DK960048
Clone id TST39A01NGRL0006_F14
Library
Length 706
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_F14. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
GCATAATTGGCTCTTTAGCCCCAGTGACGGGCACGCGGTGTTCATGTTTCAAACAAGTAC
GGCAGCAGACAAGTCATGGTCAAGCCTGGCGACTAGTTCTCTCCTTCAGTGGCAGCATGC
ATCGAGCTCATCTTCTTCTTTGAAAAGTACGGAGAGCTCGGGGTTCTCCCTGCTGCTTTA
TGCATGGAAGAGTGATTAGAGTTCTGCATTTTTGCTACCCTAAAGAGTTGCCAATGGTAG
CAGAAACATGTCCAAGGCTGCAGTCCCATTGGCAGACAGTTTTTAAGCCTCTCAAAATCA
ATTTTCTACATGGCGTGCTGAAGCGAAGGCAGCAGCTTCATAGGCTAGTATGCCACATAG
AAGAGTTTTCCTCACATGCAGATCGTGCAAGACATGTAAGGCTTCAGAAAGGTTTTTTCA
GATATTTGTGTGCAGGCTTGACAACACTGCTTTCTCCCCTGTTCAAAGAGAGATTATCAC
TAGTGCAACTGTACCATGTGCAAAATGTACACAGCTTCAAGGATGGGAGACTTTTGAGGG
GCACCCTCGTCTGCGAAGGTTGTATATTTGTGAAATGTTTTGAGCTTTTAAAGGGAAATG
CATGTTATGCACGAAAGTGAACAACGGGAGCATACCATAAGCTGTCCTTTGCAACCAATA
TTATTCATGTATAATGGGTTTTGTTTGAAAAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id Q705D2
Definition sp|Q705D2|VE6_HPV94 Protein E6 OS=Human papillomavirus type 94
Align length 62
Score (bit) 31.6
E-value 4.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960048|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_F14, 5'
(687 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q705D2|VE6_HPV94 Protein E6 OS=Human papillomavirus type 94 G... 32 4.1
sp|P59109|TRMFO_THEEB Methylenetetrahydrofolate--tRNA-(uracil-5-... 31 7.1
sp|Q9D2Z8|KIF12_MOUSE Kinesin-like protein KIF12 OS=Mus musculus... 31 7.1

>sp|Q705D2|VE6_HPV94 Protein E6 OS=Human papillomavirus type 94
GN=E6 PE=3 SV=1
Length = 148

Score = 31.6 bits (70), Expect = 4.1
Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 7/62 (11%)
Frame = +2

Query: 359 RRVFLTCRSCKTCKASERFFQIFVCR----LDNTAFSPVQREIITSATVP---CAKCTQL 517
R +FL CR+C R +F + + TAF+ + ++ A VP CA+C L
Sbjct: 9 RNIFLLCRNCGISFEDLRLCCVFCTKQLTVAELTAFALRELNLVWKAGVPYGACARCLLL 68

Query: 518 QG 523
QG
Sbjct: 69 QG 70


>sp|P59109|TRMFO_THEEB
Methylenetetrahydrofolate--tRNA-(uracil-5-)-
methyltransferase trmFO OS=Thermosynechococcus elongatus
(strain BP-1) GN=trmFO PE=3 SV=1
Length = 457

Score = 30.8 bits (68), Expect = 7.1
Identities = 14/31 (45%), Positives = 17/31 (54%)
Frame = +3

Query: 6 IGSLAPVTGTRCSCFKQVRQQTSHGQAWRLV 98
+G P TG R Q+RQ+ HGQ W LV
Sbjct: 249 VGLRDPRTGERPYAVAQLRQEDRHGQLWNLV 279


>sp|Q9D2Z8|KIF12_MOUSE Kinesin-like protein KIF12 OS=Mus musculus
GN=Kif12 PE=2 SV=1
Length = 642

Score = 30.8 bits (68), Expect = 7.1
Identities = 14/41 (34%), Positives = 19/41 (46%)
Frame = +3

Query: 168 PCCFMHGRVIRVLHFCYPKELPMVAETCPRLQSHWQTVFKP 290
P C+ H HFC +P+ TCPR + H V +P
Sbjct: 494 PLCYCH-------HFCPLCRVPLAHWTCPRRECHMPQVLEP 527


tr_hit_id A7NWM2
Definition tr|A7NWM2|A7NWM2_VITVI Chromosome chr5 scaffold_2, whole genome shotgun sequence OS=Vitis vinifera
Align length 65
Score (bit) 50.4
E-value 0.0001
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960048|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_F14, 5'
(687 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7NWM2|A7NWM2_VITVI Chromosome chr5 scaffold_2, whole genome ... 50 1e-04
tr|A5BR08|A5BR08_VITVI Putative uncharacterized protein OS=Vitis... 50 1e-04
tr|A9T0W1|A9T0W1_PHYPA Predicted protein OS=Physcomitrella paten... 47 0.001
tr|A9SWI2|A9SWI2_PHYPA Predicted protein OS=Physcomitrella paten... 45 0.004
tr|B8LNS3|B8LNS3_PICSI Putative uncharacterized protein OS=Picea... 41 0.082
tr|A5C2V3|A5C2V3_VITVI Putative uncharacterized protein OS=Vitis... 41 0.082
tr|A7PUB4|A7PUB4_VITVI Chromosome chr7 scaffold_31, whole genome... 39 0.31
tr|A5BK25|A5BK25_VITVI Putative uncharacterized protein OS=Vitis... 39 0.31
tr|A7PPI8|A7PPI8_VITVI Chromosome chr8 scaffold_23, whole genome... 35 4.5
tr|A5AD42|A5AD42_VITVI Putative uncharacterized protein OS=Vitis... 35 4.5
tr|A2XN53|A2XN53_ORYSI Putative uncharacterized protein OS=Oryza... 35 4.5
tr|A7PQI4|A7PQI4_VITVI Chromosome chr6 scaffold_25, whole genome... 35 5.9
tr|A5C6X2|A5C6X2_VITVI Putative uncharacterized protein OS=Vitis... 35 5.9
tr|Q84M57|Q84M57_ORYSJ Os03g0806700 protein OS=Oryza sativa subs... 34 7.7
tr|A3ANU6|A3ANU6_ORYSJ Putative uncharacterized protein OS=Oryza... 34 7.7

>tr|A7NWM2|A7NWM2_VITVI Chromosome chr5 scaffold_2, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00019979001
PE=4 SV=1
Length = 300

Score = 50.4 bits (119), Expect = 1e-04
Identities = 25/65 (38%), Positives = 32/65 (49%)
Frame = +2

Query: 2 HNWLFSPSDGHAVFMFQTSTAADKSWSSLATXXXXXXXXXXXXXXXXXXXXXXXXXXLLY 181
HNWLF PS G+AVFMFQT ++A+K WSS +LY
Sbjct: 236 HNWLFGPSVGNAVFMFQTCSSAEKLWSSQPFFDSSALLSPCSQNFREFKLQGLGFSLILY 295

Query: 182 AWKSD 196
AWK++
Sbjct: 296 AWKNE 300


>tr|A5BR08|A5BR08_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_040533 PE=4 SV=1
Length = 300

Score = 50.4 bits (119), Expect = 1e-04
Identities = 25/65 (38%), Positives = 32/65 (49%)
Frame = +2

Query: 2 HNWLFSPSDGHAVFMFQTSTAADKSWSSLATXXXXXXXXXXXXXXXXXXXXXXXXXXLLY 181
HNWLF PS G+AVFMFQT ++A+K WSS +LY
Sbjct: 236 HNWLFGPSVGNAVFMFQTCSSAEKLWSSQPFFDSSALLSPCSQNFREFKLQGLGFSLILY 295

Query: 182 AWKSD 196
AWK++
Sbjct: 296 AWKNE 300


>tr|A9T0W1|A9T0W1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_190535 PE=4 SV=1
Length = 284

Score = 46.6 bits (109), Expect = 0.001
Identities = 18/26 (69%), Positives = 21/26 (80%)
Frame = +2

Query: 2 HNWLFSPSDGHAVFMFQTSTAADKSW 79
HNWLF+P GHAVFMFQT ++DK W
Sbjct: 233 HNWLFNPRVGHAVFMFQTCLSSDKPW 258


>tr|A9SWI2|A9SWI2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_189100 PE=4 SV=1
Length = 298

Score = 45.1 bits (105), Expect = 0.004
Identities = 17/26 (65%), Positives = 21/26 (80%)
Frame = +2

Query: 2 HNWLFSPSDGHAVFMFQTSTAADKSW 79
H+WLF+P GHAVFMFQT ++DK W
Sbjct: 233 HSWLFNPRAGHAVFMFQTCLSSDKPW 258


>tr|B8LNS3|B8LNS3_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 270

Score = 40.8 bits (94), Expect = 0.082
Identities = 23/65 (35%), Positives = 31/65 (47%)
Frame = +2

Query: 2 HNWLFSPSDGHAVFMFQTSTAADKSWSSLATXXXXXXXXXXXXXXXXXXXXXXXXXXLLY 181
H+WLF+PS GHAVFMF+T T+ + SL+ L+Y
Sbjct: 209 HDWLFNPSLGHAVFMFKTITSGEVQEPSLS---KPVSHSFKHKELAQSQGNGYGFSLLMY 265

Query: 182 AWKSD 196
AWK+D
Sbjct: 266 AWKND 270


>tr|A5C2V3|A5C2V3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_041021 PE=4 SV=1
Length = 305

Score = 40.8 bits (94), Expect = 0.082
Identities = 16/28 (57%), Positives = 23/28 (82%)
Frame = +2

Query: 2 HNWLFSPSDGHAVFMFQTSTAADKSWSS 85
HNWLFS + G+AVF+F+T +A+K W+S
Sbjct: 235 HNWLFSTTLGNAVFLFKTCLSAEKLWAS 262


>tr|A7PUB4|A7PUB4_VITVI Chromosome chr7 scaffold_31, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023730001
PE=4 SV=1
Length = 300

Score = 38.9 bits (89), Expect = 0.31
Identities = 15/27 (55%), Positives = 21/27 (77%)
Frame = +2

Query: 2 HNWLFSPSDGHAVFMFQTSTAADKSWS 82
HNWLF + G+AVFMFQ+ +A+K W+
Sbjct: 235 HNWLFGNAIGNAVFMFQSCLSAEKLWA 261


>tr|A5BK25|A5BK25_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_024138 PE=4 SV=1
Length = 416

Score = 38.9 bits (89), Expect = 0.31
Identities = 15/27 (55%), Positives = 21/27 (77%)
Frame = +2

Query: 2 HNWLFSPSDGHAVFMFQTSTAADKSWS 82
HNWLF + G+AVFMFQ+ +A+K W+
Sbjct: 235 HNWLFGNAIGNAVFMFQSCLSAEKLWA 261


>tr|A7PPI8|A7PPI8_VITVI Chromosome chr8 scaffold_23, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021666001
PE=4 SV=1
Length = 301

Score = 35.0 bits (79), Expect = 4.5
Identities = 13/23 (56%), Positives = 17/23 (73%)
Frame = +2

Query: 2 HNWLFSPSDGHAVFMFQTSTAAD 70
H+W F+PS G AVFMF+T + D
Sbjct: 248 HDWFFNPSSGSAVFMFRTRSGLD 270


>tr|A5AD42|A5AD42_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_018204 PE=4 SV=1
Length = 753

Score = 35.0 bits (79), Expect = 4.5
Identities = 13/23 (56%), Positives = 17/23 (73%)
Frame = +2

Query: 2 HNWLFSPSDGHAVFMFQTSTAAD 70
H+W F+PS G AVFMF+T + D
Sbjct: 593 HDWFFNPSSGSAVFMFRTRSGLD 615