DK957667
Clone id TST39A01NGRL0028_P14
Library
Length 648
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0028_P14. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID
Sequence
CCCCAGCAATGGCAGCATCAACAGCAGGCCTCGCCAGCTCTACGCTCAGAGGCGAGGCTC
TGGGCAAGGCCTCCAATGAGCTGTCCAGCAAGGTGGCCTCCGGGCAGGCACGCGTTCAGA
TGATGGCACCCAAGAAGGCATCCTCCTCCGGCAGCATTTGGTATGGCTCCGACCGACCTC
TGTACCTGGGCCCCTTCTCCGGCTCGCCCCCTTCCTATCTCTCGGGTGAGTTCCCCGGTG
ACTATGGCTGGGACACCGCCGGGTTGTCTGCCGACCCCGAGACCTTCGCCAAGAACCGGG
AGTTGGAGGTCATCCACCGCAGGTGGGCCATGCTGGGCGCCCTGGGCTGCGTCACGCCGG
AGCTGTTGGCCAAGAACGGCGTCAAGTTCGGCGAGGCTGTGTGGTTCAAGGCCGGCTCCC
AGATCTTGGGCCTTTGGGTGAGGTAGAGGATCTCATTTACCCCGGAGGCTCCTTCGACCC
CTTGGGCCTGGCCGATGACCCCGAGGCCTTCGCCGAGCTGAAGGTGAAGGAGCTCAAGAA
CGGGCGCTTGGCCATGCTTTCTATGTTCGGCTTCTTCGTGCAGGCCATCGTCACTGGCAA
GGGCCCCATTGAAAACCTGTCCGACCACCTTGCCGACCCCACCGTCAA
■■Homology search results ■■ -
sp_hit_id P15195
Definition sp|P15195|CB23_POLMU Chlorophyll a-b binding protein type 1 member F3, chloroplastic OS=Polystichum munitum
Align length 120
Score (bit) 229.0
E-value 9.0e-60
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK957667|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0028_P14, 5'
(648 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P15195|CB23_POLMU Chlorophyll a-b binding protein type 1 memb... 229 9e-60
sp|P12330|CB21_ORYSJ Chlorophyll a-b binding protein 1, chloropl... 193 7e-49
sp|P27497|CB29_MAIZE Chlorophyll a-b binding protein M9, chlorop... 191 3e-48
sp|P14278|CB24_SOLLC Chlorophyll a-b binding protein 4, chloropl... 191 4e-48
sp|P12332|CB21_SILPR Chlorophyll a-b binding protein, chloroplas... 191 4e-48
sp|P04784|CB21_WHEAT Chlorophyll a-b binding protein, chloroplas... 190 5e-48
sp|P06671|CB22_MAIZE Chlorophyll a-b binding protein, chloroplas... 190 6e-48
sp|P20866|CB2_PHYPA Chlorophyll a-b binding protein, chloroplast... 188 2e-47
sp|P12331|CB22_ORYSJ Chlorophyll a-b binding protein 2, chloropl... 188 2e-47
sp|P27518|CB21_GOSHI Chlorophyll a-b binding protein 151, chloro... 186 7e-47
sp|P04778|CB22_ARATH Chlorophyll a-b binding protein 2, chloropl... 186 1e-46
sp|P04777|CB21_ARATH Chlorophyll a-b binding protein 165/180, ch... 185 2e-46
sp|P08963|CB22_HORVU Chlorophyll a-b binding protein 2, chloropl... 185 2e-46
sp|P12329|CB21_MAIZE Chlorophyll a-b binding protein 1, chloropl... 185 2e-46
sp|P04782|CB24_PETSP Chlorophyll a-b binding protein 25, chlorop... 184 3e-46
sp|P92919|CB23_APIGR Chlorophyll a-b binding protein, chloroplas... 184 3e-46
sp|P07369|CB2G_SOLLC Chlorophyll a-b binding protein 3C, chlorop... 184 4e-46
sp|P27494|CB23_TOBAC Chlorophyll a-b binding protein 36, chlorop... 184 4e-46
sp|P10049|CB21_PINTH Chlorophyll a-b binding protein type I, chl... 184 4e-46
sp|P15193|CB2A_PINSY Chlorophyll a-b binding protein type 2 memb... 183 6e-46
sp|P13851|CB21_SINAL Chlorophyll a-b binding protein 1, chloropl... 183 6e-46
sp|P08221|CB21_CUCSA Chlorophyll a-b binding protein of LHCII ty... 183 6e-46
sp|P27490|CB28_PEA Chlorophyll a-b binding protein 8, chloroplas... 183 8e-46
sp|P27495|CB24_TOBAC Chlorophyll a-b binding protein 40, chlorop... 183 8e-46
sp|P27492|CB21_TOBAC Chlorophyll a-b binding protein 16, chlorop... 183 8e-46
sp|P12471|CB21_SOYBN Chlorophyll a-b binding protein, chloroplas... 183 8e-46
sp|P15194|CB2B_PINSY Chlorophyll a-b binding protein type 2 memb... 182 1e-45
sp|P12470|CB25_NICPL Chlorophyll a-b binding protein E, chloropl... 182 1e-45
sp|P27496|CB25_TOBAC Chlorophyll a-b binding protein 50, chlorop... 182 1e-45
sp|P09756|CB23_SOYBN Chlorophyll a-b binding protein 3, chloropl... 182 1e-45

>sp|P15195|CB23_POLMU Chlorophyll a-b binding protein type 1 member
F3, chloroplastic OS=Polystichum munitum GN=CABF3 PE=3
SV=1
Length = 265

Score = 229 bits (584), Expect = 9e-60
Identities = 109/120 (90%), Positives = 112/120 (93%)
Frame = +3

Query: 66 KASNELSSKVASGQARVQMMAPKKASSSGSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDY 245
K NELS KV +G+ARVQMMAPK + SGSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDY
Sbjct: 18 KPVNELSRKVGAGEARVQMMAPKSKAPSGSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDY 77

Query: 246 GWDTAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWFKAGSQI 425
GWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVTPELLAKNGVKFGEAVWFKAGSQI
Sbjct: 78 GWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVTPELLAKNGVKFGEAVWFKAGSQI 137



Score = 143 bits (361), Expect = 7e-34
Identities = 70/73 (95%), Positives = 70/73 (95%)
Frame = +2

Query: 428 GPLGEVEDLIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKGP 607
GPLGEVED IYPGGSFDPLGLADDPEAFAELKVKELKNGRLAM SMFGFFVQAIVTGKGP
Sbjct: 179 GPLGEVEDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP 238

Query: 608 IENLSDHLADPTV 646
IENLSDHLADP V
Sbjct: 239 IENLSDHLADPAV 251



Score = 30.8 bits (68), Expect = 6.4
Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
Frame = +2

Query: 458 YPGG-SFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKG 604
+PG +D GL+ DPE FA+ + E+ + R AML G ++ G
Sbjct: 73 FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVTPELLAKNG 122


>sp|P12330|CB21_ORYSJ Chlorophyll a-b binding protein 1,
chloroplastic OS=Oryza sativa subsp. japonica GN=CAB1R
PE=2 SV=2
Length = 265

Score = 193 bits (490), Expect = 7e-49
Identities = 93/118 (78%), Positives = 100/118 (84%), Gaps = 4/118 (3%)
Frame = +3

Query: 84 SSKVASGQARVQMMA----PKKASSSGSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDYGW 251
+S G+AR+ M PK A+SSGS WYG+DR LYLGP SG PPSYL+GEFPGDYGW
Sbjct: 20 TSSALFGEARITMRKTAAKPKPAASSGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGW 79

Query: 252 DTAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWFKAGSQI 425
DTAGLSADPETFAKNRELEVIH RWAMLGALGCV PELLA+NGVKFGEAVWFKAGSQI
Sbjct: 80 DTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQI 137



Score = 134 bits (338), Expect = 3e-31
Identities = 63/71 (88%), Positives = 68/71 (95%)
Frame = +2

Query: 428 GPLGEVEDLIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKGP 607
GPLGEV D +YPGG+FDPLGLADDPEAFAELKVKE+KNGRLAM SMFGFFVQAIVTGKGP
Sbjct: 179 GPLGEVVDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 238

Query: 608 IENLSDHLADP 640
+ENL+DHLADP
Sbjct: 239 LENLADHLADP 249



Score = 32.0 bits (71), Expect = 2.9
Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 5/65 (7%)
Frame = +2

Query: 425 LGPL-GEVEDLI---YPGG-SFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAI 589
LGPL GE + +PG +D GL+ DPE FA+ + E+ + R AML G +
Sbjct: 58 LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEL 117

Query: 590 VTGKG 604
+ G
Sbjct: 118 LARNG 122


>sp|P27497|CB29_MAIZE Chlorophyll a-b binding protein M9,
chloroplastic OS=Zea mays GN=CAB-M9 PE=2 SV=1
Length = 265

Score = 191 bits (485), Expect = 3e-48
Identities = 98/125 (78%), Positives = 102/125 (81%), Gaps = 4/125 (3%)
Frame = +3

Query: 63 GKASNELSSKVASGQARVQMMAP----KKASSSGSIWYGSDRPLYLGPFSGSPPSYLSGE 230
GKA N SS G+ARV M K A+SSGS WYG DR LYLGP SG PPSYL+GE
Sbjct: 15 GKAVNVPSSLF--GEARVTMRKTAAKAKPAASSGSPWYGPDRVLYLGPLSGEPPSYLTGE 72

Query: 231 FPGDYGWDTAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWFK 410
FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCV PELLA+NGVKFGEAVWFK
Sbjct: 73 FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK 132

Query: 411 AGSQI 425
AGSQI
Sbjct: 133 AGSQI 137



Score = 133 bits (334), Expect = 9e-31
Identities = 62/71 (87%), Positives = 68/71 (95%)
Frame = +2

Query: 428 GPLGEVEDLIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKGP 607
GPLGEV D +YPGG+FDPLGLADDPEAFA++KVKELKNGRLAM SMFGFFVQAIVTGKGP
Sbjct: 179 GPLGEVVDPLYPGGTFDPLGLADDPEAFADVKVKELKNGRLAMFSMFGFFVQAIVTGKGP 238

Query: 608 IENLSDHLADP 640
+ENL+DHLADP
Sbjct: 239 LENLADHLADP 249



Score = 32.0 bits (71), Expect = 2.9
Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 5/65 (7%)
Frame = +2

Query: 425 LGPL-GEVEDLI---YPGG-SFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAI 589
LGPL GE + +PG +D GL+ DPE FA+ + E+ + R AML G +
Sbjct: 58 LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEL 117

Query: 590 VTGKG 604
+ G
Sbjct: 118 LARNG 122


>sp|P14278|CB24_SOLLC Chlorophyll a-b binding protein 4,
chloroplastic OS=Solanum lycopersicum GN=CAB4 PE=2 SV=1
Length = 265

Score = 191 bits (484), Expect = 4e-48
Identities = 93/126 (73%), Positives = 104/126 (82%), Gaps = 1/126 (0%)
Frame = +3

Query: 51 GEALGKASNELSSKVAS-GQARVQMMAPKKASSSGSIWYGSDRPLYLGPFSGSPPSYLSG 227
G+A+GK+ NE KV + G+ R+ M K S+ SIWYG DRP YLGPFS PSYL+G
Sbjct: 13 GQAVGKSQNEFIRKVGNFGEGRITMRRTVK-SAPQSIWYGEDRPKYLGPFSEQTPSYLTG 71

Query: 228 EFPGDYGWDTAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWF 407
EFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCV PE+L+KNGVKFGEAVWF
Sbjct: 72 EFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWF 131

Query: 408 KAGSQI 425
KAGSQI
Sbjct: 132 KAGSQI 137



Score = 131 bits (330), Expect = 3e-30
Identities = 63/71 (88%), Positives = 66/71 (92%)
Frame = +2

Query: 428 GPLGEVEDLIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKGP 607
GPLGE D IYPGG+FDPLGLADDPEAFAELKVKE+KNGRLAM SMFGFFVQAIVTGKGP
Sbjct: 179 GPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 238

Query: 608 IENLSDHLADP 640
IENLSDH+ DP
Sbjct: 239 IENLSDHINDP 249


>sp|P12332|CB21_SILPR Chlorophyll a-b binding protein, chloroplastic
(Fragment) OS=Silene pratensis PE=2 SV=2
Length = 205

Score = 191 bits (484), Expect = 4e-48
Identities = 96/125 (76%), Positives = 99/125 (79%)
Frame = +3

Query: 51 GEALGKASNELSSKVASGQARVQMMAPKKASSSGSIWYGSDRPLYLGPFSGSPPSYLSGE 230
G+ L K NEL KV RV M K S+ SIWYG DRP YLGPFS PSYL+GE
Sbjct: 13 GQTLLKPQNELVRKVGGNGGRVSMRRTIK-SAPESIWYGPDRPKYLGPFSEQTPSYLTGE 71

Query: 231 FPGDYGWDTAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWFK 410
FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCV PELLAKNGVKFGEAVWFK
Sbjct: 72 FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGVKFGEAVWFK 131

Query: 411 AGSQI 425
AGSQI
Sbjct: 132 AGSQI 136



Score = 51.6 bits (122), Expect = 3e-06
Identities = 22/28 (78%), Positives = 25/28 (89%)
Frame = +2

Query: 428 GPLGEVEDLIYPGGSFDPLGLADDPEAF 511
GPLGE D +YPGG+FDPLGLA+DPEAF
Sbjct: 178 GPLGEGLDQLYPGGAFDPLGLAEDPEAF 205


>sp|P04784|CB21_WHEAT Chlorophyll a-b binding protein, chloroplastic
OS=Triticum aestivum GN=WHAB1.6 PE=3 SV=1
Length = 266

Score = 190 bits (483), Expect = 5e-48
Identities = 96/124 (77%), Positives = 98/124 (79%), Gaps = 3/124 (2%)
Frame = +3

Query: 63 GKASNELSSKVASGQARVQMM---APKKASSSGSIWYGSDRPLYLGPFSGSPPSYLSGEF 233
GKA L S G ARV M A K SS S WYGSDR LYLGP SG PPSYL+GEF
Sbjct: 15 GKAVKNLPSSALIGDARVNMRKTAAKAKQVSSSSPWYGSDRVLYLGPLSGEPPSYLTGEF 74

Query: 234 PGDYGWDTAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWFKA 413
PGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCV PELLA+NGVKFGEA WFKA
Sbjct: 75 PGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAGWFKA 134

Query: 414 GSQI 425
GSQI
Sbjct: 135 GSQI 138



Score = 127 bits (318), Expect = 7e-29
Identities = 58/71 (81%), Positives = 67/71 (94%)
Frame = +2

Query: 428 GPLGEVEDLIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKGP 607
GPLGE+ D +YPGGSFDPLGLA+ P+AFAELKVKE+KNGRLAM SMFGFFVQAIVTGKGP
Sbjct: 180 GPLGEIVDPLYPGGSFDPLGLAERPQAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 239

Query: 608 IENLSDHLADP 640
+E+L+DH+ADP
Sbjct: 240 LEDLADHIADP 250



Score = 30.8 bits (68), Expect = 6.4
Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 5/65 (7%)
Frame = +2

Query: 425 LGPL-GEVEDLI---YPGG-SFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAI 589
LGPL GE + +PG +D GL+ DPE FA+ + E+ + R AML G +
Sbjct: 59 LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL 118

Query: 590 VTGKG 604
+ G
Sbjct: 119 LARNG 123


>sp|P06671|CB22_MAIZE Chlorophyll a-b binding protein, chloroplastic
OS=Zea mays PE=2 SV=1
Length = 265

Score = 190 bits (482), Expect = 6e-48
Identities = 97/125 (77%), Positives = 102/125 (81%), Gaps = 4/125 (3%)
Frame = +3

Query: 63 GKASNELSSKVASGQARVQMMAP----KKASSSGSIWYGSDRPLYLGPFSGSPPSYLSGE 230
GKA N SS G+ARV M K A++SGS WYG DR LYLGP SG PPSYL+GE
Sbjct: 15 GKAVNVPSSSF--GEARVTMRKTAAKAKPAAASGSPWYGPDRVLYLGPLSGEPPSYLTGE 72

Query: 231 FPGDYGWDTAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWFK 410
FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCV PELLA+NGVKFGEAVWFK
Sbjct: 73 FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK 132

Query: 411 AGSQI 425
AGSQI
Sbjct: 133 AGSQI 137



Score = 133 bits (335), Expect = 7e-31
Identities = 63/71 (88%), Positives = 67/71 (94%)
Frame = +2

Query: 428 GPLGEVEDLIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKGP 607
GPLGEV D +YPGGSFDPLGLADDPEAF ELKVKELK GRLAMLSMFGFFVQAIVTGKGP
Sbjct: 179 GPLGEVVDPLYPGGSFDPLGLADDPEAFGELKVKELKKGRLAMLSMFGFFVQAIVTGKGP 238

Query: 608 IENLSDHLADP 640
+ENL+DH+ADP
Sbjct: 239 LENLADHIADP 249



Score = 30.8 bits (68), Expect = 6.4
Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 5/65 (7%)
Frame = +2

Query: 425 LGPL-GEVEDLI---YPGG-SFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAI 589
LGPL GE + +PG +D GL+ DPE FA+ + E+ + R AML G +
Sbjct: 58 LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL 117

Query: 590 VTGKG 604
+ G
Sbjct: 118 LARNG 122


>sp|P20866|CB2_PHYPA Chlorophyll a-b binding protein, chloroplastic
OS=Physcomitrella patens PE=3 SV=1
Length = 269

Score = 188 bits (477), Expect = 2e-47
Identities = 92/127 (72%), Positives = 106/127 (83%), Gaps = 2/127 (1%)
Frame = +3

Query: 51 GEALGKASNELSSKVASG-QARVQMMAP-KKASSSGSIWYGSDRPLYLGPFSGSPPSYLS 224
G++L K NELS KV +ARV M K++ S +IWYG+DRP +LGPFSG PSYL+
Sbjct: 14 GQSLVKPVNELSRKVLGNVEARVTMRRTVSKSAGSDTIWYGADRPKFLGPFSGETPSYLN 73

Query: 225 GEFPGDYGWDTAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVW 404
GEF GDYGWDTAGLS+DPETFA+NRELEVIH RWAMLGALGC+TPELLAK+GVKFGEAVW
Sbjct: 74 GEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLAKSGVKFGEAVW 133

Query: 405 FKAGSQI 425
FKAG+QI
Sbjct: 134 FKAGAQI 140



Score = 134 bits (337), Expect = 4e-31
Identities = 63/71 (88%), Positives = 67/71 (94%)
Frame = +2

Query: 428 GPLGEVEDLIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKGP 607
GPLGEV D IYPGGSFDPLGLADDP+ FAELKVKE+KNGRLAM SMFGFFVQAIVTGKGP
Sbjct: 182 GPLGEVTDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 241

Query: 608 IENLSDHLADP 640
+ENL+DHLADP
Sbjct: 242 LENLNDHLADP 252



Score = 30.4 bits (67), Expect = 8.3
Identities = 15/44 (34%), Positives = 22/44 (50%)
Frame = +2

Query: 473 FDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKG 604
+D GL+ DPE FA + E+ + R AML G ++ G
Sbjct: 82 WDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLAKSG 125


>sp|P12331|CB22_ORYSJ Chlorophyll a-b binding protein 2,
chloroplastic OS=Oryza sativa subsp. japonica GN=CAB2R
PE=2 SV=2
Length = 261

Score = 188 bits (477), Expect = 2e-47
Identities = 93/125 (74%), Positives = 103/125 (82%), Gaps = 6/125 (4%)
Frame = +3

Query: 69 ASNELSSKVAS---GQARVQMM---APKKASSSGSIWYGSDRPLYLGPFSGSPPSYLSGE 230
+S L+ K A+ G+ R+ M A K ++SGS WYG+DR LYLGP SG PPSYL+GE
Sbjct: 9 SSPALAGKAAAKVFGEGRITMRKSAAKPKPAASGSPWYGADRVLYLGPLSGEPPSYLTGE 68

Query: 231 FPGDYGWDTAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWFK 410
FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCV PELLA+NGVKFGEAVWFK
Sbjct: 69 FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK 128

Query: 411 AGSQI 425
AGSQI
Sbjct: 129 AGSQI 133



Score = 135 bits (341), Expect = 1e-31
Identities = 64/71 (90%), Positives = 68/71 (95%)
Frame = +2

Query: 428 GPLGEVEDLIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKGP 607
GPLGEV D +YPGGSFDPLGLADDPEAFAELKVKE+KNGRLAM SMFGFFVQAIVTGKGP
Sbjct: 175 GPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 234

Query: 608 IENLSDHLADP 640
+ENL+DHLADP
Sbjct: 235 LENLADHLADP 245



Score = 32.0 bits (71), Expect = 2.9
Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 5/65 (7%)
Frame = +2

Query: 425 LGPL-GEVEDLI---YPGG-SFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAI 589
LGPL GE + +PG +D GL+ DPE FA+ + E+ + R AML G +
Sbjct: 54 LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEL 113

Query: 590 VTGKG 604
+ G
Sbjct: 114 LARNG 118


>sp|P27518|CB21_GOSHI Chlorophyll a-b binding protein 151,
chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2
Length = 265

Score = 186 bits (473), Expect = 7e-47
Identities = 94/126 (74%), Positives = 102/126 (80%), Gaps = 1/126 (0%)
Frame = +3

Query: 51 GEALGKASNELSSKV-ASGQARVQMMAPKKASSSGSIWYGSDRPLYLGPFSGSPPSYLSG 227
G+ K SNEL K+ A G RV M K++ + SIWYG DRP YLGPFS PSYL+G
Sbjct: 13 GQTALKQSNELVCKIGAVGGGRVSMRRTVKSAPT-SIWYGPDRPKYLGPFSDQIPSYLTG 71

Query: 228 EFPGDYGWDTAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWF 407
EFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCV PE+L+KNGVKFGEAVWF
Sbjct: 72 EFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWF 131

Query: 408 KAGSQI 425
KAGSQI
Sbjct: 132 KAGSQI 137



Score = 130 bits (328), Expect = 5e-30
Identities = 63/71 (88%), Positives = 66/71 (92%)
Frame = +2

Query: 428 GPLGEVEDLIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKGP 607
GPLGE D IYPGG+FDPLGLADDP+AFAELKVKE+KNGRLAM SMFGFFVQAIVTGKGP
Sbjct: 179 GPLGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 238

Query: 608 IENLSDHLADP 640
IENL DHLADP
Sbjct: 239 IENLFDHLADP 249



Score = 30.4 bits (67), Expect = 8.3
Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
Frame = +2

Query: 458 YPGG-SFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKG 604
+PG +D GL+ DPE FA+ + E+ + R AML G I++ G
Sbjct: 73 FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKNG 122


tr_hit_id A7PJV3
Definition tr|A7PJV3|A7PJV3_VITVI Chromosome chr12 scaffold_18, whole genome shotgun sequence OS=Vitis vinifera
Align length 125
Score (bit) 185.0
E-value 1.0e-79
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK957667|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0028_P14, 5'
(648 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PJV3|A7PJV3_VITVI Chromosome chr12 scaffold_18, whole genom... 185 1e-79
tr|Q7Y1A1|Q7Y1A1_BRAOL Chlorophyll a/b binding protein OS=Brassi... 180 4e-78
tr|A9NWZ3|A9NWZ3_PICSI Putative uncharacterized protein OS=Picea... 180 3e-77
tr|B6SZ08|B6SZ08_MAIZE Chlorophyll a-b binding protein 2 OS=Zea ... 186 2e-69
tr|A9P0Q2|A9P0Q2_PICSI Putative uncharacterized protein OS=Picea... 184 6e-62
tr|B5A4I6|B5A4I6_GYMST Light harvesting complex protein LHCII-3 ... 130 4e-57
tr|Q5CCK8|Q5CCK8_ADICA Chlorophyll a/b-binding protein OS=Adiant... 219 1e-55
tr|A9S6S7|A9S6S7_PHYPA Predicted protein OS=Physcomitrella paten... 201 3e-50
tr|A9TL35|A9TL35_PHYPA Predicted protein OS=Physcomitrella paten... 200 7e-50
tr|Q765P5|Q765P5_PHYPA Light-harvesting chlorophyll a/b-binding ... 199 1e-49
tr|A9RT62|A9RT62_PHYPA Predicted protein OS=Physcomitrella paten... 197 5e-49
tr|A9RJS3|A9RJS3_PHYPA Predicted protein OS=Physcomitrella paten... 197 5e-49
tr|A9RNP2|A9RNP2_PHYPA Predicted protein OS=Physcomitrella paten... 197 6e-49
tr|Q9SXW8|Q9SXW8_PHYPA Chlorophyll a/b-binding protein OS=Physco... 196 1e-48
tr|A9T769|A9T769_PHYPA Predicted protein OS=Physcomitrella paten... 196 1e-48
tr|A9SGM1|A9SGM1_PHYPA Predicted protein OS=Physcomitrella paten... 195 2e-48
tr|Q765P6|Q765P6_PHYPA Light-harvesting chlorophyll a/b-binding ... 195 2e-48
tr|A9T914|A9T914_PHYPA Predicted protein OS=Physcomitrella paten... 194 4e-48
tr|Q9M600|Q9M600_EUPES Chlorophyll a/b binding protein OS=Euphor... 193 7e-48
tr|A9S6F4|A9S6F4_PHYPA Predicted protein OS=Physcomitrella paten... 193 7e-48
tr|Q0J2G2|Q0J2G2_ORYSJ Os09g0346500 protein OS=Oryza sativa subs... 193 9e-48
tr|B8BEP6|B8BEP6_ORYSI Putative uncharacterized protein OS=Oryza... 193 9e-48
tr|B4FQ80|B4FQ80_MAIZE Chlorophyll a-b binding protein 2 OS=Zea ... 192 1e-47
tr|O24401|O24401_WHEAT Chlorophyll a/b-binding protein WCAB OS=T... 191 2e-47
tr|B4FUA1|B4FUA1_MAIZE Chlorophyll a-b binding protein 1 OS=Zea ... 191 2e-47
tr|A9RAS2|A9RAS2_PHYPA Predicted protein OS=Physcomitrella paten... 191 2e-47
tr|A9NT55|A9NT55_PICSI Putative uncharacterized protein OS=Picea... 191 3e-47
tr|B0L806|B0L806_9POAL Chloroplast chlorophyll a/b binding prote... 191 4e-47
tr|A9RBQ3|A9RBQ3_PHYPA Predicted protein OS=Physcomitrella paten... 190 7e-47
tr|Q8W0E6|Q8W0E6_ORYSJ cDNA clone:001-013-E06, full insert seque... 189 9e-47

>tr|A7PJV3|A7PJV3_VITVI Chromosome chr12 scaffold_18, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00018891001
PE=4 SV=1
Length = 254

Score = 185 bits (469), Expect(2) = 1e-79
Identities = 91/125 (72%), Positives = 102/125 (81%)
Frame = +3

Query: 51 GEALGKASNELSSKVASGQARVQMMAPKKASSSGSIWYGSDRPLYLGPFSGSPPSYLSGE 230
G+A+ A N ++ +A + +A KA SSGS WYG DR YLGPFSG PPSYL+GE
Sbjct: 16 GQAVKLAPN-VTELLAGRVTMRKSVAKSKAVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE 74

Query: 231 FPGDYGWDTAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWFK 410
FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCV PELL++NGVKFGEAVWFK
Sbjct: 75 FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVWFK 134

Query: 411 AGSQI 425
AG+QI
Sbjct: 135 AGAQI 139



Score = 136 bits (342), Expect(2) = 1e-79
Identities = 64/71 (90%), Positives = 68/71 (95%)
Frame = +2

Query: 428 GPLGEVEDLIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKGP 607
GPLGEV D +YPGGSFDPLGLADDPEAFAELKVKE+KNGRLAM SMFGFFVQAIVTGKGP
Sbjct: 168 GPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 227

Query: 608 IENLSDHLADP 640
+ENL+DHLADP
Sbjct: 228 LENLADHLADP 238


>tr|Q7Y1A1|Q7Y1A1_BRAOL Chlorophyll a/b binding protein OS=Brassica
oleracea PE=2 SV=1
Length = 273

Score = 180 bits (457), Expect(2) = 4e-78
Identities = 86/120 (71%), Positives = 95/120 (79%)
Frame = +3

Query: 66 KASNELSSKVASGQARVQMMAPKKASSSGSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDY 245
K S S + SG+ ++ K SGS WYGS+R YLGPFSG PPSYL+G+FPGDY
Sbjct: 19 KLSPAASEVLGSGRVTMRKTVAKPKGPSGSPWYGSERVKYLGPFSGEPPSYLTGQFPGDY 78

Query: 246 GWDTAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWFKAGSQI 425
GWDTAGLSA PETF +NRELEVIH RWAMLGALGCV PELLA+NGVKFGEAVWFKAGSQI
Sbjct: 79 GWDTAGLSAVPETFVRNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQI 138



Score = 135 bits (340), Expect(2) = 4e-78
Identities = 64/75 (85%), Positives = 69/75 (92%)
Frame = +2

Query: 416 LPDLGPLGEVEDLIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVT 595
+P GPLGE EDL+YPGGSFDPLGLA DP AFAELKVKE+KNGRLAM SMFGFFVQAIVT
Sbjct: 177 VPGDGPLGEAEDLLYPGGSFDPLGLATDPVAFAELKVKEIKNGRLAMFSMFGFFVQAIVT 236

Query: 596 GKGPIENLSDHLADP 640
GKGP+ENL+DHLADP
Sbjct: 237 GKGPLENLADHLADP 251


>tr|A9NWZ3|A9NWZ3_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 240

Score = 180 bits (456), Expect(2) = 3e-77
Identities = 88/113 (77%), Positives = 93/113 (82%)
Frame = +3

Query: 75 NELSSKVASGQARVQMMAPKKASSSGSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDYGWD 254
NEL KV + QAR+ M + S+ SIWYG DRP YLGPFS PSYL+GEFPGDYGWD
Sbjct: 23 NELVKKVGASQARITMRRTVR-SAPESIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWD 81

Query: 255 TAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWFKA 413
TAGLSADPETFAKNRELEVIH RWAMLGALGCV PELLAK GVKFGEAVWFKA
Sbjct: 82 TAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKTGVKFGEAVWFKA 134



Score = 133 bits (334), Expect(2) = 3e-77
Identities = 64/72 (88%), Positives = 67/72 (93%)
Frame = +2

Query: 428 GPLGEVEDLIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKGP 607
GPLGE D +YPGG+FDPLGLADDPEAFAELKVKE+KNGRLAM SMFGFFVQAIVTGKGP
Sbjct: 154 GPLGEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 213

Query: 608 IENLSDHLADPT 643
IENL DHLADPT
Sbjct: 214 IENLFDHLADPT 225


>tr|B6SZ08|B6SZ08_MAIZE Chlorophyll a-b binding protein 2 OS=Zea
mays PE=2 SV=1
Length = 241

Score = 186 bits (472), Expect(2) = 2e-69
Identities = 90/123 (73%), Positives = 100/123 (81%), Gaps = 1/123 (0%)
Frame = +3

Query: 60 LGKASNELSSKVASGQARVQMMAPK-KASSSGSIWYGSDRPLYLGPFSGSPPSYLSGEFP 236
+GK + G+ ++ A K K ++SGS WYG+DR LYLGP SG PPSYL+GEFP
Sbjct: 14 VGKPATSTRDVFGEGRITMRKTAGKPKPAASGSPWYGADRVLYLGPLSGQPPSYLTGEFP 73

Query: 237 GDYGWDTAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWFKAG 416
GDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCV PELLA+NGVKFGEAVWFKAG
Sbjct: 74 GDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG 133

Query: 417 SQI 425
SQI
Sbjct: 134 SQI 136



Score = 100 bits (249), Expect(2) = 2e-69
Identities = 47/58 (81%), Positives = 53/58 (91%)
Frame = +2

Query: 467 GSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKGPIENLSDHLADP 640
G+ + +ADDPEAFAELKVKE+KNGRLAM SMFGFFVQAIVTGKGP+ENL+DHLADP
Sbjct: 168 GAVEGYRIADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPVENLADHLADP 225


>tr|A9P0Q2|A9P0Q2_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 251

Score = 184 bits (466), Expect(2) = 6e-62
Identities = 91/112 (81%), Positives = 97/112 (86%), Gaps = 4/112 (3%)
Frame = +3

Query: 102 GQARVQMMAP--KK--ASSSGSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDYGWDTAGLS 269
G+AR+ M KK A+SS S WYG DR LYLGPFSG PPSYL+GEFPGDYGWDTAGLS
Sbjct: 39 GEARLTMRKATGKKSVAASSDSPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLS 98

Query: 270 ADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWFKAGSQI 425
ADPETFAKNRELEVIH RWAMLGALGCV PELLA+NGVKFGEAVWFKAG+QI
Sbjct: 99 ADPETFAKNRELEVIHGRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQI 150



Score = 78.2 bits (191), Expect(2) = 6e-62
Identities = 43/69 (62%), Positives = 48/69 (69%)
Frame = +2

Query: 434 LGEVEDLIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKGPIE 613
+G +E GG PLG +VKELKNGRLAM SMFGFFVQAIVTGKGP+E
Sbjct: 181 MGAIEGYRVAGG---PLG-----------EVKELKNGRLAMFSMFGFFVQAIVTGKGPLE 226

Query: 614 NLSDHLADP 640
NL+DHLADP
Sbjct: 227 NLADHLADP 235


>tr|B5A4I6|B5A4I6_GYMST Light harvesting complex protein LHCII-3
OS=Gymnochlora stellata PE=2 SV=1
Length = 300

Score = 130 bits (327), Expect(2) = 4e-57
Identities = 61/89 (68%), Positives = 66/89 (74%)
Frame = +3

Query: 159 WYGSDRPLYLGPFSGSPPSYLSGEFPGDYGWDTAGLSADPETFAKNRELEVIHRRWAMLG 338
WYG +RP YLGPF P+YL+GEFPGDYGWD+AGLSADP TF RE EVIH RWAMLG
Sbjct: 89 WYGENRPKYLGPFQSYTPAYLTGEFPGDYGWDSAGLSADPLTFKGYRETEVIHARWAMLG 148

Query: 339 ALGCVTPELLAKNGVKFGEAVWFKAGSQI 425
ALGC+ PELL N F VWFKAG I
Sbjct: 149 ALGCIFPELL--NSAGFNLPVWFKAGGTI 175



Score = 115 bits (288), Expect(2) = 4e-57
Identities = 52/72 (72%), Positives = 62/72 (86%)
Frame = +2

Query: 428 GPLGEVEDLIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKGP 607
GPLGE D++YPGG+FDPLG A DP AELKVKE+KNGRLAM +M G++VQA+ TGKGP
Sbjct: 216 GPLGEPADVLYPGGAFDPLGFAKDPSKAAELKVKEIKNGRLAMTAMLGYYVQALATGKGP 275

Query: 608 IENLSDHLADPT 643
IENLS+HLADP+
Sbjct: 276 IENLSEHLADPS 287


>tr|Q5CCK8|Q5CCK8_ADICA Chlorophyll a/b-binding protein OS=Adiantum
capillus-veneris GN=AcCab1 PE=4 SV=1
Length = 215

Score = 219 bits (558), Expect = 1e-55
Identities = 121/185 (65%), Positives = 127/185 (68%), Gaps = 40/185 (21%)
Frame = +3

Query: 66 KASNELSSKVASGQARVQMMAPKKASSSGSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDY 245
K NELS KV + +ARVQMMAPKK SSSG+I YG+DR LYLGPFSGSPPSYL+GEFPGDY
Sbjct: 26 KPVNELSRKVGTSEARVQMMAPKK-SSSGNIRYGADRLLYLGPFSGSPPSYLTGEFPGDY 84

Query: 246 GWDTAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWFKAGSQ- 422
GWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVTPELLAKNGVKFGEAVWFKAGSQ
Sbjct: 85 GWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVTPELLAKNGVKFGEAVWFKAGSQI 144

Query: 423 -------------------ILGLW--------------------VR*RISFTPEAPSTPW 485
IL +W VR R TP APSTP
Sbjct: 145 FADGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAVVPLVRLRTPSTPVAPSTPS 204

Query: 486 AWPMT 500
AW T
Sbjct: 205 AWLTT 209


>tr|A9S6S7|A9S6S7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_209208 PE=4 SV=1
Length = 263

Score = 201 bits (511), Expect = 3e-50
Identities = 99/125 (79%), Positives = 107/125 (85%)
Frame = +3

Query: 51 GEALGKASNELSSKVASGQARVQMMAPKKASSSGSIWYGSDRPLYLGPFSGSPPSYLSGE 230
G+ K+ NELS KV + QARV M +KASSS SIWYG+DRP YLGP SG PSYL+GE
Sbjct: 14 GQTALKSINELSRKVGNVQARVTM---RKASSSDSIWYGADRPKYLGPLSGETPSYLTGE 70

Query: 231 FPGDYGWDTAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWFK 410
F GDYGWDTAGLS+DPETFA+NRELEVIH RWAMLGALGCVTPELLAKNGVKFGEAVWFK
Sbjct: 71 FAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLAKNGVKFGEAVWFK 130

Query: 411 AGSQI 425
AGSQI
Sbjct: 131 AGSQI 135



Score = 135 bits (340), Expect = 2e-30
Identities = 64/71 (90%), Positives = 67/71 (94%)
Frame = +2

Query: 428 GPLGEVEDLIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKGP 607
GPLGEV D IYPGGSFDPLGLADDP+ FAELKVKE+KNGRLAM SMFGFFVQAIVTGKGP
Sbjct: 177 GPLGEVTDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 236

Query: 608 IENLSDHLADP 640
+ENLSDHLADP
Sbjct: 237 LENLSDHLADP 247


>tr|A9TL35|A9TL35_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_108362 PE=4 SV=1
Length = 263

Score = 200 bits (508), Expect = 7e-50
Identities = 96/125 (76%), Positives = 108/125 (86%)
Frame = +3

Query: 51 GEALGKASNELSSKVASGQARVQMMAPKKASSSGSIWYGSDRPLYLGPFSGSPPSYLSGE 230
G++L K NELS KV + +ARV M +K+S S SIWYG+DRP +LGPFSG PSYL+GE
Sbjct: 14 GQSLLKPVNELSRKVGTSEARVSM---RKSSGSDSIWYGADRPKFLGPFSGETPSYLNGE 70

Query: 231 FPGDYGWDTAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWFK 410
F GDYGWDTAGLS+DPETFA+NRELEVIH RWAMLGALGCVTPELLAKNGVKFGEAVWFK
Sbjct: 71 FAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLAKNGVKFGEAVWFK 130

Query: 411 AGSQI 425
AG+QI
Sbjct: 131 AGAQI 135



Score = 134 bits (337), Expect = 5e-30
Identities = 63/71 (88%), Positives = 67/71 (94%)
Frame = +2

Query: 428 GPLGEVEDLIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKGP 607
GPLGEV D IYPGGSFDPLGLADDP+ FAELKVKE+KNGRLAM SMFGFFVQAIVTGKGP
Sbjct: 177 GPLGEVTDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 236

Query: 608 IENLSDHLADP 640
+ENL+DHLADP
Sbjct: 237 LENLNDHLADP 247


>tr|Q765P5|Q765P5_PHYPA Light-harvesting chlorophyll a/b-binding
protein 2 (Predicted protein) OS=Physcomitrella patens
subsp. patens GN=PpLhcb2 PE=4 SV=1
Length = 267

Score = 199 bits (506), Expect = 1e-49
Identities = 97/126 (76%), Positives = 107/126 (84%), Gaps = 1/126 (0%)
Frame = +3

Query: 51 GEALGKASNELSSKVASGQARVQMMAP-KKASSSGSIWYGSDRPLYLGPFSGSPPSYLSG 227
G++L K NELS KV S QARV M K++ S SIWYG+DRP YLGPFSG PSYL+G
Sbjct: 14 GQSLLKPVNELSRKVGSSQARVTMRRTVNKSAGSDSIWYGADRPKYLGPFSGETPSYLNG 73

Query: 228 EFPGDYGWDTAGLSADPETFAKNRELEVIHRRWAMLGALGCVTPELLAKNGVKFGEAVWF 407
EF GDYGWDTAGLS+DPETFA+NRELEVIH RWAMLGALGCVTPELLAK+GVKFGEAVWF
Sbjct: 74 EFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLAKSGVKFGEAVWF 133

Query: 408 KAGSQI 425
KAG+QI
Sbjct: 134 KAGAQI 139



Score = 134 bits (337), Expect = 5e-30
Identities = 63/71 (88%), Positives = 67/71 (94%)
Frame = +2

Query: 428 GPLGEVEDLIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMLSMFGFFVQAIVTGKGP 607
GPLGEV D IYPGGSFDPLGLADDP+ FAELKVKE+KNGRLAM SMFGFFVQAIVTGKGP
Sbjct: 181 GPLGEVTDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 240

Query: 608 IENLSDHLADP 640
+ENL+DHLADP
Sbjct: 241 LENLNDHLADP 251