DK960027
Clone id TST39A01NGRL0006_E15
Library
Length 666
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_E15. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
CATCTGTGTTCCTTGACCGCTATTAAGTTGACCTGGAAATGCCATATTTGGCTGTTGATT
TAATATTCCAGCCATACCAAAATTTGCCTGTGGTATCCCAAATTGGCCCTGAGTGCTTTG
AAACCCTGGTAGCATGCCCGTGACACCATACATGGGGTTAGGCATCATTGTTTGAGCACC
CCTGAATACTGTTCCTGGCGTGTAAAACTGATTTCCAGGTGCATGACCAGCCATGCTCTG
GAATACCAATCCACCTCCAAAATAGCCAGGGTGTACTGAAGGTGGTGGAAAGACTTGTTG
GATAGCCTGTAGGTTGCTTCCCTGCCCATTAGAACCAGTTATAGGCTACTGAAAGGTGGC
TGGCTGAACTGGTACAGCTTGAAAGACTGGCATTTCAGCCACCTGTTCTTGCACCTTAGG
CACAGGTTGTGGAGACTGCATATTCTCCGTCAAGTGTACAGGTGTTTCCATTGACTCTGC
AGTATGAATCACCAGTGCTTGAGCCTTAACAGGCTTTTGAATATGATCCAGTGACCCAAC
TTGCTGAGACGGAAGAGGAGGTTGCAGAAAGGTTAAAAACCTCGGGTTCTGCATTACTTG
TGTGAACATAGCCACAACAGTAGCCAACTGGGTCCTGAAAATATCATCATCCGTCTGTGG
TGGTCT
■■Homology search results ■■ -
sp_hit_id Q0U1G2
Definition sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum
Align length 116
Score (bit) 35.0
E-value 0.36
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960027|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_E15, 5'
(666 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic ... 35 0.36
sp|Q3ZLR7|F48B1_HUMAN Protein FAM48B1 OS=Homo sapiens GN=FAM48B1... 35 0.47
sp|P0C7V6|F48B2_HUMAN Putative protein FAM48B2 OS=Homo sapiens G... 34 0.61
sp|Q99700|ATX2_HUMAN Ataxin-2 OS=Homo sapiens GN=ATXN2 PE=1 SV=2 34 0.61
sp|Q62407|SPEG_MOUSE Striated muscle-specific serine/threonine-p... 33 1.0
sp|Q9WV48|SHAN1_RAT SH3 and multiple ankyrin repeat domains prot... 33 1.0
sp|Q9Y566|SHAN1_HUMAN SH3 and multiple ankyrin repeat domains pr... 33 1.4
sp|P41828|NHR23_CAEEL Nuclear hormone receptor family member nhr... 33 1.4
sp|Q20497|MED12_CAEEL Mediator of RNA polymerase II transcriptio... 32 2.3
sp|Q3UH66|WNK2_MOUSE Serine/threonine-protein kinase WNK2 OS=Mus... 32 3.0
sp|Q05904|SM34_LYTPI 34 kDa spicule matrix protein OS=Lytechinus... 32 3.0
sp|P19020|DRD3_RAT D(3) dopamine receptor OS=Rattus norvegicus G... 32 3.0
sp|Q923E4|SIRT1_MOUSE NAD-dependent deacetylase sirtuin-1 OS=Mus... 32 4.0
sp|Q8BLB7|LMBL3_MOUSE Lethal(3)malignant brain tumor-like 3 prot... 32 4.0
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus... 32 4.0
sp|Q5M9G3|CAPR1_RAT Caprin-1 OS=Rattus norvegicus GN=Caprin1 PE=... 32 4.0
sp|Q60865|CAPR1_MOUSE Caprin-1 OS=Mus musculus GN=Caprin1 PE=1 SV=2 32 4.0
sp|A8ADI1|ZIPA_CITK8 Cell division protein zipA homolog OS=Citro... 31 5.2
sp|Q91094|PRLR_MELGA Prolactin receptor OS=Meleagris gallopavo G... 31 5.2
sp|Q04594|PRLR_CHICK Prolactin receptor OS=Gallus gallus GN=PRLR... 31 5.2
sp|O55225|OTOGL_MOUSE Otogelin OS=Mus musculus GN=Otog PE=1 SV=1 31 5.2
sp|P45931|YQBO_BACSU Uncharacterized protein yqbO OS=Bacillus su... 31 6.7
sp|P26313|GLYC_JUNIN Pre-glycoprotein polyprotein GP complex OS=... 31 6.7
sp|Q94KE2|TIC_ARATH Protein TIME FOR COFFEE OS=Arabidopsis thali... 31 6.8
sp|Q9P2R6|RERE_HUMAN Arginine-glutamic acid dipeptide repeats pr... 31 6.8
sp|Q04849|NTRX_AZOC5 Nitrogen assimilation regulatory protein nt... 31 6.8
sp|Q14444|CAPR1_HUMAN Caprin-1 OS=Homo sapiens GN=CAPRIN1 PE=1 SV=2 31 6.8
sp|Q8WYQ9|ZCH14_HUMAN Zinc finger CCHC domain-containing protein... 30 8.9
sp|Q9Y3S1|WNK2_HUMAN Serine/threonine-protein kinase WNK2 OS=Hom... 30 8.9
sp|O75177|S18L1_HUMAN SS18-like protein 1 OS=Homo sapiens GN=SS1... 30 8.9

>sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and
nuclear OS=Phaeosphaeria nodorum GN=PAB1 PE=3 SV=3
Length = 744

Score = 35.0 bits (79), Expect = 0.36
Identities = 37/116 (31%), Positives = 44/116 (37%), Gaps = 9/116 (7%)
Frame = -1

Query: 321 GSNLQAIQQVFPPPSVHPGYFGGG-LVFQSMAGHAPGNQFYTPGTVFRGAQTMMPNPMYG 145
G N Q + ++ PP + PG F G + Q A Q G RG PM G
Sbjct: 545 GPNAQQMPPMYMPPGMAPGAFPPGPYMNQQYMQLAQAAQQAMGGRGGRGG------PMPG 598

Query: 144 VTGML-------PGFQSTQGQFGIPQANFGMAGILNQQPNMAFP-GQLNSGQGTQM 1
+ GM PG + QG G PQ G G Q P FP G G G M
Sbjct: 599 MPGMPQAQIAGGPGIRGGQG--GFPQGGRGAPGGRGQPPMPGFPQGGRPGGPGVDM 652


>sp|Q3ZLR7|F48B1_HUMAN Protein FAM48B1 OS=Homo sapiens GN=FAM48B1
PE=2 SV=2
Length = 823

Score = 34.7 bits (78), Expect = 0.47
Identities = 31/110 (28%), Positives = 43/110 (39%), Gaps = 4/110 (3%)
Frame = -1

Query: 342 ITGSNGQGSNLQAIQQVFPPPSVHPGYFGGGLVFQSMAGHAPGNQFYTPGTVFRGAQTMM 163
+TG Q L ++QQ+ P + HP G G A G T G F Q +
Sbjct: 632 LTGPQQQSHQLVSLQQLQQPTAAHPPQPG-------PQGSALG--LSTQGQAFPAQQLLK 682

Query: 162 PNPMYGVTGMLPGFQ----STQGQFGIPQANFGMAGILNQQPNMAFPGQL 25
NP +G+ P Q S G +PQ + +L QQ P +L
Sbjct: 683 VNPTRARSGLQPQPQPAVLSLLGSAQVPQQGVQLPSVLRQQQPQPQPPKL 732


>sp|P0C7V6|F48B2_HUMAN Putative protein FAM48B2 OS=Homo sapiens
GN=FAM48B2 PE=5 SV=1
Length = 817

Score = 34.3 bits (77), Expect = 0.61
Identities = 32/115 (27%), Positives = 46/115 (40%), Gaps = 8/115 (6%)
Frame = -1

Query: 369 VQPATFQ*P-----ITGSNGQGSNLQAIQQVFPPPSVHPGYFG--GGLVFQSMAGHA-PG 214
++P T Q P +TG Q L ++QQ+ P + HP G G + S G A P
Sbjct: 646 LRPLTLQVPQGWAVLTGPQQQSHQLVSLQQLQQPTAAHPPQPGPQGSTLGLSTQGQAFPA 705

Query: 213 NQFYTPGTVFRGAQTMMPNPMYGVTGMLPGFQSTQGQFGIPQANFGMAGILNQQP 49
Q G+ + P P V +L G +PQ + +L QQP
Sbjct: 706 QQLLNVNLTGAGS-GLQPQPQAAVLSLL-------GSAQVPQQGVQLPFVLGQQP 752


>sp|Q99700|ATX2_HUMAN Ataxin-2 OS=Homo sapiens GN=ATXN2 PE=1 SV=2
Length = 1313

Score = 34.3 bits (77), Expect = 0.61
Identities = 45/192 (23%), Positives = 70/192 (36%), Gaps = 20/192 (10%)
Frame = -1

Query: 588 NPRFLTFLQP--------PLPSQQVG-SLDHIQKPVKAQALVIHTAESMETPVHLTENMQ 436
NPR +F QP P P Q S+ Q+P + A +M PV ++ +Q
Sbjct: 922 NPR--SFSQPKPSTTPTSPRPQAQPSPSMVGHQQPTPVYTQPVCFAPNMMYPVPVSPGVQ 979

Query: 435 SPQPVPKVQEQVAEMPVFQAVPVQPATFQ*PITGSNGQGSNLQAIQQVFPPPSVHPGYFG 256
P+P V + ++AVP P Q + Q + + PP + P +
Sbjct: 980 PLYPIPMTPMPVNQAKTYRAVPNMPQQRQ----DQHHQSAMMHPASAAGPPIAATPPAYS 1035

Query: 255 GGLVF--------QSMAGHAPGNQFYTP---GTVFRGAQTMMPNPMYGVTGMLPGFQSTQ 109
V Q + H P Q P V +G MM P + G++ S+
Sbjct: 1036 TQYVAYSPQQFPNQPLVQHVPHYQSQHPHVYSPVIQGNARMMAPPTHAQPGLV---SSSA 1092

Query: 108 GQFGIPQANFGM 73
Q+G + M
Sbjct: 1093 TQYGAHEQTHAM 1104


>sp|Q62407|SPEG_MOUSE Striated muscle-specific
serine/threonine-protein kinase OS=Mus musculus GN=Speg
PE=1 SV=2
Length = 3262

Score = 33.5 bits (75), Expect = 1.0
Identities = 39/162 (24%), Positives = 62/162 (38%), Gaps = 8/162 (4%)
Frame = -1

Query: 576 LTFLQPPLPSQQVGSLDHIQKPVKAQALVIHTAESMETPVHLTENMQSPQPVPKVQEQVA 397
L+ QPP P++ I K + A+ + P + E + P+P P + A
Sbjct: 2175 LSETQPPSPARPSVPKLSITKSPEPSAVTSRDSPQPPEPQPVPEKVPEPKPEPVRAAKPA 2234

Query: 396 EMPVFQAVPVQPATFQ*PITGSNGQGSNLQAIQQVFPPPSVHPGYFGGGLVFQSMAGHAP 217
+ P+ +P QP T I S S + Q PPS + VF +A P
Sbjct: 2235 QPPLALQMPTQPLTPYAQIMQSLQLSSPTLSPQDPAVPPSEPKPH---AAVFARVASPPP 2291

Query: 216 G------NQFYTPGTVFRGAQ--TMMPNPMYGVTGMLPGFQS 115
G TP + A+ T+ P P ++G + +S
Sbjct: 2292 GVSEKRVPSARTPPVLAEKARVPTVPPRPGSSLSGSIENLES 2333


>sp|Q9WV48|SHAN1_RAT SH3 and multiple ankyrin repeat domains protein 1
OS=Rattus norvegicus GN=Shank1 PE=1 SV=1
Length = 2167

Score = 33.5 bits (75), Expect = 1.0
Identities = 19/66 (28%), Positives = 30/66 (45%)
Frame = -1

Query: 450 TENMQSPQPVPKVQEQVAEMPVFQAVPVQPATFQ*PITGSNGQGSNLQAIQQVFPPPSVH 271
+++ SP P P + +P+ + P+ P F + + G G + VF PP H
Sbjct: 2013 SDHKVSPAPRP------SSLPILPSGPIYPGLFDIRSSPTGGAGGSTDPFAPVFVPP--H 2064

Query: 270 PGYFGG 253
PG GG
Sbjct: 2065 PGISGG 2070


>sp|Q9Y566|SHAN1_HUMAN SH3 and multiple ankyrin repeat domains protein
1 OS=Homo sapiens GN=SHANK1 PE=1 SV=1
Length = 2161

Score = 33.1 bits (74), Expect = 1.4
Identities = 20/66 (30%), Positives = 30/66 (45%)
Frame = -1

Query: 450 TENMQSPQPVPKVQEQVAEMPVFQAVPVQPATFQ*PITGSNGQGSNLQAIQQVFPPPSVH 271
+E+ SP P P + +P+ + P+ P F + + G G + VF PP H
Sbjct: 2007 SEHKVSPAPRP------SSLPILPSGPLYPGLFDIRGSPTGGAGGSADPFAPVFVPP--H 2058

Query: 270 PGYFGG 253
PG GG
Sbjct: 2059 PGISGG 2064


>sp|P41828|NHR23_CAEEL Nuclear hormone receptor family member nhr-23
OS=Caenorhabditis elegans GN=nhr-23 PE=2 SV=2
Length = 588

Score = 33.1 bits (74), Expect = 1.4
Identities = 31/88 (35%), Positives = 33/88 (37%), Gaps = 10/88 (11%)
Frame = -1

Query: 321 GSNLQAIQQVFPPPSVHPGYFGGGLVFQSMAGHAP-GNQFYTPG---TVFRGAQTMMPNP 154
G QAI + PP HP Y QSM GH P G G V T MP
Sbjct: 260 GLGYQAIYGDYSPPPSHPSY----CFDQSMYGHYPSGTSTPVNGYSIAVAATPTTPMPQN 315

Query: 153 MYGVT------GMLPGFQSTQGQFGIPQ 88
MYG T Q+T G F PQ
Sbjct: 316 MYGATPSSTNGTQYVAHQATGGSFPSPQ 343


>sp|Q20497|MED12_CAEEL Mediator of RNA polymerase II transcription
subunit 12 OS=Caenorhabditis elegans GN=dpy-22 PE=1 SV=2
Length = 3498

Score = 32.3 bits (72), Expect = 2.3
Identities = 16/46 (34%), Positives = 22/46 (47%)
Frame = -1

Query: 141 TGMLPGFQSTQGQFGIPQANFGMAGILNQQPNMAFPGQLNSGQGTQ 4
T LPG +++ G GM QQP + PG + +GQ TQ
Sbjct: 2938 TSQLPGASTSRMNQGSSNPQGGMQSYQQQQPVLGQPGPIQTGQSTQ 2983


>sp|Q3UH66|WNK2_MOUSE Serine/threonine-protein kinase WNK2 OS=Mus
musculus GN=Wnk2 PE=2 SV=2
Length = 2149

Score = 32.0 bits (71), Expect = 3.0
Identities = 41/160 (25%), Positives = 62/160 (38%), Gaps = 23/160 (14%)
Frame = -1

Query: 567 LQPPLPSQQVGSLDHIQKPVK---AQALVIHT------AESMETPVHLTENMQSPQP--- 424
+Q PLP Q +L + P Q + H + P L + +Q PQP
Sbjct: 728 VQQPLPMAQPPTLPQVLAPQPMGTVQPVPSHLPPYLAPTSQVVAPAQL-KPLQMPQPPLQ 786

Query: 423 -VPKVQEQVAEMPVFQAVPVQPATFQ*PITGSNGQGSNLQAIQQVFPPPSVHPGYFGGGL 247
+ +V Q+ +MPV V P T P+TG +G L + P P YF +
Sbjct: 787 PLAQVPPQMPQMPV-----VPPIT---PLTGLDGLPQTLTDLPAANVAPVPPPQYFSPAV 838

Query: 246 VFQSMAGHAPGNQF---------YTPGTVFR-GAQTMMPN 157
+ S+ P + + PGT QT++PN
Sbjct: 839 ILPSLTTPLPTSPALPMQAVKLPHPPGTPLAVPCQTIVPN 878


tr_hit_id B6PK73
Definition tr|B6PK73|B6PK73_BRAFL Putative uncharacterized protein OS=Branchiostoma floridae
Align length 197
Score (bit) 40.4
E-value 0.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960027|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_E15, 5'
(666 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6PK73|B6PK73_BRAFL Putative uncharacterized protein OS=Branc... 40 0.10
tr|B1FK93|B1FK93_9BURK Putative uncharacterized protein OS=Burkh... 39 0.22
tr|B5DR34|B5DR34_DROPS GA28525 OS=Drosophila pseudoobscura pseud... 39 0.22
tr|Q7KWU3|Q7KWU3_DICDI Putative uncharacterized protein OS=Dicty... 39 0.38
tr|Q5G5C1|Q5G5C1_PERAM Parcxpwnx04 OS=Periplaneta americana PE=2... 39 0.38
tr|Q559I7|Q559I7_DICDI Putative uncharacterized protein OS=Dicty... 39 0.38
tr|B5DMU2|B5DMU2_DROPS GA24149 OS=Drosophila pseudoobscura pseud... 39 0.38
tr|B4GW48|B4GW48_DROPE GL14775 OS=Drosophila persimilis GN=GL147... 39 0.38
tr|Q0AMW2|Q0AMW2_MARMM UDP-N-acetylmuramoylalanyl-D-glutamate--2... 38 0.50
tr|Q7K533|Q7K533_DROME CG11395 OS=Drosophila melanogaster GN=CG1... 38 0.50
tr|A6RAN8|A6RAN8_AJECN Polyadenylate-binding protein OS=Ajellomy... 38 0.50
tr|A7K8S6|A7K8S6_9PHYC Putative uncharacterized protein Z316R OS... 38 0.65
tr|B3R7W1|B3R7W1_CUPTR Putative General Secretory Pathway protei... 38 0.65
tr|Q5AG35|Q5AG35_CANAL Putative uncharacterized protein SEC16 OS... 38 0.65
tr|B8MBE6|B8MBE6_9EURO RNA binding protein (Arp), putative OS=Ta... 38 0.65
tr|Q4QCD1|Q4QCD1_LEIMA Putative uncharacterized protein OS=Leish... 37 0.85
tr|Q4S555|Q4S555_TETNG Chromosome 6 SCAF14737, whole genome shot... 37 1.1
tr|A8XU67|A8XU67_CAEBR CBR-TFG-1 protein OS=Caenorhabditis brigg... 37 1.1
tr|A7EWT2|A7EWT2_SCLS1 Predicted protein OS=Sclerotinia scleroti... 37 1.1
tr|B8A970|B8A970_ORYSI Putative uncharacterized protein OS=Oryza... 37 1.5
tr|B7SVM7|B7SVM7_NEPCL Aggregate spider glue 2 OS=Nephila clavip... 37 1.5
tr|B4HMI9|B4HMI9_DROSE GM21763 OS=Drosophila sechellia GN=GM2176... 37 1.5
tr|Q24JQ7|Q24JQ7_HUMAN ATXN2 protein OS=Homo sapiens GN=ATXN2 PE... 37 1.5
tr|Q0V6W8|Q0V6W8_PHANO Putative uncharacterized protein OS=Phaeo... 37 1.5
tr|A2R8V2|A2R8V2_ASPNC Contig An16c0270, complete genome OS=Aspe... 36 1.9
tr|Q90355|Q90355_CYPCA ZP2 OS=Cyprinus carpio GN=ZP2 PE=2 SV=1 36 2.5
tr|A9D7H5|A9D7H5_9RHIZ Putative uncharacterized protein OS=Hoefl... 36 2.5
tr|B7PSL1|B7PSL1_IXOSC Secreted protein, putative OS=Ixodes scap... 36 2.5
tr|B4MCP0|B4MCP0_DROVI GJ19769 OS=Drosophila virilis GN=GJ19769 ... 36 2.5
tr|B4JVM6|B4JVM6_DROGR GH22638 OS=Drosophila grimshawi GN=GH2263... 36 2.5

>tr|B6PK73|B6PK73_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_107932 PE=4 SV=1
Length = 769

Score = 40.4 bits (93), Expect = 0.10
Identities = 53/197 (26%), Positives = 71/197 (36%), Gaps = 2/197 (1%)
Frame = -1

Query: 591 QNPRFLTFLQPPLPSQQVGSLDHIQKPVKAQALVIHTAESMETPVHLTENMQSPQPVPKV 412
+NP L PP V H P A++ V +S P H + ++PQP+P
Sbjct: 456 RNPTNLQENMPPKAKSPVPPSAHSSVPPSAKSPVPPKIKS-PVPPHAPQPTKAPQPIPST 514

Query: 411 Q-EQVAEMPVFQAVPVQPATFQ*PITGSNGQGSNLQAIQQVFPPPSVHPGYFGGGLVFQS 235
Q P +GQ + IQ+ PP P + QS
Sbjct: 515 SGTQNIHAP------------------KSGQDGSFHDIQRDLAPPKKEPS---ASIAKQS 553

Query: 234 MAGHAPGNQFYTPGTVFRGAQTMMPNPMYGVTGMLPGFQSTQGQFGIPQANFGMAGILNQ 55
AG G+Q TP T AQ + NP VT Q+ Q A G +
Sbjct: 554 QAG---GSQRLTPETPANSAQKNVTNPTPEVT------QAQQKDASAKAAPTGPVKAKSP 604

Query: 54 QPNMAFPGQLN-SGQGT 7
+P + P Q N S QGT
Sbjct: 605 KPKLQPPLQENGSVQGT 621


>tr|B1FK93|B1FK93_9BURK Putative uncharacterized protein
OS=Burkholderia ambifaria IOP40-10
GN=BamIOP4010DRAFT_4454 PE=4 SV=1
Length = 989

Score = 39.3 bits (90), Expect = 0.22
Identities = 50/184 (27%), Positives = 63/184 (34%), Gaps = 1/184 (0%)
Frame = -1

Query: 558 PLPSQQVGSLDHIQKPVKAQALVIHTAESMETPVHLTENMQSPQPVPKVQEQVAEMPVFQ 379
P+P Q P A V T ++ P +++ P P Q Q A MP Q
Sbjct: 186 PMPLAQASDT----APPNTPAPVAQTPDAPMPPAQASDSPPPNTPAPVAQTQDAPMPPAQ 241

Query: 378 AVPVQPATFQ*PITGSNGQGSNLQAIQQVFPPPSVHPGYFGGGLVFQSMAGHAPGNQFYT 199
A QP+ P + + S A P PS P L A P N
Sbjct: 242 AASTQPSDTAAPTAATTSEPS---ASAAPAPAPSAQPS--DTPLQSAQAATTTPPN---A 293

Query: 198 PGTVFRGAQTMMPNPMYGVTGMLPGFQSTQGQFGIPQANFGMAGILNQQPNMAFPGQ-LN 22
P + + T MPN VT M PG Q Q G +Q P PG+ L
Sbjct: 294 PTQTAQASGTPMPNSPAPVTQM-PGAQLPSSQ-----------GPSSQTPGAQLPGESLQ 341

Query: 21 SGQG 10
QG
Sbjct: 342 RSQG 345


>tr|B5DR34|B5DR34_DROPS GA28525 OS=Drosophila pseudoobscura
pseudoobscura GN=GA28525 PE=4 SV=1
Length = 2075

Score = 39.3 bits (90), Expect = 0.22
Identities = 48/207 (23%), Positives = 76/207 (36%), Gaps = 16/207 (7%)
Frame = -1

Query: 600 QVMQNPRFLTFLQPPLPSQQVGSLDHIQKPVKAQALVIHTAESMETPVHLTENMQSPQPV 421
Q++ +P+ L +LQ QQ Q+ + Q + + + +H+ + Q Q
Sbjct: 899 QILSDPQRLQYLQQQQLMQQKQQQQQQQQQQQPQLV----GATQQQQIHIQQQQQQQQQA 954

Query: 420 PKVQEQVAEMPVFQAVPVQPATFQ*PITGSNGQGSNLQAIQQVF----------PPPSVH 271
P+ Q+Q+ + Q +P+ P Q Q +QQV PPP
Sbjct: 955 PQQQQQILQ----QKLPIDP---------QQQQQQQQQIMQQVLIKQQQLPQRTPPPQQQ 1001

Query: 270 PGYFGGGLVFQSMAGHAPGNQ--FYTPGTVFRGAQTM----MPNPMYGVTGMLPGFQSTQ 109
L QS HA Q ++P + G P G+ LPG T
Sbjct: 1002 QQQQQLLLQQQSPQHHAQMQQSAHWSPQSPASGQMAPTTPGTPTSSVGMQSPLPGGPPTP 1061

Query: 108 GQFGIPQANFGMAGILNQQPNMAFPGQ 28
Q P F G+ +P ++PGQ
Sbjct: 1062 QQHQQPPQQFAPRGL---RPQTSWPGQ 1085


>tr|Q7KWU3|Q7KWU3_DICDI Putative uncharacterized protein
OS=Dictyostelium discoideum PE=4 SV=1
Length = 1483

Score = 38.5 bits (88), Expect = 0.38
Identities = 33/133 (24%), Positives = 48/133 (36%), Gaps = 16/133 (12%)
Frame = -1

Query: 633 TQLATVVAMFTQVMQNPRFLTFLQPPLPSQQVGSLD----------------HIQKPVKA 502
T T A T Q P L QPP P+Q V S+ IQ ++
Sbjct: 1127 TTSTTATATMTTTTQPP-VLVPNQPPTPNQLVNSMSPSPSPTIQQQNILPTQQIQPQIQP 1185

Query: 501 QALVIHTAESMETPVHLTENMQSPQPVPKVQEQVAEMPVFQAVPVQPATFQ*PITGSNGQ 322
Q + + + P + Q PQP P+ Q+ ++ + Q + Q Q + Q
Sbjct: 1186 QQQIQSPQQQFQQPQPHQQQFQQPQPQPQQQQNISHLQPPQILQQQQQQIQQQLQQQQLQ 1245

Query: 321 GSNLQAIQQVFPP 283
LQ Q PP
Sbjct: 1246 QQQLQQQLQQLPP 1258


>tr|Q5G5C1|Q5G5C1_PERAM Parcxpwnx04 OS=Periplaneta americana PE=2
SV=1
Length = 238

Score = 38.5 bits (88), Expect = 0.38
Identities = 53/203 (26%), Positives = 73/203 (35%), Gaps = 12/203 (5%)
Frame = -1

Query: 603 TQVMQNPRFLTFLQPPLPSQQVGSLDHIQKPVKAQALVIHTAESMETPVHLTENM----Q 436
+QV+Q P L P P+ Q + +P I+ + PV+L + +
Sbjct: 54 SQVVQPPVIL-----PQPTCQP---PYCPQPPPVYQPPIYQPPVYQPPVYLPQPICQQPY 105

Query: 435 SPQPVPKVQEQVAEMPVFQAVPVQPATFQ*PITGSNGQGSNLQAIQQVFPPPSVHPGYFG 256
PQP P Q V + PV+Q QP +Q P+ G + +P P P G
Sbjct: 106 CPQPPPVYQPPVYQPPVYQPPVYQPPVYQPPVYQPPVSGCYIN-----YPSP-CPPQCLG 159

Query: 255 GGLVFQSMAGHAPGNQF----YTPGTVFRGAQTMMPNPMYGVTGM----LPGFQSTQGQF 100
G AP NQ+ PG + YG G PG G +
Sbjct: 160 ACTYVPLQTGCAPLNQWPFLRCAPGNSYSYLGGYGGIGGYGTPGAGGYGAPGI----GSY 215

Query: 99 GIPQANFGMAGILNQQPNMAFPG 31
G P G+ GI QP F G
Sbjct: 216 GTPGITPGIGGIGGVQPGQPFVG 238


>tr|Q559I7|Q559I7_DICDI Putative uncharacterized protein
OS=Dictyostelium discoideum GN=DDB_0203776 PE=4 SV=2
Length = 1493

Score = 38.5 bits (88), Expect = 0.38
Identities = 33/133 (24%), Positives = 48/133 (36%), Gaps = 16/133 (12%)
Frame = -1

Query: 633 TQLATVVAMFTQVMQNPRFLTFLQPPLPSQQVGSLD----------------HIQKPVKA 502
T T A T Q P L QPP P+Q V S+ IQ ++
Sbjct: 1137 TTSTTATATMTTTTQPP-VLVPNQPPTPNQLVNSMSPSPSPTIQQQNILPTQQIQPQIQP 1195

Query: 501 QALVIHTAESMETPVHLTENMQSPQPVPKVQEQVAEMPVFQAVPVQPATFQ*PITGSNGQ 322
Q + + + P + Q PQP P+ Q+ ++ + Q + Q Q + Q
Sbjct: 1196 QQQIQSPQQQFQQPQPHQQQFQQPQPQPQQQQNISHLQPPQILQQQQQQIQQQLQQQQLQ 1255

Query: 321 GSNLQAIQQVFPP 283
LQ Q PP
Sbjct: 1256 QQQLQQQLQQLPP 1268


>tr|B5DMU2|B5DMU2_DROPS GA24149 OS=Drosophila pseudoobscura
pseudoobscura GN=GA24149 PE=4 SV=1
Length = 953

Score = 38.5 bits (88), Expect = 0.38
Identities = 39/103 (37%), Positives = 44/103 (42%), Gaps = 11/103 (10%)
Frame = -1

Query: 345 PITGSN---GQGSNLQAIQQVFPPPSVHPGY-----FGGGLVFQSMAGHAPGNQFY---T 199
P G N GQ L QQ FP + PG G G+ Q M G APG+Q
Sbjct: 234 PSNGDNVPTGQPPALWPPQQGFPVHGMAPGTQCMHAIGPGI--QGMQGMAPGSQGMQGMA 291

Query: 198 PGTVFRGAQTMMPNPMYGVTGMLPGFQSTQGQFGIPQANFGMA 70
PG +G Q M Y + GM PG Q QG QA GMA
Sbjct: 292 PG--IQGIQGMAAGTQY-MQGMAPGSQGMQGMAAGTQAMQGMA 331


>tr|B4GW48|B4GW48_DROPE GL14775 OS=Drosophila persimilis GN=GL14775
PE=4 SV=1
Length = 993

Score = 38.5 bits (88), Expect = 0.38
Identities = 34/107 (31%), Positives = 42/107 (39%), Gaps = 5/107 (4%)
Frame = -1

Query: 336 GSNGQGSNLQAIQQVFPPPSVHPGYFGGGLVFQSMAGHAPGNQFYTPGTVFRGAQTMMPN 157
G G Q +Q + P G G Q MA Q PGT +G Q M P
Sbjct: 298 GMQGMAPGSQGMQGMAPGSLGMQGMAPGTQGIQGMAAGTQDMQRMAPGT--QGMQGMAPR 355

Query: 156 PMYGVTGMLPGFQSTQGQFGIPQANFGMA-----GILNQQPNMAFPG 31
G+ GM PG Q+ QG Q GMA G +Q ++ PG
Sbjct: 356 SQ-GMQGMAPGTQAMQGMAPGTQGMQGMAPVSQFGAYGEQRSLPTPG 401


>tr|Q0AMW2|Q0AMW2_MARMM UDP-N-acetylmuramoylalanyl-D-glutamate--2,
6-diaminopimelate ligase OS=Maricaulis maris (strain
MCS10) GN=Mmar10_2083 PE=3 SV=1
Length = 483

Score = 38.1 bits (87), Expect = 0.50
Identities = 30/105 (28%), Positives = 47/105 (44%)
Frame = -1

Query: 570 FLQPPLPSQQVGSLDHIQKPVKAQALVIHTAESMETPVHLTENMQSPQPVPKVQEQVAEM 391
F+ LP +V D I K + A A VI T E +E PV + + P+P + A
Sbjct: 35 FVFAALPGVKVHGRDFIPKALTAGASVILTDEPVEAPVPV---IAVPEPAALLARMAARF 91

Query: 390 PVFQAVPVQPATFQ*PITGSNGQGSNLQAIQQVFPPPSVHPGYFG 256
P QP ITG+NG+ S ++ ++Q++ + G
Sbjct: 92 -----YPRQPGHIV-AITGTNGKSSTVEFLRQIWAGAGIEAACLG 130


>tr|Q7K533|Q7K533_DROME CG11395 OS=Drosophila melanogaster
GN=CG11395 PE=1 SV=1
Length = 456

Score = 38.1 bits (87), Expect = 0.50
Identities = 31/103 (30%), Positives = 39/103 (37%), Gaps = 7/103 (6%)
Frame = -1

Query: 288 PPPSVHPGY--FGGGLVFQSMAGHA---PGNQFYTPGTVFRGAQTMMPNPMYGVTGMLPG 124
PPPS +P GG + G PG+QF+ G F Q P P+ PG
Sbjct: 73 PPPSYYPDNQPSGGRQPYYPNVGAVQGQPGSQFHQHGGGFHRGQQEYPYPVGDFNRGHPG 132

Query: 123 FQSTQGQFGIPQANFGMAG--ILNQQPNMAFPGQLNSGQGTQM 1
Q G F Q F G QP+ PG SG ++
Sbjct: 133 LQQPGGDFNRGQPGFQQPGNEFNRPQPSGRAPGHQQSGSHEEL 175