DK960028
Clone id TST39A01NGRL0006_E16
Library
Length 681
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_E16. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID
Sequence
GGCAGGCAGGCAGGCAGGCCACACGTGCCATGCCCGAGGCGAGAACGCGAACGCAGGCTC
GACTTCACACTTCCTTTGTCTGCTACCGCCCTTCCCCCTCGATCCCTTCGTAGACCTAAT
TGTCACCTGCTTGCTTGCACCGCCTCCTCAGCTATGGCTGCCAACTTCTGGGGCTCCTCC
CAATGGAAGCTACTTGAGCAAGACGAGATTGGACATGTATTTCCTGCTGATCAAGAAAAT
GGGATATCCCCAGAGGATGCAAAAATCATAAAGATTCACATGTCTGAATATATACAAAGT
TTAGCACACCAAGTGAAGGTGCGACAAAGGGTTGTTGCAACAGCAATTGCTTATTTTAGG
CGAGTTTACACAAGAAAAAGTTTTGTCGAATATGATCCACGTCTTGTCGCTCCCACATGC
TTGTACTTGGCCTCAAAAGCAGAGGAGAGCACAGTGCAGGCTAAACTCCTCATTTTTTAC
ATGAAGAAAACTAGGGCATTTCCTCAAGAGAAATGTAGCTATGAGGTCCCAGATATCTTG
CACATGGAGATGAGGCTACTTGAAGCTCTTGATTTCTACCTGATTATTTATCATCCATAT
CGATCTTTGATACAGTTGTTGCAAGATGCTGGCATCACGGAAATGACAAAAATTACTTGG
TCTCTGGTTAATGATCTATAC
■■Homology search results ■■ -
sp_hit_id P93411
Definition sp|P93411|CCC11_ORYSJ Cyclin-C1-1 OS=Oryza sativa subsp. japonica
Align length 177
Score (bit) 234.0
E-value 4.0e-61
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960028|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_E16, 5'
(681 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P93411|CCC11_ORYSJ Cyclin-C1-1 OS=Oryza sativa subsp. japonic... 234 4e-61
sp|Q9FJK7|CCC12_ARATH Cyclin-C1-2 OS=Arabidopsis thaliana GN=CYC... 223 7e-58
sp|Q9FJK6|CCC11_ARATH Cyclin-C1-1 OS=Arabidopsis thaliana GN=CYC... 212 1e-54
sp|Q86KE7|CCNC_DICDI Cyclin-C OS=Dictyostelium discoideum GN=cyc... 138 3e-32
sp|Q28F72|CCNC_XENTR Cyclin-C OS=Xenopus tropicalis GN=ccnc PE=2... 120 7e-27
sp|Q4KLA0|CCNC_XENLA Cyclin-C OS=Xenopus laevis GN=ccnc PE=2 SV=1 120 7e-27
sp|P24863|CCNC_HUMAN Cyclin-C OS=Homo sapiens GN=CCNC PE=1 SV=2 120 7e-27
sp|P55168|CCNC_CHICK Cyclin-C OS=Gallus gallus GN=CCNC PE=3 SV=1 120 7e-27
sp|Q3ZCK5|CCNC_BOVIN Cyclin-C OS=Bos taurus GN=CCNC PE=2 SV=1 120 7e-27
sp|P39947|CCNC_RAT Cyclin-C OS=Rattus norvegicus GN=Ccnc PE=2 SV=2 116 1e-25
sp|Q62447|CCNC_MOUSE Cyclin-C OS=Mus musculus GN=Ccnc PE=2 SV=3 115 2e-25
sp|Q16JA2|CCNC_AEDAE Cyclin-C OS=Aedes aegypti GN=CycC PE=3 SV=1 115 2e-25
sp|Q7QB13|CCNC_ANOGA Cyclin-C OS=Anopheles gambiae GN=CycC PE=3 ... 114 4e-25
sp|Q29AI1|CCNC_DROPS Cyclin-C OS=Drosophila pseudoobscura pseudo... 111 4e-24
sp|P25008|CCNC_DROME Cyclin-C OS=Drosophila melanogaster GN=CycC... 109 1e-23
sp|Q6CAC7|SSN8_YARLI RNA polymerase II holoenzyme cyclin-like su... 92 3e-18
sp|Q2UDB2|SSN8_ASPOR RNA polymerase II holoenzyme cyclin-like su... 87 8e-17
sp|Q4P101|SSN8_USTMA RNA polymerase II holoenzyme cyclin-like su... 87 1e-16
sp|Q5BBA8|SSN8_EMENI RNA polymerase II holoenzyme cyclin-like su... 86 1e-16
sp|Q4WZT9|SSN8_ASPFU RNA polymerase II holoenzyme cyclin-like su... 86 1e-16
sp|Q0CV29|SSN8_ASPTN RNA polymerase II holoenzyme cyclin-like su... 85 4e-16
sp|A1C7R6|SSN8_ASPCL RNA polymerase II holoenzyme cyclin-like su... 85 4e-16
sp|A3LPX1|SSN8_PICST RNA polymerase II holoenzyme cyclin-like su... 84 9e-16
sp|Q2GVK1|SSN8_CHAGB RNA polymerase II holoenzyme cyclin-like su... 84 9e-16
sp|O94503|SRB11_SCHPO RNA polymerase II holoenzyme cyclin-like s... 81 6e-15
sp|Q9HE63|SSN8_NEUCR RNA polymerase II holoenzyme cyclin-like su... 80 1e-14
sp|Q5A4H9|SSN8_CANAL RNA polymerase II holoenzyme cyclin-like su... 79 2e-14
sp|A4RD79|SSN8_MAGGR RNA polymerase II holoenzyme cyclin-like su... 77 7e-14
sp|Q9TYP2|CCNC_CAEEL Cyclin-C OS=Caenorhabditis elegans GN=cic-1... 76 2e-13
sp|Q6BYF8|SSN8_DEBHA RNA polymerase II holoenzyme cyclin-like su... 75 3e-13

>sp|P93411|CCC11_ORYSJ Cyclin-C1-1 OS=Oryza sativa subsp. japonica
GN=Os09g0504400 PE=2 SV=1
Length = 257

Score = 234 bits (596), Expect = 4e-61
Identities = 116/177 (65%), Positives = 143/177 (80%), Gaps = 1/177 (0%)
Frame = +1

Query: 154 MAANFWGSSQWK-LLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVRQR 330
MAANFW SS K LL+Q+++ V AD + GI+ E+ +++KIHMS +I LA QVKVRQR
Sbjct: 1 MAANFWTSSHCKQLLDQEDVDKVPQADSDRGITLEEFRLVKIHMSFHIWRLAQQVKVRQR 60

Query: 331 VVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEESTVQAKLLIFYMKKTRAFPQE 510
V+ATA+ YFRRVYTRKS EYDPRLVAPTCLYLASK EESTVQA+LL+FY+KK A E
Sbjct: 61 VIATAVTYFRRVYTRKSMTEYDPRLVAPTCLYLASKVEESTVQARLLVFYIKKMCA-SDE 119

Query: 511 KCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGITEMTKITWSLVNDLY 681
K +E+ DIL MEM+LLEALD+YL++YHPYR L+QLLQDAGIT++T+ W +VND Y
Sbjct: 120 KYRFEIKDILEMEMKLLEALDYYLVVYHPYRPLLQLLQDAGITDLTQFAWGIVNDTY 176


>sp|Q9FJK7|CCC12_ARATH Cyclin-C1-2 OS=Arabidopsis thaliana
GN=CYCC1-2 PE=2 SV=1
Length = 253

Score = 223 bits (568), Expect = 7e-58
Identities = 111/179 (62%), Positives = 137/179 (76%), Gaps = 3/179 (1%)
Frame = +1

Query: 154 MAANFWGSSQWK-LLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVRQR 330
MA+NFW S+ +K L + +E+ V P D + GIS ED ++IK+HMS YI LA +K+RQR
Sbjct: 1 MASNFWTSTHYKELKDPEEVNVVHPLDAQRGISVEDFRLIKLHMSNYISKLAQHIKIRQR 60

Query: 331 VVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEESTVQAKLLIFYMKKTRAFPQE 510
VVATA+ Y RRVYTRKS EY+PRLVAPTCLYLA KAEES V AKLL+FYMKK + E
Sbjct: 61 VVATAVTYMRRVYTRKSLTEYEPRLVAPTCLYLACKAEESVVHAKLLVFYMKK--LYADE 118

Query: 511 KCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGI--TEMTKITWSLVNDLY 681
K YE+ DIL MEM++LEAL+FYL+++HPYRSL + LQD+GI T MT +TW LVND Y
Sbjct: 119 KFRYEIKDILEMEMKVLEALNFYLVVFHPYRSLPEFLQDSGINDTSMTHLTWGLVNDTY 177


>sp|Q9FJK6|CCC11_ARATH Cyclin-C1-1 OS=Arabidopsis thaliana
GN=CYCC1-1 PE=2 SV=2
Length = 253

Score = 212 bits (540), Expect = 1e-54
Identities = 109/179 (60%), Positives = 136/179 (75%), Gaps = 3/179 (1%)
Frame = +1

Query: 154 MAANFWGSSQWK-LLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVRQR 330
MAANFW SS +K LL+ +E+ V D+E GIS +D K+IK HMS +I LA +KVRQR
Sbjct: 1 MAANFWNSSHYKQLLDPEEVDVVHDLDKERGISIDDFKLIKFHMSNHIMKLAQHIKVRQR 60

Query: 331 VVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEESTVQAKLLIFYMKKTRAFPQE 510
VVATAI Y RRVY RKS VE++PRLVA TCLYLASKAEES VQA+ L+FY+K R +P E
Sbjct: 61 VVATAITYMRRVYIRKSMVEFEPRLVALTCLYLASKAEESIVQARNLVFYIK--RLYPDE 118

Query: 511 KCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGITE--MTKITWSLVNDLY 681
YE+ DIL MEM++LEALD+YL+++HPYRSL + LQDA + + M +ITW +VND Y
Sbjct: 119 YNKYELKDILGMEMKVLEALDYYLVVFHPYRSLSEFLQDAALNDVNMNQITWGIVNDTY 177


>sp|Q86KE7|CCNC_DICDI Cyclin-C OS=Dictyostelium discoideum GN=cycC
PE=3 SV=1
Length = 255

Score = 138 bits (347), Expect = 3e-32
Identities = 81/180 (45%), Positives = 114/180 (63%), Gaps = 4/180 (2%)
Frame = +1

Query: 154 MAANFWGSS---QWKLLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVR 324
MAANFW SS +W LL++++I P D++ ++P + K ++ H IQ+L + +K+R
Sbjct: 1 MAANFWESSHCTEW-LLDRNKIEESNPKDKQY-LTPIELKKLRTHYCFVIQNLGNALKLR 58

Query: 325 QRVVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEESTVQAKLLIFYMKKTRAFP 504
QR ++TAI YF+R Y + SFV+ +PRLVA TCLYL+SK EE QAK MK+
Sbjct: 59 QRAISTAIVYFKRFYLKNSFVDCEPRLVAVTCLYLSSKVEECITQAKKCAAKMKEI---- 114

Query: 505 QEKCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGITEMT-KITWSLVNDLY 681
+Y + DIL E +LE LDF LIIYHPY+SL LQ +G+ + +I W +VND Y
Sbjct: 115 DHSFNYLMNDILECEFFVLEELDFCLIIYHPYKSLPFYLQSSGLDPASIEIIWGIVNDSY 174


>sp|Q28F72|CCNC_XENTR Cyclin-C OS=Xenopus tropicalis GN=ccnc PE=2
SV=1
Length = 283

Score = 120 bits (301), Expect = 7e-27
Identities = 75/187 (40%), Positives = 104/187 (55%), Gaps = 11/187 (5%)
Frame = +1

Query: 154 MAANFWGSS---QWKLLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVR 324
MA NFW SS QW L +QD + +S E+ ++I + IQ+L +K+R
Sbjct: 1 MAGNFWQSSHYLQWILDKQDLLKE--RQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLR 58

Query: 325 QRVVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEE-------STVQAKLLIFYM 483
Q+V+ATA YF+R Y R S DP L+APTC++LASK EE + A +
Sbjct: 59 QQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKT 118

Query: 484 KKTRAFPQEKCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGITEM-TKITW 660
+ + AFP+E Y + IL E LLE +D LI+YHPYR L+Q +QD G +M + W
Sbjct: 119 RFSYAFPKE-FPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAW 177

Query: 661 SLVNDLY 681
+VND Y
Sbjct: 178 RIVNDTY 184


>sp|Q4KLA0|CCNC_XENLA Cyclin-C OS=Xenopus laevis GN=ccnc PE=2 SV=1
Length = 283

Score = 120 bits (301), Expect = 7e-27
Identities = 75/187 (40%), Positives = 104/187 (55%), Gaps = 11/187 (5%)
Frame = +1

Query: 154 MAANFWGSS---QWKLLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVR 324
MA NFW SS QW L +QD + +S E+ ++I + IQ+L +K+R
Sbjct: 1 MAGNFWQSSHYLQWILDKQDLLKE--RQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLR 58

Query: 325 QRVVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEE-------STVQAKLLIFYM 483
Q+V+ATA YF+R Y R S DP L+APTC++LASK EE + A +
Sbjct: 59 QQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKT 118

Query: 484 KKTRAFPQEKCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGITEM-TKITW 660
+ + AFP+E Y + IL E LLE +D LI+YHPYR L+Q +QD G +M + W
Sbjct: 119 RFSYAFPKE-FPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAW 177

Query: 661 SLVNDLY 681
+VND Y
Sbjct: 178 RIVNDTY 184


>sp|P24863|CCNC_HUMAN Cyclin-C OS=Homo sapiens GN=CCNC PE=1 SV=2
Length = 283

Score = 120 bits (301), Expect = 7e-27
Identities = 78/187 (41%), Positives = 106/187 (56%), Gaps = 11/187 (5%)
Frame = +1

Query: 154 MAANFWGSS---QWKLLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVR 324
MA NFW SS QW L +QD + +S E+ ++I + IQ+L +K+R
Sbjct: 1 MAGNFWQSSHYLQWILDKQDLLKE--RQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLR 58

Query: 325 QRVVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEESTVQAKLLIF----YMKKT 492
Q+V+ATA YF+R Y R S DP L+APTC++LASK EE V + + + KT
Sbjct: 59 QQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKT 118

Query: 493 R---AFPQEKCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGITEM-TKITW 660
R AFP+E Y + IL E LLE +D LI+YHPYR L+Q +QD G +M + W
Sbjct: 119 RFSYAFPKE-FPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAW 177

Query: 661 SLVNDLY 681
+VND Y
Sbjct: 178 RIVNDTY 184


>sp|P55168|CCNC_CHICK Cyclin-C OS=Gallus gallus GN=CCNC PE=3 SV=1
Length = 283

Score = 120 bits (301), Expect = 7e-27
Identities = 75/187 (40%), Positives = 104/187 (55%), Gaps = 11/187 (5%)
Frame = +1

Query: 154 MAANFWGSS---QWKLLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVR 324
MA NFW SS QW L +QD + +S E+ ++I + IQ+L +K+R
Sbjct: 1 MAGNFWQSSHYLQWILDKQDLLKE--RQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLR 58

Query: 325 QRVVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEE-------STVQAKLLIFYM 483
Q+V+ATA YF+R Y R S DP L+APTC++LASK EE + A +
Sbjct: 59 QQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKT 118

Query: 484 KKTRAFPQEKCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGITEM-TKITW 660
+ + AFP+E Y + IL E LLE +D LI+YHPYR L+Q +QD G +M + W
Sbjct: 119 RFSYAFPKE-FPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAW 177

Query: 661 SLVNDLY 681
+VND Y
Sbjct: 178 RIVNDTY 184


>sp|Q3ZCK5|CCNC_BOVIN Cyclin-C OS=Bos taurus GN=CCNC PE=2 SV=1
Length = 283

Score = 120 bits (301), Expect = 7e-27
Identities = 77/187 (41%), Positives = 107/187 (57%), Gaps = 11/187 (5%)
Frame = +1

Query: 154 MAANFWGSS---QWKLLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVR 324
MA NFW SS QW L +QD + +S E+ ++I + IQ+L +K+R
Sbjct: 1 MAGNFWQSSHYLQWILDKQDLLKE--RQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLR 58

Query: 325 QRVVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEESTVQAKLLIF----YMKKT 492
Q+V+ATA YF+R Y R S DP L+APTC++LASK EE V + + + KT
Sbjct: 59 QQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKT 118

Query: 493 R---AFPQEKCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGITEM-TKITW 660
R AFP+E Y++ +L E LLE +D LI+YHPYR L+Q +QD G +M + W
Sbjct: 119 RFSYAFPKE-FPYKMNHVLECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAW 177

Query: 661 SLVNDLY 681
+VND Y
Sbjct: 178 RIVNDTY 184


>sp|P39947|CCNC_RAT Cyclin-C OS=Rattus norvegicus GN=Ccnc PE=2 SV=2
Length = 278

Score = 116 bits (290), Expect = 1e-25
Identities = 73/187 (39%), Positives = 104/187 (55%), Gaps = 11/187 (5%)
Frame = +1

Query: 154 MAANFWGSS---QWKLLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVR 324
MA NFW SS QW L ++ + F +S E+ ++I + IQ+L +K+R
Sbjct: 1 MAGNFWQSSHYLQWILDKERQKDLKF-------LSEEEYWKLQIFFTNVIQALGEHLKLR 53

Query: 325 QRVVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEE-------STVQAKLLIFYM 483
Q+V+ATA YF+R Y R S DP L+APTC++LASK EE S + A +
Sbjct: 54 QQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTSLIAATTSVLKT 113

Query: 484 KKTRAFPQEKCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGITE-MTKITW 660
+ + A P+E Y + IL E LLE +D LI+YHPYR L+Q +QD G + + + W
Sbjct: 114 RFSYASPKE-FPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDVLLPLAW 172

Query: 661 SLVNDLY 681
+VND Y
Sbjct: 173 RIVNDTY 179


tr_hit_id A9NZ75
Definition tr|A9NZ75|A9NZ75_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 177
Score (bit) 236.0
E-value 1.0e-60
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960028|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_E16, 5'
(681 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NZ75|A9NZ75_PICSI Putative uncharacterized protein OS=Picea... 236 1e-60
tr|B8BDA4|B8BDA4_ORYSI Putative uncharacterized protein OS=Oryza... 235 2e-60
tr|B7EKR4|B7EKR4_ORYSJ (RAP Annotation release2) Cyclin OS=Oryza... 234 5e-60
tr|B4F8I9|B4F8I9_MAIZE Putative uncharacterized protein OS=Zea m... 233 7e-60
tr|B6U610|B6U610_MAIZE Cyclin-C OS=Zea mays PE=2 SV=1 232 1e-59
tr|A9U1X5|A9U1X5_PHYPA Predicted protein OS=Physcomitrella paten... 227 6e-58
tr|A9PI29|A9PI29_POPTR Putative uncharacterized protein OS=Popul... 225 2e-57
tr|B7FHU4|B7FHU4_MEDTR Putative uncharacterized protein OS=Medic... 223 7e-57
tr|A3C0E1|A3C0E1_ORYSJ Putative uncharacterized protein OS=Oryza... 204 3e-51
tr|B7EKR5|B7EKR5_ORYSJ (RAP Annotation release2) Cyclin OS=Oryza... 195 3e-48
tr|B4FGQ5|B4FGQ5_MAIZE Putative uncharacterized protein OS=Zea m... 189 2e-46
tr|B7EKR6|B7EKR6_ORYSJ (RAP Annotation release2) Cyclin OS=Oryza... 146 1e-33
tr|A7R5P7|A7R5P7_VITVI Chromosome undetermined scaffold_1021, wh... 137 8e-31
tr|A8IE61|A8IE61_CHLRE C-type cyclin (Fragment) OS=Chlamydomonas... 131 5e-29
tr|Q6P6A2|Q6P6A2_MOUSE Ccnc protein (Fragment) OS=Mus musculus G... 124 7e-27
tr|Q5PPR1|Q5PPR1_MOUSE Ccnc protein (Fragment) OS=Mus musculus G... 124 7e-27
tr|Q497T2|Q497T2_MOUSE Ccnc protein (Fragment) OS=Mus musculus G... 124 7e-27
tr|Q05BN1|Q05BN1_MOUSE Ccnc protein (Fragment) OS=Mus musculus G... 124 7e-27
tr|Q3U6Q7|Q3U6Q7_MOUSE Putative uncharacterized protein OS=Mus m... 120 8e-26
tr|Q7Z4L3|Q7Z4L3_HUMAN Cyclin C OS=Homo sapiens GN=CCNC PE=2 SV=1 120 8e-26
tr|A8K799|A8K799_HUMAN cDNA FLJ77471, highly similar to Homo sap... 120 8e-26
tr|Q8CAS3|Q8CAS3_MOUSE Cyclin C OS=Mus musculus GN=Ccnc PE=2 SV=1 119 2e-25
tr|Q3UXL9|Q3UXL9_MOUSE Cyclin C OS=Mus musculus GN=Ccnc PE=2 SV=1 119 2e-25
tr|Q0P542|Q0P542_MOUSE Cyclin C OS=Mus musculus GN=Ccnc PE=2 SV=1 119 2e-25
tr|A7STP9|A7STP9_NEMVE Predicted protein OS=Nematostella vectens... 119 2e-25
tr|Q6STL0|Q6STL0_DANRE Cyclin C (Zgc:73078 protein) OS=Danio rer... 117 5e-25
tr|B0WG06|B0WG06_CULQU G1/S-specific cyclin-C OS=Culex quinquefa... 117 5e-25
tr|B7QBP1|B7QBP1_IXOSC Cdk activating kinase, putative (Fragment... 116 2e-24
tr|B4NJ56|B4NJ56_DROWI GK13831 OS=Drosophila willistoni GN=GK138... 115 2e-24
tr|B6RB94|B6RB94_HALDI Cyclin C (Fragment) OS=Haliotis discus di... 114 6e-24

>tr|A9NZ75|A9NZ75_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 248

Score = 236 bits (602), Expect = 1e-60
Identities = 120/177 (67%), Positives = 141/177 (79%), Gaps = 1/177 (0%)
Frame = +1

Query: 154 MAANFWGSSQWK-LLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVRQR 330
MAANFW SS K LL+ +++G V P D+E+G++ ED KIIKIHMS YI++L+ VKVRQR
Sbjct: 1 MAANFWTSSHCKELLDAEKVGIVHPLDKEHGLTQEDVKIIKIHMSNYIRTLSQSVKVRQR 60

Query: 331 VVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEESTVQAKLLIFYMKKTRAFPQE 510
VVATAI YFRRVYTRK F EYDP+LVAPTCLYLASKAEESTVQAKL+IFYMK+
Sbjct: 61 VVATAITYFRRVYTRKGFTEYDPQLVAPTCLYLASKAEESTVQAKLVIFYMKR-----YT 115

Query: 511 KCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGITEMTKITWSLVNDLY 681
K YE+ D+L MEM+LLEALD+YL+IYHPY LIQLLQDA + E+ WSLVND Y
Sbjct: 116 KHRYEIKDMLEMEMKLLEALDYYLVIYHPYHPLIQLLQDANLAELKVTAWSLVNDTY 172


>tr|B8BDA4|B8BDA4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_31940 PE=4 SV=1
Length = 257

Score = 235 bits (599), Expect = 2e-60
Identities = 116/177 (65%), Positives = 143/177 (80%), Gaps = 1/177 (0%)
Frame = +1

Query: 154 MAANFWGSSQWK-LLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVRQR 330
MAANFW SS K LL+Q+++ V AD + GI+PE+ +++KIHMS +I LA QVKVRQR
Sbjct: 1 MAANFWTSSHCKQLLDQEDVDKVPQADSDRGITPEEFRLVKIHMSFHIWRLAQQVKVRQR 60

Query: 331 VVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEESTVQAKLLIFYMKKTRAFPQE 510
V+ATA+ YFRRVYTRKS EYDPRLVAPTCLYLASK EESTVQA+LL+FY+KK A E
Sbjct: 61 VIATAVTYFRRVYTRKSMTEYDPRLVAPTCLYLASKVEESTVQARLLVFYIKKMCA-SDE 119

Query: 511 KCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGITEMTKITWSLVNDLY 681
K +E+ DIL M M+LLEALD+YL++YHPYR L+QLLQDAGIT++T+ W +VND Y
Sbjct: 120 KYRFEIKDILEMGMKLLEALDYYLVVYHPYRPLLQLLQDAGITDLTQFAWGIVNDTY 176


>tr|B7EKR4|B7EKR4_ORYSJ (RAP Annotation release2) Cyclin OS=Oryza
sativa subsp. japonica PE=2 SV=1
Length = 257

Score = 234 bits (596), Expect = 5e-60
Identities = 116/177 (65%), Positives = 143/177 (80%), Gaps = 1/177 (0%)
Frame = +1

Query: 154 MAANFWGSSQWK-LLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVRQR 330
MAANFW SS K LL+Q+++ V AD + GI+ E+ +++KIHMS +I LA QVKVRQR
Sbjct: 1 MAANFWTSSHCKQLLDQEDVDKVPQADSDRGITLEEFRLVKIHMSFHIWRLAQQVKVRQR 60

Query: 331 VVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEESTVQAKLLIFYMKKTRAFPQE 510
V+ATA+ YFRRVYTRKS EYDPRLVAPTCLYLASK EESTVQA+LL+FY+KK A E
Sbjct: 61 VIATAVTYFRRVYTRKSMTEYDPRLVAPTCLYLASKVEESTVQARLLVFYIKKMCA-SDE 119

Query: 511 KCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGITEMTKITWSLVNDLY 681
K +E+ DIL MEM+LLEALD+YL++YHPYR L+QLLQDAGIT++T+ W +VND Y
Sbjct: 120 KYRFEIKDILEMEMKLLEALDYYLVVYHPYRPLLQLLQDAGITDLTQFAWGIVNDTY 176


>tr|B4F8I9|B4F8I9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 257

Score = 233 bits (595), Expect = 7e-60
Identities = 118/177 (66%), Positives = 144/177 (81%), Gaps = 1/177 (0%)
Frame = +1

Query: 154 MAANFWGSSQWK-LLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVRQR 330
MAANFW SS K LL+ +++ V AD+E GI+PE+ ++IKIHMS +I LA QVKVRQR
Sbjct: 1 MAANFWTSSHCKQLLDPEDVDLVPAADRERGITPEEFRLIKIHMSFHIWRLAQQVKVRQR 60

Query: 331 VVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEESTVQAKLLIFYMKKTRAFPQE 510
VVATAIAYFRRVYTRKS +YDPRLVAPTCLYLASK EESTVQA+LL+FY+KK +
Sbjct: 61 VVATAIAYFRRVYTRKSMSDYDPRLVAPTCLYLASKVEESTVQARLLVFYIKK-MCGSDD 119

Query: 511 KCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGITEMTKITWSLVNDLY 681
K +E+ DIL MEM+LLEALD+YL+++HPYR L+QLLQDAGIT++T+ W LVND Y
Sbjct: 120 KYRFEIKDILEMEMKLLEALDYYLVVFHPYRPLLQLLQDAGITDLTQFAWGLVNDTY 176


>tr|B6U610|B6U610_MAIZE Cyclin-C OS=Zea mays PE=2 SV=1
Length = 257

Score = 232 bits (592), Expect = 1e-59
Identities = 117/177 (66%), Positives = 144/177 (81%), Gaps = 1/177 (0%)
Frame = +1

Query: 154 MAANFWGSSQWK-LLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVRQR 330
MAANFW SS K LL+ +++ V AD+E GI+PE+ ++IKIHMS +I LA QVKVRQR
Sbjct: 1 MAANFWTSSHCKQLLDPEDVDLVPAADRERGITPEEFRLIKIHMSFHIWRLAQQVKVRQR 60

Query: 331 VVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEESTVQAKLLIFYMKKTRAFPQE 510
VVATAI+YFRRVYTRKS +YDPRLVAPTCLYLASK EESTVQA+LL+FY+KK +
Sbjct: 61 VVATAISYFRRVYTRKSMSDYDPRLVAPTCLYLASKVEESTVQARLLVFYIKK-MCGSDD 119

Query: 511 KCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGITEMTKITWSLVNDLY 681
K +E+ DIL MEM+LLEALD+YL+++HPYR L+QLLQDAGIT++T+ W LVND Y
Sbjct: 120 KYRFEIKDILEMEMKLLEALDYYLVVFHPYRPLLQLLQDAGITDLTQFAWGLVNDTY 176


>tr|A9U1X5|A9U1X5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_154505 PE=3 SV=1
Length = 263

Score = 227 bits (578), Expect = 6e-58
Identities = 123/189 (65%), Positives = 143/189 (75%), Gaps = 13/189 (6%)
Frame = +1

Query: 154 MAANFWGSSQWK-LLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVRQR 330
MA+NFW SS K LL+Q+E+ HV D E G++PED K++KI S YI+ L + KVRQR
Sbjct: 1 MASNFWTSSHCKKLLDQEEVSHVAQTDAERGLTPEDVKLMKIQFSAYIKLLGYHAKVRQR 60

Query: 331 VVATAIAYFRRVYTR----------KSFVEYDPRLVAPTCLYLASKAEESTVQAKLLIFY 480
VVATAIAYFRR+YTR KSF E+DPRLVAPTCLYLASKAEESTVQAKLL+F
Sbjct: 61 VVATAIAYFRRIYTRHALHLLHICIKSFSEFDPRLVAPTCLYLASKAEESTVQAKLLVFC 120

Query: 481 MKKTRA-FPQEKCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGI-TEMTKI 654
KK RA F + Y+V DIL MEMRLLEALD+YL+IYHPYR LIQLLQD + T+MT+
Sbjct: 121 TKKIRATFASHR--YDVKDILEMEMRLLEALDYYLVIYHPYRPLIQLLQDGNMPTDMTQF 178

Query: 655 TWSLVNDLY 681
TWSLVND Y
Sbjct: 179 TWSLVNDSY 187


>tr|A9PI29|A9PI29_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 251

Score = 225 bits (573), Expect = 2e-57
Identities = 116/179 (64%), Positives = 141/179 (78%), Gaps = 3/179 (1%)
Frame = +1

Query: 154 MAANFWGSSQWK-LLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVRQR 330
MAANFW SS +K L +Q+E+ V P D+E GI+ ED KIIK M+ YI LA QVKVRQR
Sbjct: 1 MAANFWTSSHYKQLFDQEEVDVVHPLDKEKGITLEDFKIIKTQMAIYIGILAQQVKVRQR 60

Query: 331 VVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEESTVQAKLLIFYMKKTRAFPQE 510
VVATA+AY RRVYTRKS EYDPRL APTCLYLASKAEEST+QA++L FY+KK + +
Sbjct: 61 VVATAVAYMRRVYTRKSMSEYDPRLAAPTCLYLASKAEESTIQARVLSFYIKK--LYSDD 118

Query: 511 KCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGITE--MTKITWSLVNDLY 681
K YE+ +IL MEM++LEAL+FYL+++HPYRSL Q LQDAGI + MT++TW LVND Y
Sbjct: 119 KYRYEIKEILEMEMKILEALNFYLVVFHPYRSLPQFLQDAGINDINMTQLTWGLVNDTY 177


>tr|B7FHU4|B7FHU4_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 249

Score = 223 bits (569), Expect = 7e-57
Identities = 113/179 (63%), Positives = 138/179 (77%), Gaps = 3/179 (1%)
Frame = +1

Query: 154 MAANFWGSSQWK-LLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQSLAHQVKVRQR 330
MAANFW SS + LL Q+++ V P D+E G++ ED K IK+HMS YI LA QVKVRQR
Sbjct: 1 MAANFWTSSHYTHLLVQEDVDKVNPVDKEKGVTLEDFKFIKMHMSNYILKLAQQVKVRQR 60

Query: 331 VVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEESTVQAKLLIFYMKKTRAFPQE 510
VVATA+ Y RRVYTR S EYDPRLVAP CLYLASKAEESTVQA+LL+FY+KK + +
Sbjct: 61 VVATAVTYMRRVYTRMSMTEYDPRLVAPACLYLASKAEESTVQARLLVFYIKK--LYADD 118

Query: 511 KCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGITE--MTKITWSLVNDLY 681
K YE+ DIL MEM++LEAL +YL+++HPYRSL LQDAG+ + MT++TW LVND Y
Sbjct: 119 KYRYEIKDILEMEMKILEALKYYLVVFHPYRSLSGFLQDAGLNDLSMTQLTWGLVNDTY 177


>tr|A3C0E1|A3C0E1_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_028763 PE=3 SV=1
Length = 313

Score = 204 bits (520), Expect = 3e-51
Identities = 112/196 (57%), Positives = 139/196 (70%), Gaps = 21/196 (10%)
Frame = +1

Query: 154 MAANFWGSSQWK----LLEQDEIGHVFPADQENGISPEDAKIIKIHMSEYIQ-------- 297
MAANFW SS + LL+Q+++ V AD + GI+ E+ +++KIHMS +Q
Sbjct: 1 MAANFWTSSHCEGSKQLLDQEDVDKVPQADSDRGITLEEFRLVKIHMSFLLQIKANHLMI 60

Query: 298 ----SLAHQVKVRQRVVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEESTVQAK 465
LA QVKVRQRV+ATA+ YFRRVYTRKS EYDPRLVAPTCLYLASK EESTVQA+
Sbjct: 61 SDIWRLAQQVKVRQRVIATAVTYFRRVYTRKSMTEYDPRLVAPTCLYLASKVEESTVQAR 120

Query: 466 LLIFYMKKTRAFPQEKCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQ-----LLQDA 630
LL+FY+KK A EK +E+ DIL MEM+LLEALD+YL++YHPYR L+Q LLQDA
Sbjct: 121 LLVFYIKKMCA-SDEKYRFEIKDILEMEMKLLEALDYYLVVYHPYRPLLQCFDFRLLQDA 179

Query: 631 GITEMTKITWSLVNDL 678
GIT++T+ DL
Sbjct: 180 GITDLTQFACCTCADL 195


>tr|B7EKR5|B7EKR5_ORYSJ (RAP Annotation release2) Cyclin OS=Oryza
sativa subsp. japonica PE=2 SV=1
Length = 214

Score = 195 bits (495), Expect = 3e-48
Identities = 95/134 (70%), Positives = 112/134 (83%)
Frame = +1

Query: 280 MSEYIQSLAHQVKVRQRVVATAIAYFRRVYTRKSFVEYDPRLVAPTCLYLASKAEESTVQ 459
MS +I LA QVKVRQRV+ATA+ YFRRVYTRKS EYDPRLVAPTCLYLASK EESTVQ
Sbjct: 1 MSFHIWRLAQQVKVRQRVIATAVTYFRRVYTRKSMTEYDPRLVAPTCLYLASKVEESTVQ 60

Query: 460 AKLLIFYMKKTRAFPQEKCSYEVPDILHMEMRLLEALDFYLIIYHPYRSLIQLLQDAGIT 639
A+LL+FY+KK A EK +E+ DIL MEM+LLEALD+YL++YHPYR L+QLLQDAGIT
Sbjct: 61 ARLLVFYIKKMCA-SDEKYRFEIKDILEMEMKLLEALDYYLVVYHPYRPLLQLLQDAGIT 119

Query: 640 EMTKITWSLVNDLY 681
++T+ W +VND Y
Sbjct: 120 DLTQFAWGIVNDTY 133