DK960025
Clone id TST39A01NGRL0006_E13
Library
Length 698
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_E13. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
CACCGCTACGTCTCGGCACGCCAGGAAAATATCTGTAGTCCCTGCCAATTAACCATCCAG
CAAACCAATTTTGAGAGGAGGCCCCGGCCCTTCCCTGCAGGGCCTGCACTCACACACCTC
CACCACCCAATCGTTAATTGGTAGAGAGCTAATTAATTACTTCACTCTCCTTGCCTTGCA
TTCCTATCAAGAGTTGACCAGGACCAGGAATATGGCCATGAAGTCCTCCTCCTCCTCCTC
CTCCTCCTGCCTGCCCATCTCCTCTGTCAATCATATCTCCTTGCTCTGCTCTTCTGTGGA
GAAATCTGCTGCCTTCTACGAGGATGTTCTGGGCTTCTTCCCCATTAGGCGTCCTGGCTC
TTTCGACTTTGATGGTGCTTGGCTCTTTAATTATGGGATGGGCATCCACCTCATCCAAGC
TCCCAATCCCTCTGAGCTTCCTAAGAAAGTGGACATAAATCCAAAGGACAACCACATGTC
CTTTCAGACTGGATGCCATGACATTGAGGAAGTAGAAGAGCGGCTGAAGGAGTTGGGAGT
GCGTTACATTCGCGTGCAGGTGGAGGAGGGTGGGATCCTGGTGGACCAAATTTTCTTCCA
CGACCCCGACGGCTTCATGATCGAGGTGTGCACATGCGAGAATTTGCCTCTCGTGCCACT
CAAGGGCTCACCATCCGCGCTCTCCCTTTGCTCGCTTC
■■Homology search results ■■ -
sp_hit_id A4IS40
Definition sp|A4IS40|FOSB_GEOTN Metallothiol transferase fosB OS=Geobacillus thermodenitrificans (strain NG80-2)
Align length 129
Score (bit) 53.5
E-value 1.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960025|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_E13, 5'
(698 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A4IS40|FOSB_GEOTN Metallothiol transferase fosB OS=Geobacillu... 54 1e-06
sp|Q65KJ5|FOSB_BACLD Metallothiol transferase fosB OS=Bacillus l... 49 2e-05
sp|Q9KBZ6|FOSB_BACHD Metallothiol transferase fosB OS=Bacillus h... 49 3e-05
sp|A7Z3A4|FOSB_BACA2 Metallothiol transferase fosB OS=Bacillus a... 47 8e-05
sp|P45871|YWKD_BACSU Uncharacterized protein ywkD OS=Bacillus su... 46 2e-04
sp|O31817|FOSB_BACSU Metallothiol transferase fosB OS=Bacillus s... 45 4e-04
sp|Q5WE80|FOSB_BACSK Metallothiol transferase fosB OS=Bacillus c... 43 0.001
sp|Q8CXK5|FOSB_OCEIH Metallothiol transferase fosB OS=Oceanobaci... 43 0.002
sp|Q81RK2|FOSB1_BACAN Metallothiol transferase fosB 1 OS=Bacillu... 42 0.004
sp|Q8ZM36|VIR17_SALTY Virulence protein STM3117 OS=Salmonella ty... 41 0.005
sp|P52096|YAER_ECOLI Uncharacterized protein yaeR OS=Escherichia... 41 0.007
sp|Q9I4K6|FOSA_PSEAE Glutathione transferase fosA OS=Pseudomonas... 40 0.009
sp|Q4L2Y9|FOSB_STAHJ Metallothiol transferase fosB OS=Staphyloco... 40 0.016
sp|Q55317|FOSB_STAHA Metallothiol transferase fosB OS=Staphyloco... 40 0.016
sp|Q63CC5|FOSB_BACCZ Metallothiol transferase fosB OS=Bacillus c... 40 0.016
sp|A0RD31|FOSB_BACAH Metallothiol transferase fosB OS=Bacillus t... 40 0.016
sp|P59291|FOSB_STAES Metallothiol transferase fosB OS=Staphyloco... 39 0.021
sp|P60865|FOSB_BACCE Metallothiol transferase fosB OS=Bacillus c... 39 0.021
sp|Q92AV8|FOSX_LISIN Fosfomycin resistance protein fosX OS=Liste... 39 0.035
sp|Q739M9|FOSB_BACC1 Metallothiol transferase fosB OS=Bacillus c... 39 0.035
sp|Q81W73|FOSB2_BACAN Metallothiol transferase fosB 2 OS=Bacillu... 39 0.035
sp|Q8GR45|BPHC_BACPJ Manganese-dependent 2,3-dihydroxybiphenyl 1... 39 0.035
sp|Q81EF2|FOSB_BACCR Metallothiol transferase fosB OS=Bacillus c... 38 0.046
sp|Q8Y6I2|FOSX_LISMO Fosfomycin resistance protein fosX OS=Liste... 38 0.060
sp|Q03377|FOSB_STAEP Metallothiol transferase fosB OS=Staphyloco... 38 0.060
sp|Q49VY9|FOSB_STAS1 Metallothiol transferase fosB OS=Staphyloco... 37 0.078
sp|Q6HJT7|FOSB_BACHK Metallothiol transferase fosB OS=Bacillus t... 37 0.078
sp|A8Z522|FOSB_STAAT Metallothiol transferase fosB OS=Staphyloco... 37 0.13
sp|P60864|FOSB_STAAN Metallothiol transferase fosB OS=Staphyloco... 37 0.13
sp|P60863|FOSB_STAAM Metallothiol transferase fosB OS=Staphyloco... 37 0.13

>sp|A4IS40|FOSB_GEOTN Metallothiol transferase fosB OS=Geobacillus
thermodenitrificans (strain NG80-2) GN=fosB PE=3 SV=1
Length = 140

Score = 53.5 bits (127), Expect = 1e-06
Identities = 40/129 (31%), Positives = 57/129 (44%), Gaps = 3/129 (2%)
Frame = +2

Query: 257 ISSVNHISLLCSSVEKSAAFYEDVLG---FFPIRRPGSFDFDGAWLFNYGMGIHLIQAPN 427
I +NH++ S +EKS FY++V G R FD +G WL A N
Sbjct: 3 IGGINHLTFSVSDLEKSIHFYQNVFGAKLLVKGRNLAYFDLNGIWL-----------ALN 51

Query: 428 PSELPKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGILVDQIFFHDP 607
+ + DI H++F D + V E+LKELGV + + E ++F DP
Sbjct: 52 VQQDIPRNDIQHSYTHIAFSVKEEDFDHVVEKLKELGVNILPGR-ERDERDKRSVYFTDP 110

Query: 608 DGFMIEVCT 634
DG E T
Sbjct: 111 DGHKFEFHT 119


>sp|Q65KJ5|FOSB_BACLD Metallothiol transferase fosB OS=Bacillus
licheniformis (strain DSM 13 / ATCC 14580) GN=fosB PE=3
SV=1
Length = 154

Score = 49.3 bits (116), Expect = 2e-05
Identities = 36/129 (27%), Positives = 57/129 (44%), Gaps = 3/129 (2%)
Frame = +2

Query: 257 ISSVNHISLLCSSVEKSAAFYEDVLG---FFPIRRPGSFDFDGAWLFNYGMGIHLIQAPN 427
I +NH+ S + S +FYE V + FD +G WL A N
Sbjct: 6 ILGINHLLFSVSDLSVSISFYEKVFDAKWLVKAEKTAYFDLNGIWL-----------AFN 54

Query: 428 PSELPKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGILVDQIFFHDP 607
+ K+ +I+ H++F D+ E++L +LGV ++ + G D I+F DP
Sbjct: 55 EEKDIKRQEIHDSYTHIAFSIQQEDLPFWEKKLHDLGVNVLKGRKRHEGDR-DSIYFSDP 113

Query: 608 DGFMIEVCT 634
DG E+ T
Sbjct: 114 DGHKFELHT 122


>sp|Q9KBZ6|FOSB_BACHD Metallothiol transferase fosB OS=Bacillus
halodurans GN=fosB PE=3 SV=1
Length = 141

Score = 48.5 bits (114), Expect = 3e-05
Identities = 37/126 (29%), Positives = 58/126 (46%), Gaps = 3/126 (2%)
Frame = +2

Query: 257 ISSVNHISLLCSSVEKSAAFYEDVLGFFPI---RRPGSFDFDGAWLFNYGMGIHLIQAPN 427
I +NH+ +E+S FY+ LG + R FD G WL L + P
Sbjct: 3 IQGINHLLFSVKCLERSIEFYKKALGAKLLVKGRTTAYFDLQGIWLA-------LNEEP- 54

Query: 428 PSELPKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGILVDQIFFHDP 607
++P+ +I+ H++F G ++EE ERL LGV ++ + + I+F DP
Sbjct: 55 --DIPRN-EIHQSYTHIAFTVGEEEMEEAYERLAGLGVNILKGRPRDPRDR-QSIYFTDP 110

Query: 608 DGFMIE 625
DG E
Sbjct: 111 DGHKFE 116


>sp|A7Z3A4|FOSB_BACA2 Metallothiol transferase fosB OS=Bacillus
amyloliquefaciens (strain FZB42) GN=fosB PE=3 SV=1
Length = 147

Score = 47.4 bits (111), Expect = 8e-05
Identities = 38/131 (29%), Positives = 60/131 (45%), Gaps = 5/131 (3%)
Frame = +2

Query: 257 ISSVNHISLLCSSVEKSAAFYEDVLG---FFPIRRPGSFDFDGAWLFNYGMGIHLIQAPN 427
I +NH+ S++EKS FYE V ++ FD +G WL ++L
Sbjct: 10 IKGINHLLFSVSNLEKSIEFYEKVFHAQLLVKGQKTAYFDLNGLWL-----ALNL----- 59

Query: 428 PSELPKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGILVDQ--IFFH 601
+++P+ +I+ HM+F D + + RLK L V + + + DQ I+F
Sbjct: 60 EADIPRN-EIHKSYTHMAFTIDPKDFDAIHHRLKNLNVNILNGRPRD---KQDQKSIYFT 115

Query: 602 DPDGFMIEVCT 634
DPDG E T
Sbjct: 116 DPDGHKFEFHT 126


>sp|P45871|YWKD_BACSU Uncharacterized protein ywkD OS=Bacillus
subtilis GN=ywkD PE=4 SV=1
Length = 128

Score = 45.8 bits (107), Expect = 2e-04
Identities = 39/129 (30%), Positives = 56/129 (43%), Gaps = 5/129 (3%)
Frame = +2

Query: 257 ISSVNHISLLCSSVEKSAAFYEDVLGFFPIRRP-----GSFDFDGAWLFNYGMGIHLIQA 421
+ S++HI+++CS EKS AFY LGF I+ GS+ D + N I L
Sbjct: 3 LKSIHHIAIICSDYEKSKAFYVHKLGFQVIQETYREERGSYKLDLS--LNGSYVIELFSF 60

Query: 422 PNPSELPKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGILVDQIFFH 601
P+P E + + H++F G D E K + IR G FF
Sbjct: 61 PDPPERQTRPEAAGL-RHLAFTVGSLDKAVQELHEKGIETEPIRTDPLTGKRFT---FFF 116

Query: 602 DPDGFMIEV 628
DPD +E+
Sbjct: 117 DPDQLPLEL 125


>sp|O31817|FOSB_BACSU Metallothiol transferase fosB OS=Bacillus
subtilis GN=fosB PE=1 SV=1
Length = 144

Score = 45.1 bits (105), Expect = 4e-04
Identities = 38/131 (29%), Positives = 57/131 (43%), Gaps = 3/131 (2%)
Frame = +2

Query: 251 LPISSVNHISLLCSSVEKSAAFYEDVLG---FFPIRRPGSFDFDGAWLFNYGMGIHLIQA 421
+ I +NH+ S ++ S FY+ V G R FD +G WL L +
Sbjct: 1 MEIKGINHLLFSVSHLDTSIDFYQKVFGAKLLVKGRTTAYFDMNGIWL-------ALNEE 53

Query: 422 PNPSELPKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGILVDQIFFH 601
P ++P+ DI H++F H+ EE+ +LK L V + + E I+F
Sbjct: 54 P---DIPRN-DIKLSYTHIAFTIEDHEFEEMSAKLKRLHVNILPGR-ERDERDRKSIYFT 108

Query: 602 DPDGFMIEVCT 634
DPDG E T
Sbjct: 109 DPDGHKFEFHT 119


>sp|Q5WE80|FOSB_BACSK Metallothiol transferase fosB OS=Bacillus
clausii (strain KSM-K16) GN=fosB PE=3 SV=1
Length = 146

Score = 43.1 bits (100), Expect = 0.001
Identities = 34/132 (25%), Positives = 58/132 (43%), Gaps = 6/132 (4%)
Frame = +2

Query: 257 ISSVNHISLLCSSVEKSAAFYEDVLGFFPI---RRPGSFDFDGAWLFNYGMGIHLIQAPN 427
++ +NH++ S+++K+ +FY+ V P+ + F G WL A N
Sbjct: 2 VNGINHMTFSVSNMDKAVSFYKHVFMEAPLVLGEKTAYFTIGGTWL-----------ALN 50

Query: 428 PSELPKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYI---RVQVEEGGILVDQIFF 598
+ +I H++F ++ RL E G + + QVE G I+F
Sbjct: 51 LQPDIDRKEIRQSYTHIAFSIEESQLDAFYTRLLEAGADILPGRKRQVETEG---KSIYF 107

Query: 599 HDPDGFMIEVCT 634
DPDG ++EV T
Sbjct: 108 RDPDGHLLEVHT 119


>sp|Q8CXK5|FOSB_OCEIH Metallothiol transferase fosB
OS=Oceanobacillus iheyensis GN=fosB PE=3 SV=2
Length = 139

Score = 42.7 bits (99), Expect = 0.002
Identities = 36/131 (27%), Positives = 54/131 (41%), Gaps = 5/131 (3%)
Frame = +2

Query: 257 ISSVNHISLLCSSVEKSAAFYEDVLG---FFPIRRPGSFDFDGAWLFNYGMGIHLIQAPN 427
I +NH+ S++E+S FY+ V R FD +G WL A N
Sbjct: 3 IKGLNHLLFSVSNLEQSIDFYQQVFDAKLLVKGRSTAYFDLNGIWL-----------ALN 51

Query: 428 PSELPKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYI--RVQVEEGGILVDQIFFH 601
+ + +IN H +F ++E + LK L V + R + E+ I+F
Sbjct: 52 EEKHIPRNEINESYTHTAFSIDESELESAIQHLKALNVNILEGRERAEQD---KQSIYFT 108

Query: 602 DPDGFMIEVCT 634
DPDG E T
Sbjct: 109 DPDGHKFEFHT 119


>sp|Q81RK2|FOSB1_BACAN Metallothiol transferase fosB 1 OS=Bacillus
anthracis GN=fosB1 PE=3 SV=1
Length = 138

Score = 41.6 bits (96), Expect = 0.004
Identities = 35/126 (27%), Positives = 57/126 (45%), Gaps = 3/126 (2%)
Frame = +2

Query: 257 ISSVNHISLLCSSVEKSAAFYEDVL-GFFPI--RRPGSFDFDGAWLFNYGMGIHLIQAPN 427
+ +NH+ S++E S FYE VL G + R+ F+ G W I
Sbjct: 2 LKGINHLCFSVSNLEDSITFYEKVLEGELLVRGRKLAYFNICGVW----------IALNE 51

Query: 428 PSELPKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGILVDQIFFHDP 607
+P+K +I+ H++F D E + +RL+E V ++ + E + I+F DP
Sbjct: 52 EIHIPRK-EIHQSYTHIAFSVEQKDFERLLQRLEENDVHILQGR-ERDVRDCESIYFVDP 109

Query: 608 DGFMIE 625
DG E
Sbjct: 110 DGHKFE 115


>sp|Q8ZM36|VIR17_SALTY Virulence protein STM3117 OS=Salmonella
typhimurium GN=STM3117 PE=1 SV=1
Length = 144

Score = 41.2 bits (95), Expect = 0.005
Identities = 35/126 (27%), Positives = 55/126 (43%), Gaps = 2/126 (1%)
Frame = +2

Query: 257 ISSVNHISLLCSSVEKSAAFYEDVLGFFPIRRPGSFDFDGAWLFNYGMGIHLIQAPNPSE 436
I ++H+ L S + + FYE+VLGF + +F + L I+L Q E
Sbjct: 21 IDRIDHLVLTVSDISTTIRFYEEVLGFSAV----TFKQNRKALIFGAQKINLHQQEMEFE 76

Query: 437 LPKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGIL--VDQIFFHDPD 610
PK P + F T I +V + + G+ + VE G + I+ DPD
Sbjct: 77 -PKASRPTPGSADLCFITST-PINDVVSEILQAGISIVEGPVERTGATGEIMSIYIRDPD 134

Query: 611 GFMIEV 628
G +IE+
Sbjct: 135 GNLIEI 140


tr_hit_id Q65XR4
Definition tr|Q65XR4|Q65XR4_ORYSJ Os05g0171900 protein OS=Oryza sativa subsp. japonica
Align length 148
Score (bit) 213.0
E-value 7.0e-54
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960025|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_E13, 5'
(698 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q65XR4|Q65XR4_ORYSJ Os05g0171900 protein OS=Oryza sativa subs... 213 7e-54
tr|A2Y0V7|A2Y0V7_ORYSI Putative uncharacterized protein OS=Oryza... 213 7e-54
tr|B4ERW1|B4ERW1_WHEAT Glyoxalase OS=Triticum aestivum GN=Glyoxa... 208 2e-52
tr|B4UW95|B4UW95_ARAHY Lactoylglutathione lyase OS=Arachis hypog... 207 7e-52
tr|Q9SSC3|Q9SSC3_ARATH F18B13.24 protein OS=Arabidopsis thaliana... 203 1e-50
tr|Q94E60|Q94E60_ORYSJ Putative uncharacterized protein OSJNBa00... 203 1e-50
tr|Q8LD97|Q8LD97_ARATH Putative uncharacterized protein (At1g801... 203 1e-50
tr|B6UGW8|B6UGW8_MAIZE Lactoylglutathione lyase OS=Zea mays PE=2... 203 1e-50
tr|B4FQ23|B4FQ23_MAIZE Lactoylglutathione lyase OS=Zea mays PE=2... 203 1e-50
tr|A7QIS6|A7QIS6_VITVI Chromosome chr9 scaffold_104, whole genom... 203 1e-50
tr|A5BHH5|A5BHH5_VITVI Putative uncharacterized protein (Chromos... 203 1e-50
tr|A2ZPT3|A2ZPT3_ORYSJ Putative uncharacterized protein OS=Oryza... 203 1e-50
tr|A9P1X4|A9P1X4_PICSI Putative uncharacterized protein OS=Picea... 201 4e-50
tr|A5AFR2|A5AFR2_VITVI Putative uncharacterized protein OS=Vitis... 200 6e-50
tr|A7QIS7|A7QIS7_VITVI Chromosome chr9 scaffold_104, whole genom... 199 1e-49
tr|A2WL84|A2WL84_ORYSI Putative uncharacterized protein OS=Oryza... 199 1e-49
tr|B8LNA7|B8LNA7_PICSI Putative uncharacterized protein OS=Picea... 197 7e-49
tr|Q9XI31|Q9XI31_ARATH F9L1.33 protein (Putative uncharacterized... 192 2e-47
tr|A9NU68|A9NU68_PICSI Putative uncharacterized protein OS=Picea... 191 4e-47
tr|A9NN94|A9NN94_PICSI Putative uncharacterized protein OS=Picea... 180 7e-44
tr|A7QCH7|A7QCH7_VITVI Chromosome chr12 scaffold_78, whole genom... 174 6e-42
tr|A9PBZ0|A9PBZ0_POPTR Putative uncharacterized protein OS=Popul... 170 9e-41
tr|Q2HVV5|Q2HVV5_MEDTR Glyoxalase/bleomycin resistance protein/d... 169 1e-40
tr|A9TWK7|A9TWK7_PHYPA Predicted protein (Fragment) OS=Physcomit... 168 3e-40
tr|A7QE15|A7QE15_VITVI Chromosome chr4 scaffold_83, whole genome... 168 3e-40
tr|A5B7V1|A5B7V1_VITVI Putative uncharacterized protein OS=Vitis... 168 3e-40
tr|Q9SKM8|Q9SKM8_ARATH Expressed protein OS=Arabidopsis thaliana... 168 3e-40
tr|Q941C8|Q941C8_ARATH At2g28420/T1B3.6 OS=Arabidopsis thaliana ... 168 3e-40
tr|A9PAS8|A9PAS8_POPTR Putative uncharacterized protein OS=Popul... 167 5e-40
tr|A9TU98|A9TU98_PHYPA Predicted protein OS=Physcomitrella paten... 161 3e-38

>tr|Q65XR4|Q65XR4_ORYSJ Os05g0171900 protein OS=Oryza sativa subsp.
japonica GN=P0685E10.15 PE=2 SV=1
Length = 208

Score = 213 bits (543), Expect = 7e-54
Identities = 98/148 (66%), Positives = 120/148 (81%), Gaps = 1/148 (0%)
Frame = +2

Query: 251 LPISSVNHISLLCSSVEKSAAFYEDVLGFFPIRRPGSFDFDGAWLFNYGMGIHLIQAPNP 430
LP++S+NHIS++C S+++S FY DVLGFFP+RRPGSFDFDGAWLFNYG+GIHL+QA +P
Sbjct: 18 LPLASLNHISIVCRSLQESLTFYTDVLGFFPVRRPGSFDFDGAWLFNYGIGIHLLQAEDP 77

Query: 431 SELPKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGILVDQIFFHDPD 610
LP K +INPKDNH+SFQ C + VE RLKELG+ YI+ VEEGGI VDQIFFHDPD
Sbjct: 78 DSLPGKTEINPKDNHISFQ--CESMVAVERRLKELGIPYIQRCVEEGGIYVDQIFFHDPD 135

Query: 611 GFMIEVCTCENLPLVPL-KGSPSALSLC 691
GFMIE+C C+NLP+VPL P ++ C
Sbjct: 136 GFMIEICNCDNLPVVPLGADQPLVMAAC 163


>tr|A2Y0V7|A2Y0V7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_18636 PE=4 SV=1
Length = 208

Score = 213 bits (543), Expect = 7e-54
Identities = 98/148 (66%), Positives = 120/148 (81%), Gaps = 1/148 (0%)
Frame = +2

Query: 251 LPISSVNHISLLCSSVEKSAAFYEDVLGFFPIRRPGSFDFDGAWLFNYGMGIHLIQAPNP 430
LP++S+NHIS++C S+++S FY DVLGFFP+RRPGSFDFDGAWLFNYG+GIHL+QA +P
Sbjct: 18 LPLASLNHISIVCRSLQESLTFYTDVLGFFPVRRPGSFDFDGAWLFNYGIGIHLLQAEDP 77

Query: 431 SELPKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGILVDQIFFHDPD 610
LP K +INPKDNH+SFQ C + VE RLKELG+ YI+ VEEGGI VDQIFFHDPD
Sbjct: 78 DSLPGKTEINPKDNHISFQ--CESMVAVERRLKELGIPYIQRCVEEGGIYVDQIFFHDPD 135

Query: 611 GFMIEVCTCENLPLVPL-KGSPSALSLC 691
GFMIE+C C+NLP+VPL P ++ C
Sbjct: 136 GFMIEICNCDNLPVVPLGADQPLVMAAC 163


>tr|B4ERW1|B4ERW1_WHEAT Glyoxalase OS=Triticum aestivum
GN=Glyoxalase_TA3B63B13-1 PE=4 SV=1
Length = 243

Score = 208 bits (530), Expect = 2e-52
Identities = 95/138 (68%), Positives = 119/138 (86%), Gaps = 1/138 (0%)
Frame = +2

Query: 251 LPISSVNHISLLCSSVEKSAAFYEDVLGFFPIRRPGSFDFDGAWLFNYGMGIHLIQAPNP 430
LP++S+NHIS++C S+E S +FY DVLGF IRRPGSFDFDGAWLFN+G+G+HL+QA +
Sbjct: 23 LPLASLNHISVVCRSLESSLSFYRDVLGFIQIRRPGSFDFDGAWLFNFGIGVHLLQAEDR 82

Query: 431 SEL-PKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGILVDQIFFHDP 607
+ L PKK +INPKDNH+SF T C +E V+ RLKELG+RY++ +VEEGGI VDQIFFHDP
Sbjct: 83 ASLPPKKAEINPKDNHISFTT-CESMEAVQRRLKELGIRYVQRRVEEGGIHVDQIFFHDP 141

Query: 608 DGFMIEVCTCENLPLVPL 661
DGFMIEVCTC+NLP++PL
Sbjct: 142 DGFMIEVCTCDNLPVIPL 159


>tr|B4UW95|B4UW95_ARAHY Lactoylglutathione lyase OS=Arachis hypogaea
PE=2 SV=1
Length = 181

Score = 207 bits (526), Expect = 7e-52
Identities = 92/139 (66%), Positives = 118/139 (84%)
Frame = +2

Query: 251 LPISSVNHISLLCSSVEKSAAFYEDVLGFFPIRRPGSFDFDGAWLFNYGMGIHLIQAPNP 430
L + S+NHISL+C SVE+S FY++VLGFFPIRRPGSFDFDGAWLF +G+GIHL+QA +P
Sbjct: 9 LQLKSLNHISLVCRSVEQSMDFYQNVLGFFPIRRPGSFDFDGAWLFGFGIGIHLLQAEDP 68

Query: 431 SELPKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGILVDQIFFHDPD 610
+LPKK +INPKDNH+SFQ C +E VE++LKE+ + ++R +VEEGGI VDQ+FFHDPD
Sbjct: 69 EKLPKKKEINPKDNHISFQ--CECMEAVEKKLKEMDINHVRARVEEGGIQVDQLFFHDPD 126

Query: 611 GFMIEVCTCENLPLVPLKG 667
GFM+E+C CE LP++PL G
Sbjct: 127 GFMVEICNCECLPVIPLVG 145


>tr|Q9SSC3|Q9SSC3_ARATH F18B13.24 protein OS=Arabidopsis thaliana
GN=F18B13.24 PE=4 SV=1
Length = 208

Score = 203 bits (516), Expect = 1e-50
Identities = 91/139 (65%), Positives = 115/139 (82%)
Frame = +2

Query: 251 LPISSVNHISLLCSSVEKSAAFYEDVLGFFPIRRPGSFDFDGAWLFNYGMGIHLIQAPNP 430
L I S+NHISLLC SVE+S +FY++VLGF PIRRP SFDFDGAWLF +G+GIHL+Q+P P
Sbjct: 50 LHIKSLNHISLLCRSVEESISFYQNVLGFLPIRRPDSFDFDGAWLFGHGIGIHLLQSPEP 109

Query: 431 SELPKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGILVDQIFFHDPD 610
+L KK +INPKDNH+SFQ C +E VE++LKE+ + Y+R VEEGGI VDQ+FFHDPD
Sbjct: 110 EKLLKKTEINPKDNHISFQ--CESMEAVEKKLKEMEIEYVRAVVEEGGIQVDQLFFHDPD 167

Query: 611 GFMIEVCTCENLPLVPLKG 667
FMIE+C C++LP++PL G
Sbjct: 168 AFMIEICNCDSLPVIPLAG 186


>tr|Q94E60|Q94E60_ORYSJ Putative uncharacterized protein
OSJNBa0089K24.11 (Os01g0173600 protein) OS=Oryza sativa
subsp. japonica GN=OSJNBa0089K24.11 PE=4 SV=1
Length = 215

Score = 203 bits (516), Expect = 1e-50
Identities = 89/137 (64%), Positives = 112/137 (81%)
Frame = +2

Query: 251 LPISSVNHISLLCSSVEKSAAFYEDVLGFFPIRRPGSFDFDGAWLFNYGMGIHLIQAPNP 430
LP+S++NH+SL+C S+ S FY D LGF +RRPGSFDFDGAWLFNYG+GIHL+QA +P
Sbjct: 17 LPLSTLNHVSLVCRSLSTSLTFYRDFLGFVSVRRPGSFDFDGAWLFNYGIGIHLLQAEDP 76

Query: 431 SELPKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGILVDQIFFHDPD 610
+P +INPKDNH+SF C +E V+ RLKE+GVRY++ +VEEGG+ VDQIFFHDPD
Sbjct: 77 ESMPPNKEINPKDNHISFT--CESMEAVQRRLKEMGVRYVQRRVEEGGVYVDQIFFHDPD 134

Query: 611 GFMIEVCTCENLPLVPL 661
GFMIE+CTC+ LP+VPL
Sbjct: 135 GFMIEICTCDKLPVVPL 151


>tr|Q8LD97|Q8LD97_ARATH Putative uncharacterized protein (At1g80160)
OS=Arabidopsis thaliana PE=2 SV=1
Length = 167

Score = 203 bits (516), Expect = 1e-50
Identities = 91/139 (65%), Positives = 115/139 (82%)
Frame = +2

Query: 251 LPISSVNHISLLCSSVEKSAAFYEDVLGFFPIRRPGSFDFDGAWLFNYGMGIHLIQAPNP 430
L I S+NHISLLC SVE+S +FY++VLGF PIRRP SFDFDGAWLF +G+GIHL+Q+P P
Sbjct: 9 LHIKSLNHISLLCRSVEESISFYQNVLGFLPIRRPDSFDFDGAWLFGHGIGIHLLQSPEP 68

Query: 431 SELPKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGILVDQIFFHDPD 610
+L KK +INPKDNH+SFQ C +E VE++LKE+ + Y+R VEEGGI VDQ+FFHDPD
Sbjct: 69 EKLLKKTEINPKDNHISFQ--CESMEAVEKKLKEMEIEYVRAVVEEGGIQVDQLFFHDPD 126

Query: 611 GFMIEVCTCENLPLVPLKG 667
FMIE+C C++LP++PL G
Sbjct: 127 AFMIEICNCDSLPVIPLAG 145


>tr|B6UGW8|B6UGW8_MAIZE Lactoylglutathione lyase OS=Zea mays PE=2
SV=1
Length = 222

Score = 203 bits (516), Expect = 1e-50
Identities = 97/153 (63%), Positives = 120/153 (78%), Gaps = 6/153 (3%)
Frame = +2

Query: 251 LPISSVNHISLLCSSVEKSAAFYEDVLGFFPIRRPGSFDFDGAWLFNYGMGIHLIQAPNP 430
LP++S+NHIS++C SVE S FY DVLGF PIRRPGSFDFDGAWLFNYG+G+HL+Q+ +P
Sbjct: 16 LPLASLNHISIVCRSVEASLRFYADVLGFVPIRRPGSFDFDGAWLFNYGIGVHLLQSEDP 75

Query: 431 SELPK-KVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGILVDQIFFHDP 607
LP+ K +INPKDNH+SFQ C + VE RLKE+G+ Y++ VEEGGI VDQIFFHDP
Sbjct: 76 GSLPENKGEINPKDNHISFQ--CESMVAVERRLKEMGIPYVQRCVEEGGINVDQIFFHDP 133

Query: 608 DGFMIEVCTCENLPLVPL-----KGSPSALSLC 691
D FMIEVC C+NLP+VPL + +P+ L C
Sbjct: 134 DAFMIEVCNCDNLPVVPLAAAADQRAPAVLGAC 166


>tr|B4FQ23|B4FQ23_MAIZE Lactoylglutathione lyase OS=Zea mays PE=2
SV=1
Length = 221

Score = 203 bits (516), Expect = 1e-50
Identities = 95/140 (67%), Positives = 115/140 (82%), Gaps = 1/140 (0%)
Frame = +2

Query: 251 LPISSVNHISLLCSSVEKSAAFYEDVLGFFPIRRPGSFDFDGAWLFNYGMGIHLIQAPNP 430
LP++S+NHIS++C SVE S FY DVLGF PIRRPGSFDF GAWLFNYG+GIHL+Q+ +P
Sbjct: 18 LPLASLNHISIVCRSVEASLRFYTDVLGFVPIRRPGSFDFGGAWLFNYGIGIHLLQSEDP 77

Query: 431 SEL-PKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGILVDQIFFHDP 607
L P+K +INPKDNH+SFQ C + VE RLKE+G+ Y++ VEEGGI VDQIFFHDP
Sbjct: 78 GSLPPEKGEINPKDNHISFQ--CESMVAVERRLKEIGIPYVQRCVEEGGINVDQIFFHDP 135

Query: 608 DGFMIEVCTCENLPLVPLKG 667
DGFMIE+C C+NLP+VPL G
Sbjct: 136 DGFMIEICNCDNLPVVPLAG 155


>tr|A7QIS6|A7QIS6_VITVI Chromosome chr9 scaffold_104, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00000378001
PE=4 SV=1
Length = 169

Score = 203 bits (516), Expect = 1e-50
Identities = 90/139 (64%), Positives = 118/139 (84%)
Frame = +2

Query: 251 LPISSVNHISLLCSSVEKSAAFYEDVLGFFPIRRPGSFDFDGAWLFNYGMGIHLIQAPNP 430
L ++S+NHISL+CSSVE+S FY++VLGF PIRRP SFDF+GAWLF+YG+GIHL+Q+ NP
Sbjct: 9 LHLTSLNHISLVCSSVEESINFYQNVLGFVPIRRPDSFDFNGAWLFSYGIGIHLLQSDNP 68

Query: 431 SELPKKVDINPKDNHMSFQTGCHDIEEVEERLKELGVRYIRVQVEEGGILVDQIFFHDPD 610
++PKK +INPKDNH+SFQ C + VE++LKE+G+ Y R +V EGGI VDQ+FFHDPD
Sbjct: 69 EKMPKKKEINPKDNHISFQ--CESMGAVEKKLKEMGMEYTRQKVVEGGIEVDQLFFHDPD 126

Query: 611 GFMIEVCTCENLPLVPLKG 667
GFM+E+C C+NLP++PL G
Sbjct: 127 GFMVEICNCDNLPVIPLAG 145