AA H++ LL G +++ + G+T L A G+ E ++ L + +
Sbjct: 375 PLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVECIKLLQSSGADFHKK 434

Query: 517 DYLNRRTAFHFAAVNGHARCIRLLVS 594
D RT H+AA N H CI LV+
Sbjct: 435 DKCG-RTPLHYAAANCHFHCIETLVT 459



Score = 46.6 bits (109), Expect = 1e-04
Identities = 30/88 (34%), Positives = 39/88 (44%)
Frame = +1

Query: 331 NSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVS 510
N+PLH AA GH ++N L+ GAD L A H + + LL +
Sbjct: 340 NTPLHVAARYGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEID 399

Query: 511 RADYLNRRTAFHFAAVNGHARCIRLLVS 594
D RT H AA G+ CI+LL S
Sbjct: 400 TPDKFG-RTCLHAAAAGGNVECIKLLQS 426



Score = 45.8 bits (107), Expect = 2e-04
Identities = 32/110 (29%), Positives = 52/110 (47%)
Frame = +1

Query: 235 LVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNI 414
L +AA +G + + LL + + +G N+ LH A G + +VN L+++GA+VN
Sbjct: 210 LHAAASNGQINVVKHLLNLGVEIDEINVYG--NTALHIACYNGQDAVVNELIDYGANVNQ 267

Query: 415 RNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNG 564
N G T L A H + LL+ G + ++ H AV+G
Sbjct: 268 PNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHG 317



Score = 42.4 bits (98), Expect = 0.002
Identities = 30/90 (33%), Positives = 44/90 (48%), Gaps = 4/90 (4%)
Frame = +1

Query: 334 SPLHFAAAKGH----NEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKG 501
+PLH+AAA+GH +E++ + L D ++ G T L AC G+ ++ LL K
Sbjct: 738 TPLHYAAARGHATWLSELLQMALSE-EDCCFKDNQGYTPLHWACYNGNENCIEVLLEQK- 795

Query: 502 NVSRADYLNRRTAFHFAAVNGHARCIRLLV 591
R N T H A +N H C LL+
Sbjct: 796 -CFRKFIGNPFTPLHCAIINDHGNCASLLL 824



Score = 38.9 bits (89), Expect = 0.022
Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 2/86 (2%)
Frame = +1

Query: 340 LHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRAD 519
LH GH E V +LLE + ++ G+T L A GH + LL +
Sbjct: 707 LHRGIMTGHEECVQMLLEQEVSILCKDSRGRTPLHYAAARGHATWLSELLQMALSEEDCC 766

Query: 520 YLNRR--TAFHFAAVNGHARCIRLLV 591
+ + + T H+A NG+ CI +L+
Sbjct: 767 FKDNQGYTPLHWACYNGNENCIEVLL 792



Score = 38.5 bits (88), Expect = 0.028
Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 3/57 (5%)
Frame = +1

Query: 328 LNSPLHFAAAKGHNEIVNLLLEHGAD---VNIRNYCGQTALMQACRYGHWEVVQTLL 489
LN+PLH A +KGH + L+L+ D +N +N QT L A R G VV+ LL
Sbjct: 906 LNTPLHLACSKGHEKCALLILDKIQDESLINEKNNALQTPLHVAARNGLKVVVEELL 962



Score = 36.6 bits (83), Expect = 0.11
Identities = 20/77 (25%), Positives = 39/77 (50%), Gaps = 1/77 (1%)
Frame = +1

Query: 376 VNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLL-LYKGNVSRADYLNRRTAFHFA 552
+ LL++ A+ +IR+ G ++ A YGH + ++ LL +D ++ H A
Sbjct: 515 LEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNSGFEESDSGATKSPLHLA 574

Query: 553 AVNGHARCIRLLVSDYI 603
A NGH + + +L+ +
Sbjct: 575 AYNGHHQALEVLLQSLV 591



Score = 34.7 bits (78), Expect = 0.41
Identities = 33/117 (28%), Positives = 49/117 (41%), Gaps = 31/117 (26%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGN--- 504
+PLH+AAA H + L+ GA+VN + G+TAL A + +T+L GN
Sbjct: 440 TPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAA-SDMDRNKTIL---GNAHD 495

Query: 505 ----VSRADYLNRRTA------------------------FHFAAVNGHARCIRLLV 591
+ RA L + A H+AA GH +C+ LL+
Sbjct: 496 NSEELERARELKEKEATLCLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLL 552


>sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=1
Length = 1327

Score = 69.7 bits (169), Expect = 1e-11
Identities = 44/120 (36%), Positives = 64/120 (53%)
Frame = +1

Query: 232 RLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVN 411
RL+ A++ GDL + L + R G ++PLHFAA +V LL HGADV+
Sbjct: 653 RLLEASKAGDLETVKQLCSSQNVNCR-DLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVH 711

Query: 412 IRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIRLLV 591
++ G L AC YGH+EV + L+ + +V+ AD L + T H AA G +LL+
Sbjct: 712 AKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVAD-LWKFTPLHEAAAKGKYEICKLLL 770



Score = 68.2 bits (165), Expect = 3e-11
Identities = 47/123 (38%), Positives = 66/123 (53%), Gaps = 1/123 (0%)
Frame = +1

Query: 229 ERLVSAARDGDLVEARALLEFNPLLAR-YSTFGALNSPLHFAAAKGHNEIVNLLLEHGAD 405
+ L+ AAR G+ + ALL PL +++ G ++PLH AA IV LLL+HGAD
Sbjct: 337 DELLEAARSGNEEKLMALL--TPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGAD 394

Query: 406 VNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIRL 585
V+ ++ G L AC YGH+EV + LL + V+ D L + T H AA L
Sbjct: 395 VHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMD-LWQFTPLHEAASKNRVEVCSL 453

Query: 586 LVS 594
L+S
Sbjct: 454 LLS 456



Score = 65.9 bits (159), Expect = 2e-10
Identities = 47/133 (35%), Positives = 69/133 (51%), Gaps = 1/133 (0%)
Frame = +1

Query: 217 SASGERLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEH 396
S + L+ A R+GD+ + L++ + A+ G +SPLHFAA G ++V LL+
Sbjct: 180 SGALRELLEACRNGDVSRVKRLVDAANVNAK-DMAGRKSSPLHFAAGFGRKDVVEHLLQM 238

Query: 397 GADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHAR- 573
GA+V+ R+ G L AC +GH EVV LL + + D N T H AA+ G
Sbjct: 239 GANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWN-YTPLHEAAIKGKIDV 297

Query: 574 CIRLLVSDYIPSV 612
CI LL P++
Sbjct: 298 CIVLLQHGADPNI 310



Score = 58.9 bits (141), Expect = 2e-08
Identities = 41/120 (34%), Positives = 58/120 (48%)
Frame = +1

Query: 235 LVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNI 414
L+ AA+ G L + L + R T G ++PLH AA + E+ LLEHGADVN
Sbjct: 807 LLDAAKKGCLARVQKLCTPENINCR-DTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNA 865

Query: 415 RNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIRLLVS 594
++ G L A YGH ++ L+ Y V+ D T H AA G + LL++
Sbjct: 866 QDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKW-AFTPLHEAAQKGRTQLCALLLA 924



Score = 54.3 bits (129), Expect = 5e-07
Identities = 40/126 (31%), Positives = 62/126 (49%), Gaps = 3/126 (2%)
Frame = +1

Query: 226 GERLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGH---NEIVNLLLEH 396
G L+ AAR+ DL + + L + + + + LH A A H ++ LLL
Sbjct: 490 GHSLLQAAREADLAKVKKTLALE--IINFKQPQSHETALHCAVASLHPKRKQVTELLLRK 547

Query: 397 GADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARC 576
GA+VN +N T L A H +V++ L + ++ D L + TA H AA+ GH +
Sbjct: 548 GANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQ-TALHRAALAGHLQT 606

Query: 577 IRLLVS 594
RLL+S
Sbjct: 607 CRLLLS 612



Score = 50.8 bits (120), Expect = 6e-06
Identities = 24/59 (40%), Positives = 37/59 (62%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVS 510
+PLH AA + HN+++ +L +HGA +N + GQTAL +A GH + + LL Y + S
Sbjct: 560 TPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHRAALAGHLQTCRLLLSYGSDPS 618



Score = 47.0 bits (110), Expect = 8e-05
Identities = 34/106 (32%), Positives = 49/106 (46%), Gaps = 20/106 (18%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTA--------------------LMQAC 453
+PLH AA KG ++ +LL+HGAD NIRN G++A L++A
Sbjct: 284 TPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAA 343

Query: 454 RYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIRLLV 591
R G+ E + LL A + T H AA R ++LL+
Sbjct: 344 RSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLL 389



Score = 41.2 bits (95), Expect = 0.004
Identities = 26/69 (37%), Positives = 38/69 (55%)
Frame = +1

Query: 235 LVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNI 414
L +AA G + A L+++N + + +PLH AA KG ++ LLL HGAD +
Sbjct: 874 LHNAASYGHVDIAALLIKYNTCVNATDKWAF--TPLHEAAQKGRTQLCALLLAHGADPTM 931

Query: 415 RNYCGQTAL 441
+N GQT L
Sbjct: 932 KNQEGQTPL 940



Score = 40.8 bits (94), Expect = 0.006
Identities = 21/36 (58%), Positives = 24/36 (66%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTAL 441
+PLH AAAKG EI LLL+HGAD +N G T L
Sbjct: 752 TPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPL 787



Score = 37.0 bits (84), Expect = 0.083
Identities = 18/39 (46%), Positives = 26/39 (66%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQA 450
+PLH AA+K E+ +LLL HGAD + N G++A+ A
Sbjct: 437 TPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMA 475



Score = 33.1 bits (74), Expect = 1.2
Identities = 18/53 (33%), Positives = 29/53 (54%)
Frame = +1

Query: 337 PLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLY 495
PLH AA+ GH +I LL+++ VN + T L +A + G ++ LL +
Sbjct: 873 PLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAH 925


>sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1
SV=3
Length = 1990

Score = 68.6 bits (166), Expect = 3e-11
Identities = 49/132 (37%), Positives = 67/132 (50%)
Frame = +1

Query: 202 NSFGCSASGERLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVN 381
NSF L +AA G L R LLE +A+ + GA+ PL +GH +IV+
Sbjct: 1027 NSFDSLWGETALTAAAGRGKLEVCRLLLEQGAAVAQPNRRGAV--PLFSTVRQGHWQIVD 1084

Query: 382 LLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVN 561
LLL HGADVN+ + G+T LM A GH V LL +++ D TA +A +
Sbjct: 1085 LLLTHGADVNMADKQGRTPLMMAASEGHLGTVDFLLAQGASIALMD-KEGLTALSWACLK 1143

Query: 562 GHARCIRLLVSD 597
GH +R LV +
Sbjct: 1144 GHLSVVRSLVDN 1155



Score = 41.6 bits (96), Expect = 0.003
Identities = 32/100 (32%), Positives = 47/100 (47%)
Frame = +1

Query: 235 LVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNI 414
L+ AA +G L LL +A G + L +A KGH +V L+++GA +
Sbjct: 1104 LMMAASEGHLGTVDFLLAQGASIALMDKEGL--TALSWACLKGHLSVVRSLVDNGAATDH 1161

Query: 415 RNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRR 534
+ G+T L A YG EVVQ L+ + + DY R
Sbjct: 1162 ADKNGRTPLDLAAFYGDAEVVQFLVDHGAMIEHVDYSGMR 1201



Score = 39.7 bits (91), Expect = 0.013
Identities = 29/70 (41%), Positives = 39/70 (55%)
Frame = +1

Query: 280 LLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRY 459
LLEF + S G +PL +AAA G+ IV LL + A V+ + GQ AL+ A
Sbjct: 904 LLEFGANVDASSESGL--TPLGYAAAAGYLSIVVLLCKKRAKVDHLDKNGQCALVHAALR 961

Query: 460 GHWEVVQTLL 489
GH EVV+ L+
Sbjct: 962 GHLEVVKFLI 971



Score = 34.3 bits (77), Expect = 0.54
Identities = 20/52 (38%), Positives = 28/52 (53%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLL 489
+PL AA G E+V L++HGA + +Y G L +A + VV TLL
Sbjct: 1168 TPLDLAAFYGDAEVVQFLVDHGAMIEHVDYSGMRPLDRAVGCRNTSVVVTLL 1219


>sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1
SV=1
Length = 1994

Score = 68.2 bits (165), Expect = 3e-11
Identities = 49/132 (37%), Positives = 67/132 (50%)
Frame = +1

Query: 202 NSFGCSASGERLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVN 381
NSF L +AA G L R LLE +A+ + GA+ PL +GH +IV+
Sbjct: 1027 NSFDSLWGETALTAAAGRGKLDVCRLLLEQGAAVAQPNRRGAV--PLFSTVRQGHWQIVD 1084

Query: 382 LLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVN 561
LLL HGADVN+ + G+T LM A GH V LL +++ D TA +A +
Sbjct: 1085 LLLTHGADVNMADKQGRTPLMMAASEGHLGTVDFLLAQGASIALMD-KEGLTALSWACLK 1143

Query: 562 GHARCIRLLVSD 597
GH +R LV +
Sbjct: 1144 GHLSVVRSLVDN 1155



Score = 41.6 bits (96), Expect = 0.003
Identities = 32/100 (32%), Positives = 47/100 (47%)
Frame = +1

Query: 235 LVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNI 414
L+ AA +G L LL +A G + L +A KGH +V L+++GA +
Sbjct: 1104 LMMAASEGHLGTVDFLLAQGASIALMDKEGL--TALSWACLKGHLSVVRSLVDNGAATDH 1161

Query: 415 RNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRR 534
+ G+T L A YG EVVQ L+ + + DY R
Sbjct: 1162 ADKNGRTPLDLAAFYGDAEVVQFLVDHGAMIEHVDYSGMR 1201



Score = 38.5 bits (88), Expect = 0.028
Identities = 29/70 (41%), Positives = 38/70 (54%)
Frame = +1

Query: 280 LLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRY 459
LLEF + S G +PL +AAA G IV LL + A V+ + GQ AL+ A
Sbjct: 904 LLEFGANVDASSESGL--TPLGYAAAAGFLSIVVLLCKKRAKVDHLDKNGQCALVHAALR 961

Query: 460 GHWEVVQTLL 489
GH EVV+ L+
Sbjct: 962 GHLEVVKFLI 971



Score = 34.3 bits (77), Expect = 0.54
Identities = 20/52 (38%), Positives = 28/52 (53%)
Frame = +1

Query: 334 SPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLL 489
+PL AA G E+V L++HGA + +Y G L +A + VV TLL
Sbjct: 1168 TPLDLAAFYGDAEVVQFLVDHGAMIEHVDYSGMRPLDRAVGCRNTSVVVTLL 1219


>sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=2
SV=2
Length = 978

Score = 68.2 bits (165), Expect = 3e-11
Identities = 42/127 (33%), Positives = 67/127 (52%), Gaps = 1/127 (0%)
Frame = +1

Query: 229 ERLVSAARDGDLVEARALLEFNPLLA-RYSTFGALNSPLHFAAAKGHNEIVNLLLEHGAD 405
+RL+ A +GD + +LL A ++ + G + H AAAKGH E + +++ HG D
Sbjct: 21 DRLLQAVENGDAEKVASLLGKKGASATKHDSEG--KTAFHLAAAKGHVECLKVMVTHGVD 78

Query: 406 VNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIRL 585
V ++ G +AL A + GH E ++ LL YK D L +TA H+AA G + +++
Sbjct: 79 VTAQDSSGHSALHIAAKNGHPEYIKKLLQYKSPAESVDNLG-KTALHYAAAQGSLQAVQV 137

Query: 586 LVSDYIP 606
L P
Sbjct: 138 LCEHKSP 144



Score = 57.4 bits (137), Expect = 6e-08
Identities = 40/117 (34%), Positives = 59/117 (50%)
Frame = +1

Query: 244 AARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEHGADVNIRNY 423
AA G L + L E + G N PL A GH+E + LL+HGADVN R+
Sbjct: 126 AAAQGSLQAVQVLCEHKSPINLKDLDG--NIPLLVAIQNGHSEACHFLLDHGADVNSRDK 183

Query: 424 CGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARCIRLLVS 594
G+TALM AC G V+ L+ +++ D L A +++ ++ +A LL+S
Sbjct: 184 NGRTALMLACETGSANTVEALIKKGADLNLVDSLG-HNALYYSKLSENAGIQSLLLS 239



Score = 53.1 bits (126), Expect = 1e-06
Identities = 37/125 (29%), Positives = 60/125 (48%)
Frame = +1

Query: 217 SASGERLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEIVNLLLEH 396
S+ L AA++G + LL++ G + LH+AAA+G + V +L EH
Sbjct: 84 SSGHSALHIAAKNGHPEYIKKLLQYKSPAESVDNLG--KTALHYAAAQGSLQAVQVLCEH 141

Query: 397 GADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAAVNGHARC 576
+ +N+++ G L+ A + GH E LL + +V+ D N RTA A G A
Sbjct: 142 KSPINLKDLDGNIPLLVAIQNGHSEACHFLLDHGADVNSRD-KNGRTALMLACETGSANT 200

Query: 577 IRLLV 591
+ L+
Sbjct: 201 VEALI 205


tr_hit_id A7QVH7
Definition tr|A7QVH7|A7QVH7_VITVI Chromosome chr16 scaffold_189, whole genome shotgun sequence OS=Vitis vinifera
Align length 141
Score (bit) 246.0
E-value 1.0e-63
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK955918|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0024_G03, 5'
(626 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QVH7|A7QVH7_VITVI Chromosome chr16 scaffold_189, whole geno... 246 1e-63
tr|Q9LYN9|Q9LYN9_ARATH Putative uncharacterized protein T28J14_2... 240 4e-62
tr|Q4FE45|Q4FE45_ARATH At5g07270 OS=Arabidopsis thaliana PE=2 SV=1 240 4e-62
tr|Q4VG19|Q4VG19_LILLO Pollen ankyrin-like protein OS=Lilium lon... 240 6e-62
tr|A9RJI4|A9RJI4_PHYPA Predicted protein (Fragment) OS=Physcomit... 235 1e-60
tr|A9S844|A9S844_PHYPA Predicted protein (Fragment) OS=Physcomit... 234 2e-60
tr|Q6KAE5|Q6KAE5_ORYSJ Os02g0791200 protein OS=Oryza sativa subs... 229 8e-59
tr|A3AC59|A3AC59_ORYSJ Putative uncharacterized protein OS=Oryza... 229 1e-58
tr|A2XAF8|A2XAF8_ORYSI Putative uncharacterized protein OS=Oryza... 229 1e-58
tr|B7ZWT3|B7ZWT3_MAIZE Putative uncharacterized protein OS=Zea m... 228 2e-58
tr|A7PFF7|A7PFF7_VITVI Chromosome chr11 scaffold_14, whole genom... 228 2e-58
tr|Q8LNI4|Q8LNI4_ORYSJ Putative uncharacterized protein OSJNBb00... 225 2e-57
tr|Q337A0|Q337A0_ORYSJ cDNA clone:J013002G21, full insert sequen... 225 2e-57
tr|Q109E0|Q109E0_ORYSJ Pollen ankyrin, putative, expressed OS=Or... 225 2e-57
tr|B8BHX4|B8BHX4_ORYSI Putative uncharacterized protein OS=Oryza... 225 2e-57
tr|A9TL53|A9TL53_PHYPA Predicted protein OS=Physcomitrella paten... 224 2e-57
tr|A7L3A0|A7L3A0_SOLTU Ankyrin repeat-rich protein OS=Solanum tu... 223 7e-57
tr|B6SXU0|B6SXU0_MAIZE Pollen ankyrin-like protein OS=Zea mays P... 222 1e-56
tr|B6SWT5|B6SWT5_MAIZE Pollen ankyrin-like protein OS=Zea mays P... 222 1e-56
tr|Q6NLQ8|Q6NLQ8_ARATH At5g57740 OS=Arabidopsis thaliana GN=At5g... 220 6e-56
tr|B6U0P6|B6U0P6_MAIZE XBAT32 OS=Zea mays PE=2 SV=1 210 6e-53
tr|B4FYJ1|B4FYJ1_MAIZE Putative uncharacterized protein OS=Zea m... 210 6e-53
tr|Q7EZ44|Q7EZ44_ORYSJ Os08g0258200 protein OS=Oryza sativa subs... 209 1e-52
tr|A2YT41|A2YT41_ORYSI Putative uncharacterized protein OS=Oryza... 209 1e-52
tr|A5BJG3|A5BJG3_VITVI Putative uncharacterized protein OS=Vitis... 205 2e-51
tr|Q4JHE0|Q4JHE0_ORYSJ XB3-related protein OS=Oryza sativa subsp... 181 4e-44
tr|Q9FHG9|Q9FHG9_ARATH Similarity to ankyrin OS=Arabidopsis thal... 171 3e-41
tr|A7NSS3|A7NSS3_VITVI Chromosome chr18 scaffold_1, whole genome... 144 4e-33
tr|Q9FWB4|Q9FWB4_ORYSJ Putative uncharacterized protein OSJNBb00... 138 2e-31
tr|A3B7Z9|A3B7Z9_ORYSJ Putative uncharacterized protein OS=Oryza... 129 1e-28

>tr|A7QVH7|A7QVH7_VITVI Chromosome chr16 scaffold_189, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00007371001
PE=4 SV=1
Length = 518

Score = 246 bits (627), Expect = 1e-63
Identities = 117/141 (82%), Positives = 130/141 (92%)
Frame = +1

Query: 196 MGNSFGCSASGERLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEI 375
MGNSFGCSASGERLVSAARDGDLVEA+ LL+ NP LA+YSTFG LNSPLHFAAAKGHNEI
Sbjct: 1 MGNSFGCSASGERLVSAARDGDLVEAKMLLDCNPCLAKYSTFGGLNSPLHFAAAKGHNEI 60

Query: 376 VNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAA 555
V LLLE+GADVN RNYCGQTALMQACRYGHWEVVQTLLL++ NV+RADYL+ RTA HFAA
Sbjct: 61 VALLLENGADVNSRNYCGQTALMQACRYGHWEVVQTLLLFRCNVTRADYLSGRTALHFAA 120

Query: 556 VNGHARCIRLLVSDYIPSVPY 618
VNGH RCIRL+V+D++PS P+
Sbjct: 121 VNGHVRCIRLVVADFVPSAPH 141


>tr|Q9LYN9|Q9LYN9_ARATH Putative uncharacterized protein T28J14_210
OS=Arabidopsis thaliana GN=T28J14_210 PE=4 SV=1
Length = 519

Score = 240 bits (613), Expect = 4e-62
Identities = 115/138 (83%), Positives = 127/138 (92%)
Frame = +1

Query: 196 MGNSFGCSASGERLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEI 375
MGNSFGCSASGERLVSAARDGD VEA+ LL+ NP LA+YSTFG LNSPLHFAAAKGHNEI
Sbjct: 1 MGNSFGCSASGERLVSAARDGDFVEAKMLLDCNPCLAKYSTFGGLNSPLHFAAAKGHNEI 60

Query: 376 VNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAA 555
V LLLE+GADVN RNYCGQTALMQACRYGHWEVVQTLLL++ NV+RADYL RTA HFAA
Sbjct: 61 VGLLLENGADVNSRNYCGQTALMQACRYGHWEVVQTLLLFRCNVTRADYLAGRTALHFAA 120

Query: 556 VNGHARCIRLLVSDYIPS 609
VNGHARCIRL+++D++PS
Sbjct: 121 VNGHARCIRLVLADFLPS 138


>tr|Q4FE45|Q4FE45_ARATH At5g07270 OS=Arabidopsis thaliana PE=2 SV=1
Length = 513

Score = 240 bits (613), Expect = 4e-62
Identities = 115/138 (83%), Positives = 127/138 (92%)
Frame = +1

Query: 196 MGNSFGCSASGERLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEI 375
MGNSFGCSASGERLVSAARDGD VEA+ LL+ NP LA+YSTFG LNSPLHFAAAKGHNEI
Sbjct: 1 MGNSFGCSASGERLVSAARDGDFVEAKMLLDCNPCLAKYSTFGGLNSPLHFAAAKGHNEI 60

Query: 376 VNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAA 555
V LLLE+GADVN RNYCGQTALMQACRYGHWEVVQTLLL++ NV+RADYL RTA HFAA
Sbjct: 61 VGLLLENGADVNSRNYCGQTALMQACRYGHWEVVQTLLLFRCNVTRADYLAGRTALHFAA 120

Query: 556 VNGHARCIRLLVSDYIPS 609
VNGHARCIRL+++D++PS
Sbjct: 121 VNGHARCIRLVLADFLPS 138


>tr|Q4VG19|Q4VG19_LILLO Pollen ankyrin-like protein OS=Lilium
longiflorum PE=2 SV=1
Length = 517

Score = 240 bits (612), Expect = 6e-62
Identities = 113/141 (80%), Positives = 128/141 (90%)
Frame = +1

Query: 196 MGNSFGCSASGERLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEI 375
MGNS GCSASGERLVSAARDGD VEAR LLEF+P LA+YSTFG LNSPLHFAAAKGH EI
Sbjct: 1 MGNSLGCSASGERLVSAARDGDAVEARMLLEFSPCLAKYSTFGGLNSPLHFAAAKGHIEI 60

Query: 376 VNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAA 555
V +LLE+GADVN RNYCGQTALMQACR+GHWEVVQTLLL++ NV+RADY++ RTA HFAA
Sbjct: 61 VEMLLENGADVNSRNYCGQTALMQACRHGHWEVVQTLLLFRSNVTRADYMSGRTALHFAA 120

Query: 556 VNGHARCIRLLVSDYIPSVPY 618
++GH RCIRLLV+D++PS PY
Sbjct: 121 MDGHTRCIRLLVADFVPSTPY 141


>tr|A9RJI4|A9RJI4_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_21854 PE=4 SV=1
Length = 402

Score = 235 bits (600), Expect = 1e-60
Identities = 111/139 (79%), Positives = 126/139 (90%)
Frame = +1

Query: 196 MGNSFGCSASGERLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEI 375
MGNSFGCSASGERLVSAARDGDL EA+ALLE NP LA+YSTFG NSPLHF+A +GHNEI
Sbjct: 1 MGNSFGCSASGERLVSAARDGDLQEAQALLECNPRLAKYSTFGVRNSPLHFSAMQGHNEI 60

Query: 376 VNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAA 555
V LLLE G +VN RNYCGQTALMQACRYGHWEVVQTLLLY+ NV+RADYLN RTA HFAA
Sbjct: 61 VTLLLECGVEVNTRNYCGQTALMQACRYGHWEVVQTLLLYRANVNRADYLNGRTALHFAA 120

Query: 556 VNGHARCIRLLVSDYIPSV 612
V+GH+RCIRL+++D++PS+
Sbjct: 121 VSGHSRCIRLILADFVPSI 139


>tr|A9S844|A9S844_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_209624 PE=4 SV=1
Length = 437

Score = 234 bits (598), Expect = 2e-60
Identities = 111/143 (77%), Positives = 125/143 (87%)
Frame = +1

Query: 196 MGNSFGCSASGERLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEI 375
MGNSFGCSASGERLVSAARDGD EA+ALLE NP LA+YSTFG NSPLHF+A +GHNEI
Sbjct: 1 MGNSFGCSASGERLVSAARDGDFQEAQALLECNPRLAKYSTFGVRNSPLHFSAIQGHNEI 60

Query: 376 VNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAA 555
V LLLE G +VN RNYCGQTALMQACRYGHWEVVQTLLL++ NV RADYLN RTA HFAA
Sbjct: 61 VTLLLECGVEVNTRNYCGQTALMQACRYGHWEVVQTLLLHRANVHRADYLNGRTALHFAA 120

Query: 556 VNGHARCIRLLVSDYIPSVPYRW 624
V+GH RC+RL+++D++ SVPY W
Sbjct: 121 VSGHTRCMRLVLADFMSSVPYLW 143


>tr|Q6KAE5|Q6KAE5_ORYSJ Os02g0791200 protein OS=Oryza sativa subsp.
japonica GN=OJ1046_F07.26 PE=2 SV=1
Length = 531

Score = 229 bits (585), Expect = 8e-59
Identities = 110/161 (68%), Positives = 132/161 (81%)
Frame = +1

Query: 142 GDPALQCXXXXXXXXXXXMGNSFGCSASGERLVSAARDGDLVEARALLEFNPLLARYSTF 321
GDP L+ +GNSFGCSASGERLVSAARDGDL EARALLE+NP LARYSTF
Sbjct: 28 GDPQLRASMGFLSL----VGNSFGCSASGERLVSAARDGDLQEARALLEYNPRLARYSTF 83

Query: 322 GALNSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKG 501
G NSPLH+AAA+GH+EIV+LLLE G ++N+RNY GQTALMQAC+YGHWEVVQTL+L+
Sbjct: 84 GGRNSPLHYAAAQGHHEIVSLLLESGVEINLRNYRGQTALMQACQYGHWEVVQTLMLFNA 143

Query: 502 NVSRADYLNRRTAFHFAAVNGHARCIRLLVSDYIPSVPYRW 624
NV R DYLN +A HFAA++GHARC+RL+++DY+PS+P W
Sbjct: 144 NVHRTDYLNGGSALHFAALHGHARCLRLVLADYVPSMPNFW 184



Score = 35.4 bits (80), Expect = 2.8
Identities = 18/43 (41%), Positives = 26/43 (60%)
Frame = +1

Query: 322 GALNSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQA 450
GA ++PLH+AA G+ LL+ GA ++ +N G T LM A
Sbjct: 257 GAGSTPLHYAACGGNAVCCQLLIARGASLSAQNASGWTPLMVA 299


>tr|A3AC59|A3AC59_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_008381 PE=4 SV=1
Length = 496

Score = 229 bits (584), Expect = 1e-58
Identities = 106/143 (74%), Positives = 127/143 (88%)
Frame = +1

Query: 196 MGNSFGCSASGERLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEI 375
+GNSFGCSASGERLVSAARDGDL EARALLE+NP LARYSTFG NSPLH+AAA+GH+EI
Sbjct: 7 VGNSFGCSASGERLVSAARDGDLQEARALLEYNPRLARYSTFGGRNSPLHYAAAQGHHEI 66

Query: 376 VNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAA 555
V+LLLE G ++N+RNY GQTALMQAC+YGHWEVVQTL+L+ NV R DYLN +A HFAA
Sbjct: 67 VSLLLESGVEINLRNYRGQTALMQACQYGHWEVVQTLMLFNANVHRTDYLNGGSALHFAA 126

Query: 556 VNGHARCIRLLVSDYIPSVPYRW 624
++GHARC+RL+++DY+PS+P W
Sbjct: 127 LHGHARCLRLVLADYVPSMPNFW 149



Score = 35.4 bits (80), Expect = 2.8
Identities = 18/43 (41%), Positives = 26/43 (60%)
Frame = +1

Query: 322 GALNSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQA 450
GA ++PLH+AA G+ LL+ GA ++ +N G T LM A
Sbjct: 222 GAGSTPLHYAACGGNAVCCQLLIARGASLSAQNASGWTPLMVA 264


>tr|A2XAF8|A2XAF8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_09236 PE=4 SV=1
Length = 496

Score = 229 bits (584), Expect = 1e-58
Identities = 106/143 (74%), Positives = 127/143 (88%)
Frame = +1

Query: 196 MGNSFGCSASGERLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEI 375
+GNSFGCSASGERLVSAARDGDL EARALLE+NP LARYSTFG NSPLH+AAA+GH+EI
Sbjct: 7 VGNSFGCSASGERLVSAARDGDLQEARALLEYNPRLARYSTFGGRNSPLHYAAAQGHHEI 66

Query: 376 VNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAA 555
V+LLLE G ++N+RNY GQTALMQAC+YGHWEVVQTL+L+ NV R DYLN +A HFAA
Sbjct: 67 VSLLLESGVEINLRNYRGQTALMQACQYGHWEVVQTLMLFNANVHRTDYLNGGSALHFAA 126

Query: 556 VNGHARCIRLLVSDYIPSVPYRW 624
++GHARC+RL+++DY+PS+P W
Sbjct: 127 LHGHARCLRLVLADYVPSMPNFW 149



Score = 35.4 bits (80), Expect = 2.8
Identities = 18/43 (41%), Positives = 26/43 (60%)
Frame = +1

Query: 322 GALNSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQA 450
GA ++PLH+AA G+ LL+ GA ++ +N G T LM A
Sbjct: 222 GAGSTPLHYAACGGNAVCCQLLIARGASLSAQNASGWTPLMVA 264


>tr|B7ZWT3|B7ZWT3_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 497

Score = 228 bits (582), Expect = 2e-58
Identities = 106/140 (75%), Positives = 126/140 (90%)
Frame = +1

Query: 196 MGNSFGCSASGERLVSAARDGDLVEARALLEFNPLLARYSTFGALNSPLHFAAAKGHNEI 375
+GNSFGCSASGERLVSAARDGDL EARALL++NP LARYSTFG NSPLH+AAA+GH+EI
Sbjct: 7 VGNSFGCSASGERLVSAARDGDLQEARALLQYNPRLARYSTFGGRNSPLHYAAAQGHHEI 66

Query: 376 VNLLLEHGADVNIRNYCGQTALMQACRYGHWEVVQTLLLYKGNVSRADYLNRRTAFHFAA 555
V+LLLE G ++N+RNY GQTALMQAC+YGHWEVVQTL+L+ NV R DYLN TA HFAA
Sbjct: 67 VSLLLESGVEINLRNYRGQTALMQACQYGHWEVVQTLILFNANVHRTDYLNGGTALHFAA 126

Query: 556 VNGHARCIRLLVSDYIPSVP 615
++GHARC+RL+++DY+PSVP
Sbjct: 127 LHGHARCLRLVLADYVPSVP 146



Score = 35.4 bits (80), Expect = 2.8
Identities = 18/43 (41%), Positives = 26/43 (60%)
Frame = +1

Query: 322 GALNSPLHFAAAKGHNEIVNLLLEHGADVNIRNYCGQTALMQA 450
GA ++PLH+AA G+ LL+ GA + ++N G T LM A
Sbjct: 222 GAGSTPLHYAACGGNAVCCQLLIARGACIAVQNASGWTPLMVA 264