DK956034
Clone id TST39A01NGRL0024_K23
Library
Length 493
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0024_K23. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID
Sequence
TTTGAGCTCGCTGCCGCGAAGATCACCATGGCGATATCTCGTTTGCTTCGACGGGCTTCT
TCGTCTGCCATCGCGCAGAGCTGTTCGTACAAGACTGCTTCGCTTCCGGTCGATAAAAAT
GTTGCAAGCCAGATTGCCTCTATGTTATCGAGAAGATGGCTCGATAGTGCAAGGGCTTTC
AGCTCAAAGGCGGGTGGTGGTGAAATCATTGGAATTGACCTTGGGACCACCAATTCTTGT
GTGTCTGTCATGGAAGGGAAGAGCCCTCGGGTGATTGAGAACTCTGAAGGGGCCCGAACA
ACGCCTTCTGTTGTTGCCTTCACATCCAAAGGTGAAAGGTTAGTGGGTACACCTGCCAAG
AGACAGGCCGTGATTAATCCTATGAACACGGTGTATGCTGCAAAGAGGCTGATAGGCCGC
ACCTACGATGATCCACAAGTGCAGAAAGAGAGCAAGATGGTTCCTTACAAGATTGTGAGG
GGGCCTAATGGAG
■■Homology search results ■■ -
sp_hit_id Q08276
Definition sp|Q08276|HSP7M_SOLTU Heat shock 70 kDa protein, mitochondrial OS=Solanum tuberosum
Align length 140
Score (bit) 181.0
E-value 1.0e-45
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK956034|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0024_K23, 5'
(493 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q08276|HSP7M_SOLTU Heat shock 70 kDa protein, mitochondrial O... 181 1e-45
sp|Q01899|HSP7M_PHAVU Heat shock 70 kDa protein, mitochondrial O... 177 2e-44
sp|P37900|HSP7M_PEA Heat shock 70 kDa protein, mitochondrial OS=... 169 8e-42
sp|P38647|GRP75_MOUSE Stress-70 protein, mitochondrial OS=Mus mu... 160 3e-39
sp|P11141|HSP7F_CAEEL Heat shock 70 kDa protein F, mitochondrial... 159 5e-39
sp|P48721|GRP75_RAT Stress-70 protein, mitochondrial OS=Rattus n... 159 5e-39
sp|P38646|GRP75_HUMAN Stress-70 protein, mitochondrial OS=Homo s... 159 5e-39
sp|Q5R511|GRP75_PONAB Stress-70 protein, mitochondrial OS=Pongo ... 159 7e-39
sp|Q3ZCH0|GRP75_BOVIN Stress-70 protein, mitochondrial OS=Bos ta... 159 7e-39
sp|O35501|GRP75_CRIGR Stress-70 protein, mitochondrial OS=Cricet... 159 9e-39
sp|Q5ZM98|GRP75_CHICK Stress-70 protein, mitochondrial OS=Gallus... 155 7e-38
sp|A1UUC3|DNAK_BARBK Chaperone protein dnaK OS=Bartonella bacill... 151 1e-36
sp|A8IPT1|DNAK_AZOC5 Chaperone protein dnaK OS=Azorhizobium caul... 151 1e-36
sp|Q07US6|DNAK_RHOP5 Chaperone protein dnaK OS=Rhodopseudomonas ... 151 2e-36
sp|Q98DD1|DNAK_RHILO Chaperone protein dnaK OS=Rhizobium loti GN... 151 2e-36
sp|Q21CI2|DNAK_RHOPB Chaperone protein dnaK OS=Rhodopseudomonas ... 150 2e-36
sp|A9ILH7|DNAK_BART1 Chaperone protein dnaK OS=Bartonella triboc... 150 2e-36
sp|Q6G1F9|DNAK_BARQU Chaperone protein dnaK OS=Bartonella quinta... 150 3e-36
sp|Q6G554|DNAK_BARHE Chaperone protein dnaK OS=Bartonella hensel... 150 3e-36
sp|Q5FSL5|DNAK_GLUOX Chaperone protein dnaK OS=Gluconobacter oxy... 149 5e-36
sp|Q2G6N0|DNAK_NOVAD Chaperone protein dnaK OS=Novosphingobium a... 149 7e-36
sp|P12398|HSP77_YEAST Heat shock protein SSC1, mitochondrial OS=... 149 9e-36
sp|A5V5P9|DNAK_SPHWW Chaperone protein dnaK OS=Sphingomonas witt... 149 9e-36
sp|A6UEY0|DNAK_SINMW Chaperone protein dnaK OS=Sinorhizobium med... 149 9e-36
sp|P42374|DNAK_RHIME Chaperone protein dnaK OS=Rhizobium melilot... 149 9e-36
sp|Q3SW76|DNAK_NITWN Chaperone protein dnaK OS=Nitrobacter winog... 149 9e-36
sp|P20442|DNAK_CAUCR Chaperone protein dnaK OS=Caulobacter cresc... 149 9e-36
sp|Q1QRU1|DNAK_NITHX Chaperone protein dnaK OS=Nitrobacter hambu... 148 2e-35
sp|Q0BW82|DNAK_GRABC Chaperone protein dnaK OS=Granulibacter bet... 148 2e-35
sp|P94317|DNAK_BRAJA Chaperone protein dnaK OS=Bradyrhizobium ja... 148 2e-35

>sp|Q08276|HSP7M_SOLTU Heat shock 70 kDa protein, mitochondrial
OS=Solanum tuberosum GN=HSP68 PE=2 SV=1
Length = 682

Score = 181 bits (460), Expect = 1e-45
Identities = 93/140 (66%), Positives = 106/140 (75%), Gaps = 5/140 (3%)
Frame = +1

Query: 88 YKTASLPVDKNVASQIA-----SMLSRRWLDSARAFSSKAGGGEIIGIDLGTTNSCVSVM 252
+ T+S+ + +AS S++ +W AR FSSK G EIIGIDLGTTNSCV+VM
Sbjct: 15 FATSSISAYRTLASNTKPSWCPSLVGAKWAGLARPFSSKPAGNEIIGIDLGTTNSCVAVM 74

Query: 253 EGKSPRVIENSEGARTTPSVVAFTSKGERLVGTPAKRQAVINPMNTVYAAKRLIGRTYDD 432
EGK+P+VIENSEGARTTPSVVAF KGE LVGTPAKRQAV NP NT+ KRLIGR +DD
Sbjct: 75 EGKNPKVIENSEGARTTPSVVAFNQKGELLVGTPAKRQAVTNPTNTLSGTKRLIGRRFDD 134

Query: 433 PQVQKESKMVPYKIVRGPNG 492
PQ QKE KMVPYKIVRG NG
Sbjct: 135 PQTQKEMKMVPYKIVRGSNG 154


>sp|Q01899|HSP7M_PHAVU Heat shock 70 kDa protein, mitochondrial
OS=Phaseolus vulgaris PE=2 SV=1
Length = 675

Score = 177 bits (450), Expect = 2e-44
Identities = 85/116 (73%), Positives = 98/116 (84%)
Frame = +1

Query: 145 LSRRWLDSARAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGARTTPSVVAFT 324
++++W AR FSS+ G ++IGIDLGTTNSCVSVMEGK+P+VIENSEGARTTPSVVAF
Sbjct: 33 VAQKWSCLARPFSSRPAGNDVIGIDLGTTNSCVSVMEGKNPKVIENSEGARTTPSVVAFN 92

Query: 325 SKGERLVGTPAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIVRGPNG 492
KGE LVGTPAKRQAV NP NTV+ KRLIGR +DDPQ QKE KMVP+KIV+ PNG
Sbjct: 93 QKGELLVGTPAKRQAVTNPTNTVFGTKRLIGRRFDDPQTQKEMKMVPFKIVKAPNG 148


>sp|P37900|HSP7M_PEA Heat shock 70 kDa protein, mitochondrial
OS=Pisum sativum GN=HSP1 PE=2 SV=1
Length = 675

Score = 169 bits (427), Expect = 8e-42
Identities = 82/107 (76%), Positives = 90/107 (84%)
Frame = +1

Query: 172 RAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGARTTPSVVAFTSKGERLVGT 351
R FSS+ G ++IGIDLGTTNSCVSVMEGK+P+VIENSEGARTTPSVVAF K E LVGT
Sbjct: 43 RPFSSRPAGNDVIGIDLGTTNSCVSVMEGKNPKVIENSEGARTTPSVVAFNQKSELLVGT 102

Query: 352 PAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIVRGPNG 492
PAKRQAV NP NT++ KRLIGR +DD Q QKE KMVPYKIVR PNG
Sbjct: 103 PAKRQAVTNPTNTLFGTKRLIGRRFDDAQTQKEMKMVPYKIVRAPNG 149


>sp|P38647|GRP75_MOUSE Stress-70 protein, mitochondrial OS=Mus
musculus GN=Hspa9 PE=1 SV=2
Length = 679

Score = 160 bits (405), Expect = 3e-39
Identities = 78/109 (71%), Positives = 92/109 (84%)
Frame = +1

Query: 166 SARAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGARTTPSVVAFTSKGERLV 345
S R ++S+A G ++GIDLGTTNSCV+VMEGK +V+EN+EGARTTPSVVAFT+ GERLV
Sbjct: 42 SRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLV 101

Query: 346 GTPAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIVRGPNG 492
G PAKRQAV NP NT YA KRLIGR YDDP+VQK++K VP+KIVR NG
Sbjct: 102 GMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDTKNVPFKIVRASNG 150


>sp|P11141|HSP7F_CAEEL Heat shock 70 kDa protein F, mitochondrial
OS=Caenorhabditis elegans GN=hsp-6 PE=1 SV=2
Length = 657

Score = 159 bits (403), Expect = 5e-39
Identities = 80/119 (67%), Positives = 96/119 (80%)
Frame = +1

Query: 136 ASMLSRRWLDSARAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGARTTPSVV 315
A ++R L SAR+ S K G +IGIDLGTTNSCVS+MEGK+P+VIEN+EG RTTPS V
Sbjct: 11 ARTIARSSLMSARSLSDKPKG-HVIGIDLGTTNSCVSIMEGKTPKVIENAEGVRTTPSTV 69

Query: 316 AFTSKGERLVGTPAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIVRGPNG 492
AFT+ GERLVG PAKRQAV N NT++A KRLIGR Y+DP+VQK+ K+VPYKIV+ NG
Sbjct: 70 AFTADGERLVGAPAKRQAVTNSANTLFATKRLIGRRYEDPEVQKDLKVVPYKIVKASNG 128


>sp|P48721|GRP75_RAT Stress-70 protein, mitochondrial OS=Rattus
norvegicus GN=Hspa9 PE=1 SV=3
Length = 679

Score = 159 bits (403), Expect = 5e-39
Identities = 78/109 (71%), Positives = 91/109 (83%)
Frame = +1

Query: 166 SARAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGARTTPSVVAFTSKGERLV 345
S R ++S+A G ++GIDLGTTNSCV+VMEGK +V+EN+EGARTTPSVVAFT GERLV
Sbjct: 42 SRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTPDGERLV 101

Query: 346 GTPAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIVRGPNG 492
G PAKRQAV NP NT YA KRLIGR YDDP+VQK++K VP+KIVR NG
Sbjct: 102 GMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDTKNVPFKIVRASNG 150


>sp|P38646|GRP75_HUMAN Stress-70 protein, mitochondrial OS=Homo
sapiens GN=HSPA9 PE=1 SV=2
Length = 679

Score = 159 bits (403), Expect = 5e-39
Identities = 79/111 (71%), Positives = 92/111 (82%)
Frame = +1

Query: 160 LDSARAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGARTTPSVVAFTSKGER 339
L S R ++S+A G ++GIDLGTTNSCV+VMEGK +V+EN+EGARTTPSVVAFT+ GER
Sbjct: 40 LVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGER 99

Query: 340 LVGTPAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIVRGPNG 492
LVG PAKRQAV NP NT YA KRLIGR YDDP+VQK+ K VP+KIVR NG
Sbjct: 100 LVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNG 150


>sp|Q5R511|GRP75_PONAB Stress-70 protein, mitochondrial OS=Pongo
abelii GN=HSPA9 PE=2 SV=1
Length = 679

Score = 159 bits (402), Expect = 7e-39
Identities = 78/109 (71%), Positives = 91/109 (83%)
Frame = +1

Query: 166 SARAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGARTTPSVVAFTSKGERLV 345
S R ++S+A G ++GIDLGTTNSCV+VMEGK +V+EN+EGARTTPSVVAFT+ GERLV
Sbjct: 42 SRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLV 101

Query: 346 GTPAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIVRGPNG 492
G PAKRQAV NP NT YA KRLIGR YDDP+VQK+ K VP+KIVR NG
Sbjct: 102 GMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNG 150


>sp|Q3ZCH0|GRP75_BOVIN Stress-70 protein, mitochondrial OS=Bos
taurus GN=HSPA9 PE=2 SV=1
Length = 679

Score = 159 bits (402), Expect = 7e-39
Identities = 78/109 (71%), Positives = 91/109 (83%)
Frame = +1

Query: 166 SARAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGARTTPSVVAFTSKGERLV 345
S R ++S+A G ++GIDLGTTNSCV+VMEGK +V+EN+EGARTTPSVVAFT+ GERLV
Sbjct: 42 SRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLV 101

Query: 346 GTPAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIVRGPNG 492
G PAKRQAV NP NT YA KRLIGR YDDP+VQK+ K VP+KIVR NG
Sbjct: 102 GMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNG 150


>sp|O35501|GRP75_CRIGR Stress-70 protein, mitochondrial
OS=Cricetulus griseus GN=HSPA9 PE=2 SV=1
Length = 679

Score = 159 bits (401), Expect = 9e-39
Identities = 77/109 (70%), Positives = 91/109 (83%)
Frame = +1

Query: 166 SARAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGARTTPSVVAFTSKGERLV 345
S R ++S+ G ++GIDLGTTNSCV+VMEGK +V+EN+EGARTTPSVVAFT+ GERLV
Sbjct: 42 SRRDYASETIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLV 101

Query: 346 GTPAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIVRGPNG 492
G PAKRQAV NP NT YA KRLIGR YDDP+VQK++K VP+KIVR NG
Sbjct: 102 GMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDTKNVPFKIVRASNG 150


tr_hit_id B4F8Q2
Definition tr|B4F8Q2|B4F8Q2_MAIZE Putative uncharacterized protein OS=Zea mays
Align length 125
Score (bit) 186.0
E-value 5.0e-46
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK956034|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0024_K23, 5'
(493 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4F8Q2|B4F8Q2_MAIZE Putative uncharacterized protein OS=Zea m... 186 5e-46
tr|A2XBQ0|A2XBQ0_ORYSI Putative uncharacterized protein OS=Oryza... 186 7e-46
tr|Q8GTB0|Q8GTB0_ORYSJ Putative heat shock 70 KD protein, mitoch... 182 1e-44
tr|Q10SR3|Q10SR3_ORYSJ Os03g0113700 protein OS=Oryza sativa subs... 182 1e-44
tr|B6U4A3|B6U4A3_MAIZE Heat shock 70 kDa protein OS=Zea mays PE=... 182 1e-44
tr|Q6Z7L1|Q6Z7L1_ORYSJ Os02g0774300 protein OS=Oryza sativa subs... 180 4e-44
tr|A3ABU8|A3ABU8_ORYSJ Putative uncharacterized protein OS=Oryza... 180 4e-44
tr|A2Q199|A2Q199_MEDTR Chaperone DnaK OS=Medicago truncatula GN=... 180 4e-44
tr|A9T8F3|A9T8F3_PHYPA Predicted protein OS=Physcomitrella paten... 179 5e-44
tr|A9T8E8|A9T8E8_PHYPA Predicted protein OS=Physcomitrella paten... 179 5e-44
tr|Q9LDZ0|Q9LDZ0_ARATH At5g09590 OS=Arabidopsis thaliana GN=F17I... 178 1e-43
tr|A9SA41|A9SA41_PHYPA Predicted protein OS=Physcomitrella paten... 178 1e-43
tr|A9SA40|A9SA40_PHYPA Predicted protein (Fragment) OS=Physcomit... 178 1e-43
tr|O50047|O50047_SPIOL Heat shock 70 protein OS=Spinacia olerace... 172 8e-42
tr|O49045|O49045_SPIOL Heat shock 70 protein OS=Spinacia olerace... 172 8e-42
tr|Q01AH9|Q01AH9_OSTTA Heat shock protein 70 / HSP70 (ISS) OS=Os... 168 1e-40
tr|A2XA53|A2XA53_ORYSI Putative uncharacterized protein OS=Oryza... 167 3e-40
tr|Q9SZJ3|Q9SZJ3_ARATH Heat shock protein 70 like protein OS=Ara... 166 4e-40
tr|Q8GUM2|Q8GUM2_ARATH Heat shock protein 70 like protein (At4g3... 166 4e-40
tr|B8BD19|B8BD19_ORYSI Putative uncharacterized protein OS=Oryza... 165 9e-40
tr|A3C065|A3C065_ORYSJ Putative uncharacterized protein OS=Oryza... 165 9e-40
tr|A4RWG3|A4RWG3_OSTLU Heat Shock Protein 70 OS=Ostreococcus luc... 160 2e-38
tr|Q7ZYY3|Q7ZYY3_DANRE Heat shock protein 9 OS=Danio rerio GN=hs... 160 3e-38
tr|Q5XJ12|Q5XJ12_DANRE Heat shock protein 9 OS=Danio rerio GN=hs... 160 3e-38
tr|Q7TSZ0|Q7TSZ0_MOUSE Heat shock protein 9 OS=Mus musculus GN=H... 160 3e-38
tr|Q3UVN1|Q3UVN1_MOUSE Putative uncharacterized protein (Fragmen... 160 3e-38
tr|B7Z4V2|B7Z4V2_HUMAN cDNA FLJ51907, highly similar to Stress-7... 159 5e-38
tr|Q8N1C8|Q8N1C8_HUMAN HSPA9 protein (Fragment) OS=Homo sapiens ... 159 7e-38
tr|Q3V015|Q3V015_MOUSE Putative uncharacterized protein OS=Mus m... 158 1e-37
tr|Q3TW93|Q3TW93_MOUSE Putative uncharacterized protein OS=Mus m... 158 2e-37

>tr|B4F8Q2|B4F8Q2_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 678

Score = 186 bits (472), Expect = 5e-46
Identities = 89/125 (71%), Positives = 104/125 (83%)
Frame = +1

Query: 118 NVASQIASMLSRRWLDSARAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGAR 297
N+ S A+ + +W + AR FS+KA G E+IGIDLGTTNSCV+VMEGK+P+VIEN+EGAR
Sbjct: 25 NLQSTCAANICSKWGNFARPFSAKAAGNEVIGIDLGTTNSCVAVMEGKNPKVIENAEGAR 84

Query: 298 TTPSVVAFTSKGERLVGTPAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIV 477
TTPSVVAFT KGERLVGTPAKRQAV NP NT + KR+IGR +DDPQ QKE KMVPYKIV
Sbjct: 85 TTPSVVAFTQKGERLVGTPAKRQAVTNPQNTFFGTKRMIGRRFDDPQTQKEMKMVPYKIV 144

Query: 478 RGPNG 492
+ PNG
Sbjct: 145 KAPNG 149


>tr|A2XBQ0|A2XBQ0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_09713 PE=3 SV=1
Length = 676

Score = 186 bits (471), Expect = 7e-46
Identities = 91/125 (72%), Positives = 101/125 (80%)
Frame = +1

Query: 118 NVASQIASMLSRRWLDSARAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGAR 297
NV S+ A+ + RW AR FS+KA G E+IGIDLGTTNSCVSVMEGK+P+VIENSEG R
Sbjct: 25 NVQSKCAANVCSRWAGFARTFSAKATGNEVIGIDLGTTNSCVSVMEGKNPKVIENSEGTR 84

Query: 298 TTPSVVAFTSKGERLVGTPAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIV 477
TTPSVVAF KGE LVGTPAKRQAV NP NT + KRLIGR +DDPQ QKE KMVPYKIV
Sbjct: 85 TTPSVVAFNQKGELLVGTPAKRQAVTNPQNTFFGTKRLIGRRFDDPQTQKEMKMVPYKIV 144

Query: 478 RGPNG 492
+ PNG
Sbjct: 145 KAPNG 149


>tr|Q8GTB0|Q8GTB0_ORYSJ Putative heat shock 70 KD protein,
mitochondrial (Putative uncharacterized protein)
OS=Oryza sativa subsp. japonica GN=OSJNBa0090O10.7 PE=3
SV=1
Length = 656

Score = 182 bits (461), Expect = 1e-44
Identities = 90/125 (72%), Positives = 100/125 (80%)
Frame = +1

Query: 118 NVASQIASMLSRRWLDSARAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGAR 297
NV S+ A+ + RW AR FS+KA G E+IGIDLGTTNSCVSVMEGK+P+VIENSEG R
Sbjct: 5 NVQSKCAANVCSRWAGFARTFSAKATGNEVIGIDLGTTNSCVSVMEGKNPKVIENSEGTR 64

Query: 298 TTPSVVAFTSKGERLVGTPAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIV 477
TTPSVVAF KGE LVGTPAKRQAV NP NT + KRLIGR +DDPQ QKE KMVPYKIV
Sbjct: 65 TTPSVVAFNQKGELLVGTPAKRQAVTNPQNTFFGTKRLIGRRFDDPQTQKEMKMVPYKIV 124

Query: 478 RGPNG 492
+ NG
Sbjct: 125 KALNG 129


>tr|Q10SR3|Q10SR3_ORYSJ Os03g0113700 protein OS=Oryza sativa subsp.
japonica GN=Os03g0113700 PE=2 SV=1
Length = 676

Score = 182 bits (461), Expect = 1e-44
Identities = 90/125 (72%), Positives = 100/125 (80%)
Frame = +1

Query: 118 NVASQIASMLSRRWLDSARAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGAR 297
NV S+ A+ + RW AR FS+KA G E+IGIDLGTTNSCVSVMEGK+P+VIENSEG R
Sbjct: 25 NVQSKCAANVCSRWAGFARTFSAKATGNEVIGIDLGTTNSCVSVMEGKNPKVIENSEGTR 84

Query: 298 TTPSVVAFTSKGERLVGTPAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIV 477
TTPSVVAF KGE LVGTPAKRQAV NP NT + KRLIGR +DDPQ QKE KMVPYKIV
Sbjct: 85 TTPSVVAFNQKGELLVGTPAKRQAVTNPQNTFFGTKRLIGRRFDDPQTQKEMKMVPYKIV 144

Query: 478 RGPNG 492
+ NG
Sbjct: 145 KALNG 149


>tr|B6U4A3|B6U4A3_MAIZE Heat shock 70 kDa protein OS=Zea mays PE=2
SV=1
Length = 678

Score = 182 bits (461), Expect = 1e-44
Identities = 88/125 (70%), Positives = 101/125 (80%)
Frame = +1

Query: 118 NVASQIASMLSRRWLDSARAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGAR 297
++ S + + +W AR FS+KA G E+IGIDLGTTNSCVSVMEGK+P+VIEN+EGAR
Sbjct: 25 SIQSTCVANICSKWGRFARPFSAKAAGNEVIGIDLGTTNSCVSVMEGKNPKVIENAEGAR 84

Query: 298 TTPSVVAFTSKGERLVGTPAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIV 477
TTPSVVAFT KGERLVGTPAKRQAV NP NT + KRLIGR +DDPQ QKE KMVPY IV
Sbjct: 85 TTPSVVAFTQKGERLVGTPAKRQAVTNPQNTFFGTKRLIGRRFDDPQTQKEMKMVPYTIV 144

Query: 478 RGPNG 492
+ PNG
Sbjct: 145 KAPNG 149


>tr|Q6Z7L1|Q6Z7L1_ORYSJ Os02g0774300 protein OS=Oryza sativa subsp.
japonica GN=OJ1448_G06.10 PE=3 SV=1
Length = 679

Score = 180 bits (456), Expect = 4e-44
Identities = 88/125 (70%), Positives = 99/125 (79%)
Frame = +1

Query: 118 NVASQIASMLSRRWLDSARAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGAR 297
N S ++ + +W ARAFS K G E+IGIDLGTTNSCVSVMEGK+P+VIENSEG R
Sbjct: 25 NAQSAYSANICSQWGSFARAFSVKPTGNEVIGIDLGTTNSCVSVMEGKNPKVIENSEGTR 84

Query: 298 TTPSVVAFTSKGERLVGTPAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIV 477
TTPSVVAF KGERLVGTPAKRQAV NP NT + KRLIGR ++DPQ QKE KMVPYKIV
Sbjct: 85 TTPSVVAFNQKGERLVGTPAKRQAVTNPQNTFFGTKRLIGRRFEDPQTQKEMKMVPYKIV 144

Query: 478 RGPNG 492
+ PNG
Sbjct: 145 KAPNG 149


>tr|A3ABU8|A3ABU8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_008270 PE=3 SV=1
Length = 773

Score = 180 bits (456), Expect = 4e-44
Identities = 88/125 (70%), Positives = 99/125 (79%)
Frame = +1

Query: 118 NVASQIASMLSRRWLDSARAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGAR 297
N S ++ + +W ARAFS K G E+IGIDLGTTNSCVSVMEGK+P+VIENSEG R
Sbjct: 25 NAQSAYSANICSQWGSFARAFSVKPTGNEVIGIDLGTTNSCVSVMEGKNPKVIENSEGTR 84

Query: 298 TTPSVVAFTSKGERLVGTPAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIV 477
TTPSVVAF KGERLVGTPAKRQAV NP NT + KRLIGR ++DPQ QKE KMVPYKIV
Sbjct: 85 TTPSVVAFNQKGERLVGTPAKRQAVTNPQNTFFGTKRLIGRRFEDPQTQKEMKMVPYKIV 144

Query: 478 RGPNG 492
+ PNG
Sbjct: 145 KAPNG 149


>tr|A2Q199|A2Q199_MEDTR Chaperone DnaK OS=Medicago truncatula
GN=MtrDRAFT_AC148396g20v2 PE=3 SV=1
Length = 676

Score = 180 bits (456), Expect = 4e-44
Identities = 86/116 (74%), Positives = 97/116 (83%)
Frame = +1

Query: 145 LSRRWLDSARAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGARTTPSVVAFT 324
+ W +R FSS+A G ++IGIDLGTTNSCVSVMEGK+P+V+ENSEGARTTPSVVAFT
Sbjct: 36 VGHNWSSLSRPFSSRAAGNDVIGIDLGTTNSCVSVMEGKNPKVVENSEGARTTPSVVAFT 95

Query: 325 SKGERLVGTPAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIVRGPNG 492
KGE LVGTPAKRQAV NP NT+ AKRLIGR +DDPQ QKE KMVPYKIV+ PNG
Sbjct: 96 QKGELLVGTPAKRQAVTNPENTISGAKRLIGRRFDDPQTQKEMKMVPYKIVKAPNG 151


>tr|A9T8F3|A9T8F3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192625 PE=3 SV=1
Length = 680

Score = 179 bits (455), Expect = 5e-44
Identities = 89/119 (74%), Positives = 100/119 (84%)
Frame = +1

Query: 136 ASMLSRRWLDSARAFSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGARTTPSVV 315
+S+L R L +SSK G ++IGIDLGTTNSCV+VMEGK PRVIENSEGARTTPSVV
Sbjct: 36 SSLLHR--LTGRALYSSKGAGSDVIGIDLGTTNSCVAVMEGKMPRVIENSEGARTTPSVV 93

Query: 316 AFTSKGERLVGTPAKRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIVRGPNG 492
AFTSKGERLVGTPAKRQAV NP NT++ KRLIGR +DDPQ QKE+KMVPYKI+R PNG
Sbjct: 94 AFTSKGERLVGTPAKRQAVTNPTNTLFGTKRLIGRPFDDPQTQKEAKMVPYKIIRAPNG 152


>tr|A9T8E8|A9T8E8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_141802 PE=3 SV=1
Length = 643

Score = 179 bits (455), Expect = 5e-44
Identities = 86/105 (81%), Positives = 94/105 (89%)
Frame = +1

Query: 178 FSSKAGGGEIIGIDLGTTNSCVSVMEGKSPRVIENSEGARTTPSVVAFTSKGERLVGTPA 357
+SSK G ++IGIDLGTTNSCV+VMEGK PRVIENSEGARTTPSVVAFT KGERLVGTPA
Sbjct: 11 YSSKGAGSDVIGIDLGTTNSCVAVMEGKMPRVIENSEGARTTPSVVAFTPKGERLVGTPA 70

Query: 358 KRQAVINPMNTVYAAKRLIGRTYDDPQVQKESKMVPYKIVRGPNG 492
KRQAV NP NT++ KRLIGR +DDPQ QKE+KMVPYKIVRGPNG
Sbjct: 71 KRQAVTNPTNTLFGTKRLIGRPFDDPQTQKEAKMVPYKIVRGPNG 115