DK960070
Clone id TST39A01NGRL0006_G13
Library
Length 564
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_G13. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
GATGAAGCCTGCGTTTGGCGGGGATATGGATGATGGTGCAGCGGGCGCGACGGCCATGGA
CGTGGATGGGGACAACGACCCTAACGATATTTTCTGCGAATCTGCGGGCGACGCTCGGCC
CCCTCTGGACGCCGATTTTTTCAATGCATTTGAAGATGACTTCGACGACTCCGACATTGC
TTAAGCTCTCTCTTCCATTACACAACCCTTTCTGAAAGATGTAAGAAGAGTTTCGTAATC
ACTTATGGAGCGATCTCATACCTTACAAGAGCCAATTGATGTGTGAAGTGCGCCCTCTCT
CTCTTCAAGTATGCTGTTGAAGCATACTTGAAATGTTTAATTTGCTGGAATAGCAAGTAA
TGTTTCGGTTGACTTACTTTGCAGTACACAACCCTTTCTGAAAGATGTAAGAAGAGTTTC
GTAATCACTTATGGAGCGATCTCATACCTTACAAGAGCCAATTGATGTGTGAAGTGCGCC
CTCTCTCTCAGTAGGTGACTTGTAGTTTATTCTTACTGTATGGTAATGAAGGTCATTTAT
TGAATGGTGGCCTCTTTTCTTTCC
■■Homology search results ■■ -
sp_hit_id Q3HTN2
Definition sp|Q3HTN2|VMSB_TRIST Zinc metalloproteinase-disintegrin stejnihagin-B OS=Trimeresurus stejnegeri
Align length 47
Score (bit) 31.2
E-value 3.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960070|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_G13, 5'
(564 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q3HTN2|VMSB_TRIST Zinc metalloproteinase-disintegrin stejniha... 31 3.7
sp|O35071|KIF1C_MOUSE Kinesin-like protein KIF1C OS=Mus musculus... 30 6.3
sp|Q8CP38|EX7L_STAES Exodeoxyribonuclease 7 large subunit OS=Sta... 30 8.2
sp|Q5HP29|EX7L_STAEQ Exodeoxyribonuclease 7 large subunit OS=Sta... 30 8.2

>sp|Q3HTN2|VMSB_TRIST Zinc metalloproteinase-disintegrin
stejnihagin-B OS=Trimeresurus stejnegeri PE=2 SV=1
Length = 600

Score = 31.2 bits (69), Expect = 3.7
Identities = 16/47 (34%), Positives = 25/47 (53%)
Frame = -1

Query: 435 SISDYETLLTSFRKGCVLQSKSTETLLAIPAN*TFQVCFNSILEERE 295
S+ Y+T LT++ C+L + S ++ P VC N +LEE E
Sbjct: 369 SMGYYQTFLTAYNPQCILNALSKRDIITPP------VCGNELLEEGE 409


>sp|O35071|KIF1C_MOUSE Kinesin-like protein KIF1C OS=Mus musculus
GN=Kif1c PE=1 SV=2
Length = 1100

Score = 30.4 bits (67), Expect = 6.3
Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 7/52 (13%)
Frame = -2

Query: 137 NRRPEGAERRPQIRR-------KYR*GRCPHPRPWPSRPLHHHPYPRQTQAS 3
NRRP R + RR + R G P P RP H+ YP+Q Q S
Sbjct: 1015 NRRPPSPRRPHRSRRNSLDGGSRSRGGGSTQPEPQHLRPQKHNGYPQQPQPS 1066


>sp|Q8CP38|EX7L_STAES Exodeoxyribonuclease 7 large subunit
OS=Staphylococcus epidermidis (strain ATCC 12228)
GN=xseA PE=3 SV=1
Length = 445

Score = 30.0 bits (66), Expect = 8.2
Identities = 13/35 (37%), Positives = 20/35 (57%)
Frame = -2

Query: 377 VSQPKHYLLFQQIKHFKYASTAYLKRERAHFTHQL 273
++ P Y L QQIK ++Y + Y+K+ H QL
Sbjct: 258 IATPDQYELLQQIKQYEYTLSRYIKQYIEHQKKQL 292


>sp|Q5HP29|EX7L_STAEQ Exodeoxyribonuclease 7 large subunit
OS=Staphylococcus epidermidis (strain ATCC 35984 /
RP62A) GN=xseA PE=3 SV=1
Length = 445

Score = 30.0 bits (66), Expect = 8.2
Identities = 13/35 (37%), Positives = 20/35 (57%)
Frame = -2

Query: 377 VSQPKHYLLFQQIKHFKYASTAYLKRERAHFTHQL 273
++ P Y L QQIK ++Y + Y+K+ H QL
Sbjct: 258 IATPDQYELLQQIKQYEYTLSRYIKQYIEHQKKQL 292


tr_hit_id B0EU80
Definition tr|B0EU80|B0EU80_ENTDI Putative uncharacterized protein OS=Entamoeba dispar SAW760
Align length 77
Score (bit) 35.4
E-value 2.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960070|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_G13, 5'
(564 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B0EU80|B0EU80_ENTDI Putative uncharacterized protein OS=Entam... 35 2.2
tr|B7CIF2|B7CIF2_BURPS Putative uncharacterized protein OS=Burkh... 33 8.2

>tr|B0EU80|B0EU80_ENTDI Putative uncharacterized protein
OS=Entamoeba dispar SAW760 GN=EDI_266800 PE=4 SV=1
Length = 461

Score = 35.4 bits (80), Expect = 2.2
Identities = 25/77 (32%), Positives = 34/77 (44%), Gaps = 4/77 (5%)
Frame = +1

Query: 139 FQCIXXXXXXXXHCLSSLFHYTTLS----ERCKKSFVITYGAISYLTRAN*CVKCALSLF 306
F+C+ C+ SL H T S RC + + YG L + N C KCA+
Sbjct: 125 FECLDGYGFNGDDCVQSLDHCKTYSYGSSTRCSECYD-GYG----LNKKNQCEKCAIDGC 179

Query: 307 KYAVEAYLKCLICWNSK 357
Y KC IC+N+K
Sbjct: 180 YSCSLDYTKCDICYNTK 196


>tr|B7CIF2|B7CIF2_BURPS Putative uncharacterized protein
OS=Burkholderia pseudomallei 576 GN=BUC_1156 PE=4 SV=1
Length = 622

Score = 33.5 bits (75), Expect = 8.2
Identities = 23/66 (34%), Positives = 29/66 (43%)
Frame = -2

Query: 227 FLHLSERVV*WKRELKQCRSRRSHLQMH*KNRRPEGAERRPQIRRKYR*GRCPHPRPWPS 48
+ H R ++R +CR R H K RRP+ RR RRK+R R H RP
Sbjct: 240 YRHRKHRHRKYRRLKHRCRKHRHRKHRHRKRRRPK-CRRRKHRRRKHR--RRKHRRPKYR 296

Query: 47 RPLHHH 30
H H
Sbjct: 297 HRKHRH 302