DK956927
Clone id TST39A01NGRL0027_A10
Library
Length 605
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0027_A10. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID
Sequence
GGCGATCCTGTGTTCTCTTGGTTGTAGCAAAGGGATCTGTAAGGCCTGCCGCTGCTTTAG
GGTTTTCCCGATCCCTGCTTCTTTATTCCTGCCATATGTGACAACAGGGGGCTAATCAGC
GCTGTCCATTTATCAGTTGGTCGGTGATCTGACACTGCTTTTAGTTGAATCGGCAACAGT
GTGATGTCTCACGCCCTTGGCGACACCACTCCTAATGTGGTGACCCTGGTTCGTCATCTT
GGGCCCAAAGTGCACAAGTCTTGTACTGAATGGGTACAGCATAGCCTTTCCTTGCAACGC
TATAAAGGCTGGGCCATGTCTACGGTGATCTATGGAATTGGATCTGTCGAAGCAACCATA
TCAAGCCAGATTTCAATACATGATGCAGTTGCACCGCCGTCTGTGAGAACTGGAAGCTAC
AGGGTGGCCCCAAGAATGTTGGCATACAAGGCAAGGCGCACCAAGAGGCGATCTCACAGA
GGTGGGGGAGATGGGGATGATGAAGGGCCTGAGTGGGATGAAGGAGGGTTTGGTGGCAGC
GGGGGCTGGGGCGGAAACGACAACGGTCGGGGCGGGAATGATTACTGGGGTGCAAGCTGG
AATGA
■■Homology search results ■■ -
sp_hit_id Q7NTK7
Definition sp|Q7NTK7|KCY_CHRVO Cytidylate kinase OS=Chromobacterium violaceum
Align length 60
Score (bit) 30.8
E-value 5.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK956927|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0027_A10, 5'
(605 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q7NTK7|KCY_CHRVO Cytidylate kinase OS=Chromobacterium violace... 31 5.6
sp|Q8XVI2|MURE_RALSO UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--... 30 7.3

>sp|Q7NTK7|KCY_CHRVO Cytidylate kinase OS=Chromobacterium violaceum
GN=cmk PE=3 SV=1
Length = 222

Score = 30.8 bits (68), Expect = 5.6
Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 1/60 (1%)
Frame = -2

Query: 406 SQTAVQL-HHVLKSGLIWLLRQIQFHRSP*TWPSLYSVARKGYAVPIQYKTCALWAQDDE 230
+Q A +L H L SG ++ L + R W ++AR A+P+++ A+W + ++
Sbjct: 21 AQVAARLAFHYLDSGSLYRLLALHARRRGIAWDDEPALARAAAALPVEFSDGAVWLEGND 80


>sp|Q8XVI2|MURE_RALSO
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,
6-diaminopimelate ligase OS=Ralstonia solanacearum
GN=murE PE=3 SV=1
Length = 514

Score = 30.4 bits (67), Expect = 7.3
Identities = 18/78 (23%), Positives = 37/78 (47%)
Frame = +1

Query: 211 PNVVTLVRHLGPKVHKSCTEWVQHSLSLQRYKGWAMSTVIYGIGSVEATISSQISIHDAV 390
P+ + ++ G SC++W+ +LS Q + + T+ G G V+A +++ + DA+
Sbjct: 115 PDALRVIGVTGTNGKTSCSQWIAQALSRQGERCAVVGTL--GTGFVDALVATGFTTPDAI 172

Query: 391 APPSVRTGSYRVAPRMLA 444
+R R +A
Sbjct: 173 QLQHSLADLHRAGARAVA 190


tr_hit_id A9SVR8
Definition tr|A9SVR8|A9SVR8_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 42
Score (bit) 38.9
E-value 0.24
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK956927|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0027_A10, 5'
(605 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SVR8|A9SVR8_PHYPA Predicted protein OS=Physcomitrella paten... 39 0.24
tr|B4R3L9|B4R3L9_DROSI GD15942 OS=Drosophila simulans GN=GD15942... 37 0.68
tr|B1MJ73|B1MJ73_MYCA9 Putative membrane protein, MmpL family OS... 37 1.2
tr|A5A9U8|A5A9U8_MYCAB MmpL protein OS=Mycobacterium abscessus G... 37 1.2
tr|A5A9S0|A5A9S0_MYCCH MmpL protein OS=Mycobacterium chelonae GN... 37 1.2
tr|A5AMS3|A5AMS3_VITVI Putative uncharacterized protein OS=Vitis... 35 2.6
tr|Q29MY3|Q29MY3_DROPS GA16478 OS=Drosophila pseudoobscura pseud... 35 3.4
tr|B4G8J5|B4G8J5_DROPE GL19307 OS=Drosophila persimilis GN=GL193... 35 3.4
tr|A9GTY9|A9GTY9_SORC5 Sensor protein OS=Sorangium cellulosum (s... 35 4.4
tr|A4SE88|A4SE88_PROVI Lytic transglycosylase, catalytic OS=Pros... 35 4.4
tr|B7FGK2|B7FGK2_MEDTR Putative uncharacterized protein OS=Medic... 34 5.8
tr|Q31EB0|Q31EB0_THICR P-type ATPase (P-ATPase) superfamily cati... 34 7.6
tr|A7PNR8|A7PNR8_VITVI Chromosome chr8 scaffold_23, whole genome... 34 7.6
tr|A5B2R0|A5B2R0_VITVI Putative uncharacterized protein OS=Vitis... 34 7.6

>tr|A9SVR8|A9SVR8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_84628 PE=4 SV=1
Length = 369

Score = 38.9 bits (89), Expect = 0.24
Identities = 18/42 (42%), Positives = 26/42 (61%)
Frame = +1

Query: 346 VEATISSQISIHDAVAPPSVRTGSYRVAPRMLAYKARRTKRR 471
V A +SS + DA A P VR Y++AP L KAR++++R
Sbjct: 106 VVAAVSSGAPVQDATAAPPVRRNCYQLAPSTLTLKARKSRKR 147


>tr|B4R3L9|B4R3L9_DROSI GD15942 OS=Drosophila simulans GN=GD15942
PE=4 SV=1
Length = 426

Score = 37.4 bits (85), Expect = 0.68
Identities = 18/42 (42%), Positives = 26/42 (61%)
Frame = -3

Query: 528 PSFIPLRPFIIPISPTSVRSPLGAPCLVCQHSWGHPVASSSH 403
P +P+RP ++P++P ++R L PC C HS P AS SH
Sbjct: 39 PMRVPVRPQLLPVNPLAMRRHLPRPC--CPHSTSQP-ASDSH 77


>tr|B1MJ73|B1MJ73_MYCA9 Putative membrane protein, MmpL family
OS=Mycobacterium abscessus (strain ATCC 19977 / DSM
44196) GN=MAB_0937c PE=4 SV=1
Length = 1002

Score = 36.6 bits (83), Expect = 1.2
Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
Frame = -3

Query: 339 NSIDHRRHGPAFIALQGKAMLYPFSTRLVHFGPKMTNQGHHIRSGVAKGVR-HHTVADST 163
N+ D +R AFI+ G ++ Y T+L F P+ +Q + I S VAKG + + T+AD+T
Sbjct: 739 NNPDFQRAAKAFISPDGHSVRYLVQTKLNPFSPEAMDQVNQI-SDVAKGAQPNTTLADAT 797

Query: 162 KSSVRSPT 139
S PT
Sbjct: 798 ISMGGFPT 805


>tr|A5A9U8|A5A9U8_MYCAB MmpL protein OS=Mycobacterium abscessus
GN=mmpL PE=4 SV=1
Length = 1002

Score = 36.6 bits (83), Expect = 1.2
Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
Frame = -3

Query: 339 NSIDHRRHGPAFIALQGKAMLYPFSTRLVHFGPKMTNQGHHIRSGVAKGVR-HHTVADST 163
N+ D +R AFI+ G ++ Y T+L F P+ +Q + I S VAKG + + T+AD+T
Sbjct: 739 NNPDFQRAAKAFISPDGHSVRYLVQTKLNPFSPEAMDQVNQI-SDVAKGAQPNTTLADAT 797

Query: 162 KSSVRSPT 139
S PT
Sbjct: 798 ISMGGFPT 805


>tr|A5A9S0|A5A9S0_MYCCH MmpL protein OS=Mycobacterium chelonae
GN=mmpL PE=4 SV=1
Length = 1006

Score = 36.6 bits (83), Expect = 1.2
Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
Frame = -3

Query: 339 NSIDHRRHGPAFIALQGKAMLYPFSTRLVHFGPKMTNQGHHIRSGVAKGVR-HHTVADST 163
N+ D +R AFI+ G ++ Y T+L F P+ +Q + I S VAKG + + T+AD+T
Sbjct: 739 NNPDFQRAAKAFISPDGHSVRYLVQTKLNPFSPEAMDQVNQI-SDVAKGAQPNTTLADAT 797

Query: 162 KSSVRSPT 139
S PT
Sbjct: 798 ISMGGFPT 805


>tr|A5AMS3|A5AMS3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_012018 PE=4 SV=1
Length = 347

Score = 35.4 bits (80), Expect = 2.6
Identities = 19/39 (48%), Positives = 25/39 (64%)
Frame = +1

Query: 358 ISSQISIHDAVAPPSVRTGSYRVAPRMLAYKARRTKRRS 474
IS+ I DA+APP VR+ S + A R + RRT+RRS
Sbjct: 86 ISAMIFPVDALAPPPVRSNSCKTARRTSLRRKRRTRRRS 124


>tr|Q29MY3|Q29MY3_DROPS GA16478 OS=Drosophila pseudoobscura
pseudoobscura GN=GA16478 PE=4 SV=1
Length = 828

Score = 35.0 bits (79), Expect = 3.4
Identities = 17/33 (51%), Positives = 18/33 (54%)
Frame = -2

Query: 589 PSNHSRPDRCRFRPSPRCHQTLLHPTQALHHPH 491
PSNH RP R P P H+T LHP HPH
Sbjct: 724 PSNHCRPPRDLSSPPPYHHKTTLHP-----HPH 751


>tr|B4G8J5|B4G8J5_DROPE GL19307 OS=Drosophila persimilis GN=GL19307
PE=4 SV=1
Length = 831

Score = 35.0 bits (79), Expect = 3.4
Identities = 17/33 (51%), Positives = 18/33 (54%)
Frame = -2

Query: 589 PSNHSRPDRCRFRPSPRCHQTLLHPTQALHHPH 491
PSNH RP R P P H+T LHP HPH
Sbjct: 727 PSNHCRPPRDLSSPPPYHHKTTLHP-----HPH 754


>tr|A9GTY9|A9GTY9_SORC5 Sensor protein OS=Sorangium cellulosum (strain
So ce56) GN=sce6844 PE=4 SV=1
Length = 1716

Score = 34.7 bits (78), Expect = 4.4
Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 1/81 (1%)
Frame = -2

Query: 508 ALHHPHLPHLCEIASWCALPCMPTFLGP-PCSFQFSQTAVQLHHVLKSGLIWLLRQIQFH 332
+L H H + S C M + LG PC+FQFS+ A++L+ KS L ++ FH
Sbjct: 921 SLQHGHAEESSFVYS-CYAAVMVSILGDVPCAFQFSEMALRLNEKFKSVTAMLKGRLLFH 979

Query: 331 RSP*TWPSLYSVARKGYAVPI 269
+ + S+ + YA I
Sbjct: 980 HA-----GVISIWHRHYATSI 995


>tr|A4SE88|A4SE88_PROVI Lytic transglycosylase, catalytic
OS=Prosthecochloris vibrioformis (strain DSM 265)
GN=Cvib_0782 PE=3 SV=1
Length = 503

Score = 34.7 bits (78), Expect = 4.4
Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 3/63 (4%)
Frame = +1

Query: 280 HSLSLQRYKGW---AMSTVIYGIGSVEATISSQISIHDAVAPPSVRTGSYRVAPRMLAYK 450
H L L ++ A+ T +Y S+ SS ++ ++V P S+R VAPR+L+YK
Sbjct: 341 HELRLPKHHATSFAAVETRLYDALSIPVPDSSAVA--ESVTPDSIRVSFVAVAPRLLSYK 398

Query: 451 ARR 459
+R
Sbjct: 399 VKR 401