DK960105
Clone id TST39A01NGRL0006_I03
Library
Length 656
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_I03. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
GCTGAACATGGGTTAAGTGACCTGGCGCTGGAGTGTTATGAGCAGATGAAAGAAGAAGGA
ATCTCCCCAGATGCTGTGACATTTGCTTGCAGTCTAAAAGCTTGTGGAAATGCAGGAGCA
GTGGATGAGGGCCAAGAAATACATAATGAAATTATGCAAAGAGGCTTGGGGAAAGATCAT
TTTGTTGGAAACTCTTTGATTTATATGTACACTAAGTGCGGCCTGCTTTTAAAGGCGCAA
GAAGCATTTTACAACATTCAAACTAAAGATGTTGCATCTTGGACAGCATTAATGACAGGA
TTTGTGGAGCACAGTCGTTTTCGTGAGGCATTAGAGCTTTTTGACAAGATGCATAATGAG
GGTGTTTCTTTAGATGCTGTCAGCTTTGTTTGCAGCTTGAAAGCCTCTGGAGGACTGAGG
GCTGCAAAGAAGGGCGAGCAAATATATAGTGAGCTTGTTATGAAGGGATTTGAAGGAGAC
TATTCTGTTGGCAGTTGCCTAGTTGAAATGTACGGAAAGTGCGGCTTGCTTGCGGACTCA
CAGCAAGTTTTTGACACGCTTCCAGATCAGACGGTGGTAGCATGGAATGCACTTATGGGA
GGGTACGTGGAACATGGGTATGGTGAGGTTGCCCTTGACTGTTTTCAAAGGATGCA
■■Homology search results ■■ -
sp_hit_id Q9SN39
Definition sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein At4g18750, chloroplastic OS=Arabidopsis thaliana
Align length 219
Score (bit) 155.0
E-value 1.0e-37
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960105|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_I03, 5'
(656 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protei... 155 1e-37
sp|Q9SB36|PP337_ARATH Pentatricopeptide repeat-containing protei... 145 2e-34
sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protei... 143 9e-34
sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protei... 142 2e-33
sp|Q9CAA8|PP108_ARATH Putative pentatricopeptide repeat-containi... 140 4e-33
sp|Q9LIC3|PP227_ARATH Putative pentatricopeptide repeat-containi... 139 1e-32
sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protei... 139 1e-32
sp|Q9C507|PP111_ARATH Putative pentatricopeptide repeat-containi... 138 2e-32
sp|Q9LR69|PPR8_ARATH Pentatricopeptide repeat-containing protein... 138 3e-32
sp|P0C898|PP232_ARATH Putative pentatricopeptide repeat-containi... 137 5e-32
sp|O64705|PP184_ARATH Pentatricopeptide repeat-containing protei... 135 1e-31
sp|P93011|PP182_ARATH Pentatricopeptide repeat-containing protei... 135 2e-31
sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protei... 134 4e-31
sp|Q9LFL5|PP390_ARATH Putative pentatricopeptide repeat-containi... 134 5e-31
sp|Q9FM64|PP431_ARATH Pentatricopeptide repeat-containing protei... 132 2e-30
sp|Q9FWA6|PP207_ARATH Pentatricopeptide repeat-containing protei... 132 2e-30
sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protei... 131 4e-30
sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protei... 131 4e-30
sp|Q9S7F4|PP206_ARATH Putative pentatricopeptide repeat-containi... 130 5e-30
sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protei... 130 6e-30
sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containi... 130 6e-30
sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protei... 130 8e-30
sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protei... 129 1e-29
sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protei... 129 1e-29
sp|Q9FK33|PP427_ARATH Pentatricopeptide repeat-containing protei... 129 1e-29
sp|O04659|PP398_ARATH Pentatricopeptide repeat-containing protei... 129 1e-29
sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protei... 129 2e-29
sp|Q9LJR6|PP253_ARATH Putative pentatricopeptide repeat-containi... 128 2e-29
sp|Q9SZK1|PP355_ARATH Pentatricopeptide repeat-containing protei... 128 3e-29
sp|Q9LND4|PPR14_ARATH Pentatricopeptide repeat-containing protei... 127 5e-29

>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein
At4g18750, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H45 PE=2 SV=1
Length = 871

Score = 155 bits (393), Expect = 1e-37
Identities = 79/219 (36%), Positives = 124/219 (56%), Gaps = 1/219 (0%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A GL+ A++ +E+M+EEGISPD T L C +DEG+ +H I + LG D
Sbjct: 373 AREGLAGEAVKLFEEMEEEGISPDVYTVTAVLNCCARYRLLDEGKRVHEWIKENDLGFDI 432

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
FV N+L+ MY KCG + +A+ F ++ KD+ SW ++ G+ ++ EAL LF+ + E
Sbjct: 433 FVSNALMDMYAKCGSMQEAELVFSEMRVKDIISWNTIIGGYSKNCYANEALSLFNLLLEE 492

Query: 361 -GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLAD 537
S D + C L A L A KG +I+ ++ G+ D V + LV+MY KCG L
Sbjct: 493 KRFSPDERTVACVLPACASLSAFDKGREIHGYIMRNGYFSDRHVANSLVDMYAKCGALLL 552

Query: 538 SQQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ +FD + + +V+W ++ GY HG+G+ A+ F +M
Sbjct: 553 AHMLFDDIASKDLVSWTVMIAGYGMHGFGKEAIALFNQM 591



Score = 118 bits (296), Expect = 2e-26
Identities = 62/195 (31%), Positives = 104/195 (53%)
Frame = +1

Query: 70 DAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYMYTKCGLLLKAQEAF 249
D T L+ C ++ ++ +G+E+ N I G D +G+ L MYT CG L +A F
Sbjct: 93 DPRTLCSVLQLCADSKSLKDGKEVDNFIRGNGFVIDSNLGSKLSLMYTNCGDLKEASRVF 152

Query: 250 YNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVCSLKASGGLRAAK 429
++ + W LM + F ++ LF KM + GV +D+ +F C K+ LR+
Sbjct: 153 DEVKIEKALFWNILMNELAKSGDFSGSIGLFKKMMSSGVEMDSYTFSCVSKSFSSLRSVH 212

Query: 430 KGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTVVAWNALMGGYV 609
GEQ++ ++ GF SVG+ LV Y K + +++VFD + ++ V++WN+++ GYV
Sbjct: 213 GGEQLHGFILKSGFGERNSVGNSLVAFYLKNQRVDSARKVFDEMTERDVISWNSIINGYV 272

Query: 610 EHGYGEVALDCFQRM 654
+G E L F +M
Sbjct: 273 SNGLAEKGLSVFVQM 287



Score = 116 bits (290), Expect = 1e-25
Identities = 68/192 (35%), Positives = 104/192 (54%), Gaps = 6/192 (3%)
Frame = +1

Query: 46 MKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYMYTKCGL 225
++E+ SPD T AC L AC + A D+G+EIH IM+ G D V NSL+ MY KCG
Sbjct: 490 LEEKRFSPDERTVACVLPACASLSAFDKGREIHGYIMRNGYFSDRHVANSLVDMYAKCGA 549

Query: 226 LLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVCSLKA 405
LL A F +I +KD+ SWT ++ G+ H +EA+ LF++M G+ D +SFV L A
Sbjct: 550 LLLAHMLFDDIASKDLVSWTVMIAGYGMHGFGKEAIALFNQMRQAGIEADEISFVSLLYA 609

Query: 406 SGGLRAAKKGEQIYSELVMK---GFEGDYSVGSCLVEMYGKCGLLADSQQVFDTL---PD 567
+G + ++ +M+ E +C+V+M + G L + + + + PD
Sbjct: 610 CSHSGLVDEGWRFFN--IMRHECKIEPTVEHYACIVDMLARTGDLIKAYRFIENMPIPPD 667

Query: 568 QTVVAWNALMGG 603
T+ W AL+ G
Sbjct: 668 ATI--WGALLCG 677



Score = 115 bits (287), Expect = 3e-25
Identities = 57/213 (26%), Positives = 110/213 (51%)
Frame = +1

Query: 7 HGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFV 186
+GL++ L + QM GI D T C ++ + G+ +H+ ++ ++
Sbjct: 274 NGLAEKGLSVFVQMLVSGIEIDLATIVSVFAGCADSRLISLGRAVHSIGVKACFSREDRF 333

Query: 187 GNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGV 366
N+L+ MY+KCG L A+ F + + V S+T+++ G+ EA++LF++M EG+
Sbjct: 334 CNTLLDMYSKCGDLDSAKAVFREMSDRSVVSYTSMIAGYAREGLAGEAVKLFEEMEEEGI 393

Query: 367 SLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQ 546
S D + L R +G++++ + D V + L++MY KCG + +++
Sbjct: 394 SPDVYTVTAVLNCCARYRLLDEGKRVHEWIKENDLGFDIFVSNALMDMYAKCGSMQEAEL 453

Query: 547 VFDTLPDQTVVAWNALMGGYVEHGYGEVALDCF 645
VF + + +++WN ++GGY ++ Y AL F
Sbjct: 454 VFSEMRVKDIISWNTIIGGYSKNCYANEALSLF 486



Score = 110 bits (276), Expect = 5e-24
Identities = 57/206 (27%), Positives = 108/206 (52%)
Frame = +1

Query: 37 YEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYMYTK 216
+++M G+ D+ TF+C K+ + +V G+++H I++ G G+ + VGNSL+ Y K
Sbjct: 183 FKKMMSSGVEMDSYTFSCVSKSFSSLRSVHGGEQLHGFILKSGFGERNSVGNSLVAFYLK 242

Query: 217 CGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVCS 396
+ A++ F + +DV SW +++ G+V + + L +F +M G+ +D + V
Sbjct: 243 NQRVDSARKVFDEMTERDVISWNSIINGYVSNGLAEKGLSVFVQMLVSGIEIDLATIVSV 302

Query: 397 LKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTV 576
R G ++S V F + + L++MY KCG L ++ VF + D++V
Sbjct: 303 FAGCADSRLISLGRAVHSIGVKACFSREDRFCNTLLDMYSKCGDLDSAKAVFREMSDRSV 362

Query: 577 VAWNALMGGYVEHGYGEVALDCFQRM 654
V++ +++ GY G A+ F+ M
Sbjct: 363 VSYTSMIAGYAREGLAGEAVKLFEEM 388



Score = 49.7 bits (117), Expect = 1e-05
Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 3/118 (2%)
Frame = +1

Query: 7 HGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFV 186
HG A+ + QM++ GI D ++F L AC ++G VDEG N IM+ + V
Sbjct: 578 HGFGKEAIALFNQMRQAGIEADEISFVSLLYACSHSGLVDEGWRFFN-IMRHECKIEPTV 636

Query: 187 GN--SLIYMYTKCGLLLKAQEAFYNIQ-TKDVASWTALMTGFVEHSRFREALELFDKM 351
+ ++ M + G L+KA N+ D W AL+ G H + A ++ +K+
Sbjct: 637 EHYACIVDMLARTGDLIKAYRFIENMPIPPDATIWGALLCGCRIHHDVKLAEKVAEKV 694


>sp|Q9SB36|PP337_ARATH Pentatricopeptide repeat-containing protein
At4g25270, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-E53 PE=2 SV=1
Length = 527

Score = 145 bits (366), Expect = 2e-34
Identities = 76/218 (34%), Positives = 125/218 (57%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
AE G + A+ Y QM E+G+ PD TF LKACG G+V G+ IH ++++ G G D
Sbjct: 171 AELGQYEDAMALYFQMAEDGVKPDRFTFPRVLKACGGIGSVQIGEAIHRDLVKEGFGYDV 230

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
+V N+L+ MY KCG ++KA+ F I KD SW +++TG++ H EAL++F M
Sbjct: 231 YVLNALVVMYAKCGDIVKARNVFDMIPHKDYVSWNSMLTGYLHHGLLHEALDIFRLMVQN 290

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
G+ D V+ L + + K G Q++ ++ +G E + SV + L+ +Y K G L +
Sbjct: 291 GIEPDKVAISSVL---ARVLSFKHGRQLHGWVIRRGMEWELSVANALIVLYSKRGQLGQA 347

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+FD + ++ V+WNA++ + ++ G L F++M
Sbjct: 348 CFIFDQMLERDTVSWNAIISAHSKNSNG---LKYFEQM 382



Score = 127 bits (320), Expect = 4e-29
Identities = 71/215 (33%), Positives = 119/215 (55%), Gaps = 3/215 (1%)
Frame = +1

Query: 19 DLALECYEQMKEEGIS-PDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNS 195
D + E ++GIS + FA L+ C + A+D G +H+ I L + + +
Sbjct: 73 DSVITDLETSAQKGISLTEPEIFASLLETCYSLRAIDHGVRVHHLIPPYLLRNNLGISSK 132

Query: 196 LIYMYTKCGLLLKAQEAFYNIQTKDVA--SWTALMTGFVEHSRFREALELFDKMHNEGVS 369
L+ +Y CG A E F + +D + +W +L++G+ E ++ +A+ L+ +M +GV
Sbjct: 133 LVRLYASCGYAEVAHEVFDRMSKRDSSPFAWNSLISGYAELGQYEDAMALYFQMAEDGVK 192

Query: 370 LDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQV 549
D +F LKA GG+ + + GE I+ +LV +GF D V + LV MY KCG + ++ V
Sbjct: 193 PDRFTFPRVLKACGGIGSVQIGEAIHRDLVKEGFGYDVYVLNALVVMYAKCGDIVKARNV 252

Query: 550 FDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
FD +P + V+WN+++ GY+ HG ALD F+ M
Sbjct: 253 FDMIPHKDYVSWNSMLTGYLHHGLLHEALDIFRLM 287



Score = 88.6 bits (218), Expect = 3e-17
Identities = 59/219 (26%), Positives = 106/219 (48%), Gaps = 3/219 (1%)
Frame = +1

Query: 7 HGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFV 186
HGL AL+ + M + GI PD V + L + G+++H +++RG+ + V
Sbjct: 274 HGLLHEALDIFRLMVQNGIEPDKVAISSVL---ARVLSFKHGRQLHGWVIRRGMEWELSV 330

Query: 187 GNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGV 366
N+LI +Y+K G L +A F + +D SW A+++ HS+ L+ F++MH
Sbjct: 331 ANALIVLYSKRGQLGQACFIFDQMLERDTVSWNAIISA---HSKNSNGLKYFEQMHRANA 387

Query: 367 SLDAVSFVCSLKASGGLRAAKKGEQIYSELVMK-GFEGDYSVGSCLVEMYGKCGLL--AD 537
D ++FV L + GE+++S + + G + +C+V +YG+ G++ A
Sbjct: 388 KPDGITFVSVLSLCANTGMVEDGERLFSLMSKEYGIDPKMEHYACMVNLYGRAGMMEEAY 447

Query: 538 SQQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
S V + + W AL+ HG ++ QR+
Sbjct: 448 SMIVQEMGLEAGPTVWGALLYACYLHGNTDIGEVAAQRL 486


>sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protein
At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2
Length = 1064

Score = 143 bits (360), Expect = 9e-34
Identities = 68/217 (31%), Positives = 123/217 (56%)
Frame = +1

Query: 4 EHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHF 183
++ D AL + QM + GI D V ++ AC A+ EGQ+IH + G D
Sbjct: 568 QYNFDDKALTTFRQMLDRGIRSDEVGLTNAVSACAGLQALKEGQQIHAQACVSGFSSDLP 627

Query: 184 VGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEG 363
N+L+ +Y++CG + ++ AF + D +W AL++GF + EAL +F +M+ EG
Sbjct: 628 FQNALVTLYSRCGKIEESYLAFEQTEAGDNIAWNALVSGFQQSGNNEEALRVFVRMNREG 687

Query: 364 VSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQ 543
+ + +F ++KA+ K+G+Q+++ + G++ + V + L+ MY KCG ++D++
Sbjct: 688 IDNNNFTFGSAVKAASETANMKQGKQVHAVITKTGYDSETEVCNALISMYAKCGSISDAE 747

Query: 544 QVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ F + + V+WNA++ Y +HG+G ALD F +M
Sbjct: 748 KQFLEVSTKNEVSWNAIINAYSKHGFGSEALDSFDQM 784



Score = 129 bits (325), Expect = 1e-29
Identities = 71/216 (32%), Positives = 117/216 (54%), Gaps = 2/216 (0%)
Frame = +1

Query: 13 LSDL--ALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFV 186
L DL + + QM+ E I P+ T+ LK C G ++ G++IH++I++ + +V
Sbjct: 468 LDDLRNSFRIFRQMQIEEIVPNQYTYPSILKTCIRLGDLELGEQIHSQIIKTNFQLNAYV 527

Query: 187 GNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGV 366
+ LI MY K G L A + KDV SWT ++ G+ +++ +AL F +M + G+
Sbjct: 528 CSVLIDMYAKLGKLDTAWDILIRFAGKDVVSWTTMIAGYTQYNFDDKALTTFRQMLDRGI 587

Query: 367 SLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQ 546
D V ++ A GL+A K+G+QI+++ + GF D + LV +Y +CG + +S
Sbjct: 588 RSDEVGLTNAVSACAGLQALKEGQQIHAQACVSGFSSDLPFQNALVTLYSRCGKIEESYL 647

Query: 547 VFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
F+ +AWNAL+ G+ + G E AL F RM
Sbjct: 648 AFEQTEAGDNIAWNALVSGFQQSGNNEEALRVFVRM 683



Score = 111 bits (278), Expect = 3e-24
Identities = 64/207 (30%), Positives = 113/207 (54%), Gaps = 1/207 (0%)
Frame = +1

Query: 37 YEQMKEEGISPDAVTFACSLKAC-GNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYMYT 213
+ +M E ++P+ TF+ L+AC G + A D ++IH I+ +GL V N LI +Y+
Sbjct: 174 FVRMVSENVTPNEGTFSGVLEACRGGSVAFDVVEQIHARILYQGLRDSTVVCNPLIDLYS 233

Query: 214 KCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVC 393
+ G + A+ F ++ KD +SW A+++G ++ EA+ LF M+ G+ +F
Sbjct: 234 RNGFVDLARRVFDGLRLKDHSSWVAMISGLSKNECEAEAIRLFCDMYVLGIMPTPYAFSS 293

Query: 394 SLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQT 573
L A + + + GEQ++ ++ GF D V + LV +Y G L ++ +F + +
Sbjct: 294 VLSACKKIESLEIGEQLHGLVLKLGFSSDTYVCNALVSLYFHLGNLISAEHIFSNMSQRD 353

Query: 574 VVAWNALMGGYVEHGYGEVALDCFQRM 654
V +N L+ G + GYGE A++ F+RM
Sbjct: 354 AVTYNTLINGLSQCGYGEKAMELFKRM 380



Score = 104 bits (260), Expect = 4e-22
Identities = 54/215 (25%), Positives = 109/215 (50%)
Frame = +1

Query: 10 GLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVG 189
G + A+E +++M +G+ PD+ T A + AC G + GQ++H + G ++ +
Sbjct: 368 GYGEKAMELFKRMHLDGLEPDSNTLASLVVACSADGTLFRGQQLHAYTTKLGFASNNKIE 427

Query: 190 NSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVS 369
+L+ +Y KC + A + F + ++V W ++ + R + +F +M E +
Sbjct: 428 GALLNLYAKCADIETALDYFLETEVENVVLWNVMLVAYGLLDDLRNSFRIFRQMQIEEIV 487

Query: 370 LDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQV 549
+ ++ LK L + GEQI+S+++ F+ + V S L++MY K G L + +
Sbjct: 488 PNQYTYPSILKTCIRLGDLELGEQIHSQIIKTNFQLNAYVCSVLIDMYAKLGKLDTAWDI 547

Query: 550 FDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ VV+W ++ GY ++ + + AL F++M
Sbjct: 548 LIRFAGKDVVSWTTMIAGYTQYNFDDKALTTFRQM 582



Score = 97.4 bits (241), Expect = 6e-20
Identities = 61/214 (28%), Positives = 105/214 (49%), Gaps = 5/214 (2%)
Frame = +1

Query: 4 EHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHF 183
+ G ++ AL + +M EGI + TF ++KA + +G+++H I + G +
Sbjct: 669 QSGNNEEALRVFVRMNREGIDNNNFTFGSAVKAASETANMKQGKQVHAVITKTGYDSETE 728

Query: 184 VGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEG 363
V N+LI MY KCG + A++ F + TK+ SW A++ + +H EAL+ FD+M +
Sbjct: 729 VCNALISMYAKCGSISDAEKQFLEVSTKNEVSWNAIINAYSKHGFGSEALDSFDQMIHSN 788

Query: 364 VSLDAVSFVCSLKASGGLRAAKKG----EQIYSELVMKGFEGDYSVGSCLVEMYGKCGLL 531
V + V+ V L A + KG E + SE + Y C+V+M + GLL
Sbjct: 789 VRPNHVTLVGVLSACSHIGLVDKGIAYFESMNSEYGLSPKPEHY---VCVVDMLTRAGLL 845

Query: 532 ADSQQVFDTLP-DQTVVAWNALMGGYVEHGYGEV 630
+ +++ +P + W L+ V H E+
Sbjct: 846 SRAKEFIQEMPIKPDALVWRTLLSACVVHKNMEI 879



Score = 94.4 bits (233), Expect = 5e-19
Identities = 52/197 (26%), Positives = 97/197 (49%), Gaps = 3/197 (1%)
Frame = +1

Query: 25 ALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIY 204
A+ + M GI P F+ L AC +++ G+++H +++ G D +V N+L+
Sbjct: 272 AIRLFCDMYVLGIMPTPYAFSSVLSACKKIESLEIGEQLHGLVLKLGFSSDTYVCNALVS 331

Query: 205 MYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDA-- 378
+Y G L+ A+ F N+ +D ++ L+ G + +A+ELF +MH +G+ D+
Sbjct: 332 LYFHLGNLISAEHIFSNMSQRDAVTYNTLINGLSQCGYGEKAMELFKRMHLDGLEPDSNT 391

Query: 379 -VSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFD 555
S V + A G L +G+Q+++ GF + + L+ +Y KC + + F
Sbjct: 392 LASLVVACSADGTL---FRGQQLHAYTTKLGFASNNKIEGALLNLYAKCADIETALDYFL 448

Query: 556 TLPDQTVVAWNALMGGY 606
+ VV WN ++ Y
Sbjct: 449 ETEVENVVLWNVMLVAY 465



Score = 50.4 bits (119), Expect = 8e-06
Identities = 33/108 (30%), Positives = 54/108 (50%), Gaps = 4/108 (3%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEI-MQRGLG-- 171
++HG AL+ ++QM + P+ VT L AC + G VD+G + + GL
Sbjct: 769 SKHGFGSEALDSFDQMIHSNVRPNHVTLVGVLSACSHIGLVDKGIAYFESMNSEYGLSPK 828

Query: 172 KDHFVGNSLIYMYTKCGLLLKAQEAFYNIQTK-DVASWTALMTGFVEH 312
+H+V ++ M T+ GLL +A+E + K D W L++ V H
Sbjct: 829 PEHYV--CVVDMLTRAGLLSRAKEFIQEMPIKPDALVWRTLLSACVVH 874



Score = 40.4 bits (93), Expect = 0.008
Identities = 32/128 (25%), Positives = 62/128 (48%), Gaps = 5/128 (3%)
Frame = +1

Query: 229 LKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGV-----SLDAVSFVC 393
LK + F + AS+ A+ E F+E + D + N G+ +L + C
Sbjct: 37 LKTRTVFPTLCGTRRASFAAISVYISEDESFQE--KRIDSVENRGIRPNHQTLKWLLEGC 94

Query: 394 SLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQT 573
LK +G L +G +++S+++ G + + + L + Y G L + +VFD +P++T
Sbjct: 95 -LKTNGSL---DEGRKLHSQILKLGLDSNGCLSEKLFDFYLFKGDLYGAFKVFDEMPERT 150

Query: 574 VVAWNALM 597
+ WN ++
Sbjct: 151 IFTWNKMI 158


>sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protein
At2g33680 OS=Arabidopsis thaliana GN=PCMP-E19 PE=2 SV=1
Length = 727

Score = 142 bits (358), Expect = 2e-33
Identities = 73/218 (33%), Positives = 124/218 (56%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
+++G S A++ + +M GI P T L AC + ++EG+++H+ +++ G +
Sbjct: 298 SQNGESLEAVKLFSRMFSAGIKPSEYTIVGVLNACSDICYLEEGKQLHSFLLKLGFERHL 357

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
F +L+ MY K G L A++ F +Q +DVA WT+L++G+V++S EAL L+ +M
Sbjct: 358 FATTALVDMYAKAGCLADARKGFDCLQERDVALWTSLISGYVQNSDNEEALILYRRMKTA 417

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
G+ + + LKA L + G+Q++ + GF + +GS L MY KCG L D
Sbjct: 418 GIIPNDPTMASVLKACSSLATLELGKQVHGHTIKHGFGLEVPIGSALSTMYSKCGSLEDG 477

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
VF P++ VV+WNA++ G +G G+ AL+ F+ M
Sbjct: 478 NLVFRRTPNKDVVSWNAMISGLSHNGQGDEALELFEEM 515



Score = 112 bits (279), Expect = 2e-24
Identities = 66/202 (32%), Positives = 113/202 (55%)
Frame = +1

Query: 49 KEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYMYTKCGLL 228
KEEG D V F L + V G++IH ++ GL + N+L+ MY+KC L
Sbjct: 214 KEEGSDSDYV-FTAVLSSLAATIYVGLGRQIHCITIKNGLLGFVALSNALVTMYSKCESL 272

Query: 229 LKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVCSLKAS 408
+A + F + ++ +W+A++TG+ ++ EA++LF +M + G+ + V L A
Sbjct: 273 NEACKMFDSSGDRNSITWSAMVTGYSQNGESLEAVKLFSRMFSAGIKPSEYTIVGVLNAC 332

Query: 409 GGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTVVAWN 588
+ ++G+Q++S L+ GFE + LV+MY K G LAD+++ FD L ++ V W
Sbjct: 333 SDICYLEEGKQLHSFLLKLGFERHLFATTALVDMYAKAGCLADARKGFDCLQERDVALWT 392

Query: 589 ALMGGYVEHGYGEVALDCFQRM 654
+L+ GYV++ E AL ++RM
Sbjct: 393 SLISGYVQNSDNEEALILYRRM 414



Score = 103 bits (257), Expect = 8e-22
Identities = 60/206 (29%), Positives = 107/206 (51%), Gaps = 2/206 (0%)
Frame = +1

Query: 25 ALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIY 204
AL Y +MK GI P+ T A LKAC + ++ G+++H ++ G G + +G++L
Sbjct: 407 ALILYRRMKTAGIIPNDPTMASVLKACSSLATLELGKQVHGHTIKHGFGLEVPIGSALST 466

Query: 205 MYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVS 384
MY+KCG L F KDV SW A+++G + + EALELF++M EG+ D V+
Sbjct: 467 MYSKCGSLEDGNLVFRRTPNKDVVSWNAMISGLSHNGQGDEALELFEEMLAEGMEPDDVT 526

Query: 385 FVCSLKASGGLRAAKKGEQIYSELVMK-GFEGDYSVGSCLVEMYGKCGLLADSQQVFDTL 561
FV + A ++G ++ + + G + +C+V++ + G L ++++ ++
Sbjct: 527 FVNIISACSHKGFVERGWFYFNMMSDQIGLDPKVDHYACMVDLLSRAGQLKEAKEFIESA 586

Query: 562 P-DQTVVAWNALMGGYVEHGYGEVAL 636
D + W L+ HG E+ +
Sbjct: 587 NIDHGLCLWRILLSACKNHGKCELGV 612



Score = 96.7 bits (239), Expect = 1e-19
Identities = 54/175 (30%), Positives = 89/175 (50%), Gaps = 3/175 (1%)
Frame = +1

Query: 130 GQEIHNEIMQRGLGKDHFVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVE 309
G+ +H +I++ G N L+ Y KCG L KA F I KDV SW +L+TG+ +
Sbjct: 33 GRAVHGQIIRTGASTCIQHANVLVNFYAKCGKLAKAHSIFNAIICKDVVSWNSLITGYSQ 92

Query: 310 HSRFREA---LELFDKMHNEGVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGD 480
+ + ++LF +M + + +A + KA L+++ G Q ++ +V GD
Sbjct: 93 NGGISSSYTVMQLFREMRAQDILPNAYTLAGIFKAESSLQSSTVGRQAHALVVKMSSFGD 152

Query: 481 YSVGSCLVEMYGKCGLLADSQQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCF 645
V + LV MY K GL+ D +VF +P++ W+ ++ GY G E A+ F
Sbjct: 153 IYVDTSLVGMYCKAGLVEDGLKVFAYMPERNTYTWSTMVSGYATRGRVEEAIKVF 207



Score = 46.2 bits (108), Expect = 2e-04
Identities = 31/109 (28%), Positives = 54/109 (49%), Gaps = 3/109 (2%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
+ +G D ALE +E+M EG+ PD VTF + AC + G V+ G N +M +G D
Sbjct: 500 SHNGQGDEALELFEEMLAEGMEPDDVTFVNIISACSHKGFVERGWFYFN-MMSDQIGLDP 558

Query: 181 FVGN--SLIYMYTKCGLLLKAQEAFYNIQ-TKDVASWTALMTGFVEHSR 318
V + ++ + ++ G L +A+E + + W L++ H +
Sbjct: 559 KVDHYACMVDLLSRAGQLKEAKEFIESANIDHGLCLWRILLSACKNHGK 607


>sp|Q9CAA8|PP108_ARATH Putative pentatricopeptide repeat-containing
protein At1g68930 OS=Arabidopsis thaliana GN=PCMP-H22
PE=3 SV=1
Length = 743

Score = 140 bits (354), Expect = 4e-33
Identities = 69/218 (31%), Positives = 123/218 (56%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A++GL+ A+EC+ +MK +G+ D F L ACG GA++EG++IH I++
Sbjct: 246 AQNGLAKEAIECFREMKVQGLKMDQYPFGSVLPACGGLGAINEGKQIHACIIRTNFQDHI 305

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
+VG++LI MY KC L A+ F ++ K+V SWTA++ G+ + R EA+++F M
Sbjct: 306 YVGSALIDMYCKCKCLHYAKTVFDRMKQKNVVSWTAMVVGYGQTGRAEEAVKIFLDMQRS 365

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
G+ D + ++ A + + ++G Q + + + G +V + LV +YGKCG + DS
Sbjct: 366 GIDPDHYTLGQAISACANVSSLEEGSQFHGKAITSGLIHYVTVSNSLVTLYGKCGDIDDS 425

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
++F+ + + V+W A++ Y + G + F +M
Sbjct: 426 TRLFNEMNVRDAVSWTAMVSAYAQFGRAVETIQLFDKM 463



Score = 117 bits (294), Expect = 4e-26
Identities = 72/246 (29%), Positives = 118/246 (47%), Gaps = 31/246 (12%)
Frame = +1

Query: 10 GLSDLALECYE-QMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFV 186
GL A++ Y M++ + VT LK + G V G++IH ++++ G V
Sbjct: 117 GLVGAAVKAYNTMMRDFSANLTRVTLMTMLKLSSSNGHVSLGKQIHGQVIKLGFESYLLV 176

Query: 187 GNSLIYMYTKCGLLLKAQEAFYNIQT------------------------------KDVA 276
G+ L+YMY G + A++ FY + KD
Sbjct: 177 GSPLLYMYANVGCISDAKKVFYGLDDRNTVMYNSLMGGLLACGMIEDALQLFRGMEKDSV 236

Query: 277 SWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVCSLKASGGLRAAKKGEQIYSEL 456
SW A++ G ++ +EA+E F +M +G+ +D F L A GGL A +G+QI++ +
Sbjct: 237 SWAAMIKGLAQNGLAKEAIECFREMKVQGLKMDQYPFGSVLPACGGLGAINEGKQIHACI 296

Query: 457 VMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTVVAWNALMGGYVEHGYGEVAL 636
+ F+ VGS L++MY KC L ++ VFD + + VV+W A++ GY + G E A+
Sbjct: 297 IRTNFQDHIYVGSALIDMYCKCKCLHYAKTVFDRMKQKNVVSWTAMVVGYGQTGRAEEAV 356

Query: 637 DCFQRM 654
F M
Sbjct: 357 KIFLDM 362



Score = 103 bits (257), Expect = 8e-22
Identities = 56/210 (26%), Positives = 107/210 (50%), Gaps = 3/210 (1%)
Frame = +1

Query: 10 GLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVG 189
G ++ A++ + M+ GI PD T ++ AC N +++EG + H + + GL V
Sbjct: 350 GRAEEAVKIFLDMQRSGIDPDHYTLGQAISACANVSSLEEGSQFHGKAITSGLIHYVTVS 409

Query: 190 NSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVS 369
NSL+ +Y KCG + + F + +D SWTA+++ + + R E ++LFDKM G+
Sbjct: 410 NSLVTLYGKCGDIDDSTRLFNEMNVRDAVSWTAMVSAYAQFGRAVETIQLFDKMVQHGLK 469

Query: 370 LDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVG--SCLVEMYGKCGLLADSQ 543
D V+ + A +KG++ Y +L+ + S+G SC+++++ + G L ++
Sbjct: 470 PDGVTLTGVISACSRAGLVEKGQR-YFKLMTSEYGIVPSIGHYSCMIDLFSRSGRLEEAM 528

Query: 544 QVFDTLP-DQTVVAWNALMGGYVEHGYGEV 630
+ + +P + W L+ G E+
Sbjct: 529 RFINGMPFPPDAIGWTTLLSACRNKGNLEI 558



Score = 85.1 bits (209), Expect = 3e-16
Identities = 49/159 (30%), Positives = 84/159 (52%), Gaps = 1/159 (0%)
Frame = +1

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
F N+L+ Y+K GL+ + + F + +D +W L+ G+ A++ ++ M +
Sbjct: 73 FSWNNLLLAYSKAGLISEMESTFEKLPDRDGVTWNVLIEGYSLSGLVGAAVKAYNTMMRD 132

Query: 361 -GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLAD 537
+L V+ + LK S G+QI+ +++ GFE VGS L+ MY G ++D
Sbjct: 133 FSANLTRVTLMTMLKLSSSNGHVSLGKQIHGQVIKLGFESYLLVGSPLLYMYANVGCISD 192

Query: 538 SQQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+++VF L D+ V +N+LMGG + G E AL F+ M
Sbjct: 193 AKKVFYGLDDRNTVMYNSLMGGLLACGMIEDALQLFRGM 231



Score = 42.7 bits (99), Expect = 0.002
Identities = 34/133 (25%), Positives = 65/133 (48%), Gaps = 9/133 (6%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+ G + ++ +++M + G+ PD VT + AC AG V++GQ + ++M G
Sbjct: 448 AQFGRAVETIQLFDKMVQHGLKPDGVTLTGVISACSRAGLVEKGQR-YFKLMTSEYGIVP 506

Query: 181 FVG--NSLIYMYTKCGLLLKAQEAFYNIQ-TKDVASWTALMT-----GFVEHSRF-REAL 333
+G + +I ++++ G L +A + D WT L++ G +E ++ E+L
Sbjct: 507 SIGHYSCMIDLFSRSGRLEEAMRFINGMPFPPDAIGWTTLLSACRNKGNLEIGKWAAESL 566

Query: 334 ELFDKMHNEGVSL 372
D H G +L
Sbjct: 567 IELDPHHPAGYTL 579


>sp|Q9LIC3|PP227_ARATH Putative pentatricopeptide repeat-containing
protein At3g13770, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H85 PE=3 SV=1
Length = 628

Score = 139 bits (351), Expect = 1e-32
Identities = 72/218 (33%), Positives = 126/218 (57%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
++ G S AL + +M P+ TFA L +C A + G++IH I++
Sbjct: 129 SQTGHSSEALTVFAEMMRSDGKPNEFTFATVLTSCIRASGLGLGKQIHGLIVKWNYDSHI 188

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
FVG+SL+ MY K G + +A+E F + +DV S TA++ G+ + EALE+F ++H+E
Sbjct: 189 FVGSSLLDMYAKAGQIKEAREIFECLPERDVVSCTAIIAGYAQLGLDEEALEMFHRLHSE 248

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
G+S + V++ L A GL G+Q + ++ + + + L++MY KCG L+ +
Sbjct: 249 GMSPNYVTYASLLTALSGLALLDHGKQAHCHVLRRELPFYAVLQNSLIDMYSKCGNLSYA 308

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+++FD +P++T ++WNA++ GY +HG G L+ F+ M
Sbjct: 309 RRLFDNMPERTAISWNAMLVGYSKHGLGREVLELFRLM 346



Score = 102 bits (253), Expect = 2e-21
Identities = 67/213 (31%), Positives = 107/213 (50%), Gaps = 8/213 (3%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+ GL + ALE + ++ EG+SP+ VT+A L A +D G++ H +++R L
Sbjct: 230 AQLGLDEEALEMFHRLHSEGMSPNYVTYASLLTALSGLALLDHGKQAHCHVLRRELPFYA 289

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
+ NSLI MY+KCG L A+ F N+ + SW A++ G+ +H RE LELF M +E
Sbjct: 290 VLQNSLIDMYSKCGNLSYARRLFDNMPERTAISWNAMLVGYSKHGLGREVLELFRLMRDE 349

Query: 361 -GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVG------SCLVEMYGK 519
V DAV+ + L R G I+ +V G+Y C+V+M G+
Sbjct: 350 KRVKPDAVTLLAVLSGCSHGRMEDTGLNIFDGMV----AGEYGTKPGTEHYGCIVDMLGR 405

Query: 520 CGLLADSQQVFDTLPDQ-TVVAWNALMGGYVEH 615
G + ++ + +P + T +L+G H
Sbjct: 406 AGRIDEAFEFIKRMPSKPTAGVLGSLLGACRVH 438



Score = 95.5 bits (236), Expect = 2e-19
Identities = 52/187 (27%), Positives = 98/187 (52%)
Frame = +1

Query: 94 LKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYMYTKCGLLLKAQEAFYNIQTKDV 273
L AC + A+ +GQ +H +++ ++ L+ Y KC L A++ + K+V
Sbjct: 59 LNACLDKRALRDGQRVHAHMIKTRYLPATYLRTRLLIFYGKCDCLEDARKVLDEMPEKNV 118

Query: 274 ASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVCSLKASGGLRAAKKGEQIYSE 453
SWTA+++ + + EAL +F +M + +F L + G+QI+
Sbjct: 119 VSWTAMISRYSQTGHSSEALTVFAEMMRSDGKPNEFTFATVLTSCIRASGLGLGKQIHGL 178

Query: 454 LVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTVVAWNALMGGYVEHGYGEVA 633
+V ++ VGS L++MY K G + +++++F+ LP++ VV+ A++ GY + G E A
Sbjct: 179 IVKWNYDSHIFVGSSLLDMYAKAGQIKEAREIFECLPERDVVSCTAIIAGYAQLGLDEEA 238

Query: 634 LDCFQRM 654
L+ F R+
Sbjct: 239 LEMFHRL 245



Score = 53.5 bits (127), Expect = 9e-07
Identities = 35/144 (24%), Positives = 68/144 (47%)
Frame = +1

Query: 223 LLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVCSLK 402
L+ +F + T V ++ + R +EAL +M G + + L
Sbjct: 4 LMRLIHRSFSSSPTNYVLQTILPISQLCSNGRLQEALL---EMAMLGPEMGFHGYDALLN 60

Query: 403 ASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTVVA 582
A RA + G+++++ ++ + + + L+ YGKC L D+++V D +P++ VV+
Sbjct: 61 ACLDKRALRDGQRVHAHMIKTRYLPATYLRTRLLIFYGKCDCLEDARKVLDEMPEKNVVS 120

Query: 583 WNALMGGYVEHGYGEVALDCFQRM 654
W A++ Y + G+ AL F M
Sbjct: 121 WTAMISRYSQTGHSSEALTVFAEM 144


>sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protein
At3g09040, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E88 PE=2 SV=1
Length = 1028

Score = 139 bits (351), Expect = 1e-32
Identities = 73/218 (33%), Positives = 123/218 (56%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A +G S +E + MK G + D TF L C + ++ G + H+ I+++ L K+
Sbjct: 404 AHNGESHKVMELFMDMKSSGYNIDDFTFTSLLSTCAASHDLEMGSQFHSIIIKKKLAKNL 463

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
FVGN+L+ MY KCG L A++ F + +D +W ++ +V+ EA +LF +M+
Sbjct: 464 FVGNALVDMYAKCGALEDARQIFERMCDRDNVTWNTIIGSYVQDENESEAFDLFKRMNLC 523

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
G+ D +LKA + +G+Q++ V G + D GS L++MY KCG++ D+
Sbjct: 524 GIVSDGACLASTLKACTHVHGLYQGKQVHCLSVKCGLDRDLHTGSSLIDMYSKCGIIKDA 583

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
++VF +LP+ +VV+ NAL+ GY ++ E A+ FQ M
Sbjct: 584 RKVFSSLPEWSVVSMNALIAGYSQNNL-EEAVVLFQEM 620



Score = 129 bits (325), Expect = 1e-29
Identities = 65/217 (29%), Positives = 113/217 (52%)
Frame = +1

Query: 4 EHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHF 183
+ G +A+E + M++ + T L A G +D G +H E ++ GL + +
Sbjct: 304 KRGCETVAIEYFFNMRKSSVKSTRSTLGSVLSAIGIVANLDLGLVVHAEAIKLGLASNIY 363

Query: 184 VGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEG 363
VG+SL+ MY+KC + A + F ++ K+ W A++ G+ + + +ELF M + G
Sbjct: 364 VGSSLVSMYSKCEKMEAAAKVFEALEEKNDVFWNAMIRGYAHNGESHKVMELFMDMKSSG 423

Query: 364 VSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQ 543
++D +F L + G Q +S ++ K + VG+ LV+MY KCG L D++
Sbjct: 424 YNIDDFTFTSLLSTCAASHDLEMGSQFHSIIIKKKLAKNLFVGNALVDMYAKCGALEDAR 483

Query: 544 QVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
Q+F+ + D+ V WN ++G YV+ A D F+RM
Sbjct: 484 QIFERMCDRDNVTWNTIIGSYVQDENESEAFDLFKRM 520



Score = 123 bits (308), Expect = 1e-27
Identities = 66/213 (30%), Positives = 119/213 (55%), Gaps = 3/213 (1%)
Frame = +1

Query: 25 ALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKD-HFVGNSLI 201
A+ +++M G++P +TFA ++AC ++ G + H +I +RG + ++G SL+
Sbjct: 613 AVVLFQEMLTRGVNPSEITFATIVEACHKPESLTLGTQFHGQITKRGFSSEGEYLGISLL 672

Query: 202 YMYTKCGLLLKAQEAFYNIQT-KDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDA 378
MY + +A F + + K + WT +M+G ++ + EAL+ + +M ++GV D
Sbjct: 673 GMYMNSRGMTEACALFSELSSPKSIVLWTGMMSGHSQNGFYEEALKFYKEMRHDGVLPDQ 732

Query: 379 VSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDT 558
+FV L+ L + ++G I+S + + D + L++MY KCG + S QVFD
Sbjct: 733 ATFVTVLRVCSVLSSLREGRAIHSLIFHLAHDLDELTSNTLIDMYAKCGDMKGSSQVFDE 792

Query: 559 LPDQT-VVAWNALMGGYVEHGYGEVALDCFQRM 654
+ ++ VV+WN+L+ GY ++GY E AL F M
Sbjct: 793 MRRRSNVVSWNSLINGYAKNGYAEDALKIFDSM 825



Score = 102 bits (255), Expect = 1e-21
Identities = 57/211 (27%), Positives = 108/211 (51%), Gaps = 5/211 (2%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
+++G + AL+ Y++M+ +G+ PD TF L+ C ++ EG+ IH+ I D
Sbjct: 708 SQNGFYEEALKFYKEMRHDGVLPDQATFVTVLRVCSVLSSLREGRAIHSLIFHLAHDLDE 767

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTK-DVASWTALMTGFVEHSRFREALELFDKMHN 357
N+LI MY KCG + + + F ++ + +V SW +L+ G+ ++ +AL++FD M
Sbjct: 768 LTSNTLIDMYAKCGDMKGSSQVFDEMRRRSNVVSWNSLINGYAKNGYAEDALKIFDSMRQ 827

Query: 358 EGVSLDAVSFVCSLKASGGLRAAKKGEQIYSELV-MKGFEGDYSVGSCLVEMYGKCGLLA 534
+ D ++F+ L A G +I+ ++ G E +C+V++ G+ G L
Sbjct: 828 SHIMPDEITFLGVLTACSHAGKVSDGRKIFEMMIGQYGIEARVDHVACMVDLLGRWGYLQ 887

Query: 535 DSQQVFDT---LPDQTVVAWNALMGGYVEHG 618
++ + PD + W++L+G HG
Sbjct: 888 EADDFIEAQNLKPDARL--WSSLLGACRIHG 916



Score = 89.4 bits (220), Expect = 2e-17
Identities = 46/175 (26%), Positives = 91/175 (52%)
Frame = +1

Query: 130 GQEIHNEIMQRGLGKDHFVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVE 309
G+ +H++ + G+ + +GN+++ +Y KC + A++ F ++ KDV +W ++++ +
Sbjct: 79 GKAVHSKSLILGIDSEGRLGNAIVDLYAKCAQVSYAEKQFDFLE-KDVTAWNSMLSMYSS 137

Query: 310 HSRFREALELFDKMHNEGVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSV 489
+ + L F + + + +F L + G QI+ ++ G E +
Sbjct: 138 IGKPGKVLRSFVSLFENQIFPNKFTFSIVLSTCARETNVEFGRQIHCSMIKMGLERNSYC 197

Query: 490 GSCLVEMYGKCGLLADSQQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
G LV+MY KC ++D+++VF+ + D V W L GYV+ G E A+ F+RM
Sbjct: 198 GGALVDMYAKCDRISDARRVFEWIVDPNTVCWTCLFSGYVKAGLPEEAVLVFERM 252



Score = 86.7 bits (213), Expect = 1e-16
Identities = 51/198 (25%), Positives = 87/198 (43%)
Frame = +1

Query: 61 ISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYMYTKCGLLLKAQ 240
+ P+ V + C AG +E + + G DH ++I Y + G L A+
Sbjct: 222 VDPNTVCWTCLFSGYVKAGLPEEAVLVFERMRDEGHRPDHLAFVTVINTYIRLGKLKDAR 281

Query: 241 EAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVCSLKASGGLR 420
F + + DV +W +++G + A+E F M V + L A G +
Sbjct: 282 LLFGEMSSPDVVAWNVMISGHGKRGCETVAIEYFFNMRKSSVKSTRSTLGSVLSAIGIVA 341

Query: 421 AAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTVVAWNALMG 600
G +++E + G + VGS LV MY KC + + +VF+ L ++ V WNA++
Sbjct: 342 NLDLGLVVHAEAIKLGLASNIYVGSSLVSMYSKCEKMEAAAKVFEALEEKNDVFWNAMIR 401

Query: 601 GYVEHGYGEVALDCFQRM 654
GY +G ++ F M
Sbjct: 402 GYAHNGESHKVMELFMDM 419



Score = 85.1 bits (209), Expect = 3e-16
Identities = 53/209 (25%), Positives = 94/209 (44%)
Frame = +1

Query: 28 LECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYM 207
L + + E I P+ TF+ L C V+ G++IH +++ GL ++ + G +L+ M
Sbjct: 145 LRSFVSLFENQIFPNKFTFSIVLSTCARETNVEFGRQIHCSMIKMGLERNSYCGGALVDM 204

Query: 208 YTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSF 387
Y KC + A+ F I + WT L +G+V+ EA+ +F++M +EG D ++F
Sbjct: 205 YAKCDRISDARRVFEWIVDPNTVCWTCLFSGYVKAGLPEEAVLVFERMRDEGHRPDHLAF 264

Query: 388 VCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPD 567
V ++ Y + G L D++ +F +
Sbjct: 265 V-----------------------------------TVINTYIRLGKLKDARLLFGEMSS 289

Query: 568 QTVVAWNALMGGYVEHGYGEVALDCFQRM 654
VVAWN ++ G+ + G VA++ F M
Sbjct: 290 PDVVAWNVMISGHGKRGCETVAIEYFFNM 318


>sp|Q9C507|PP111_ARATH Putative pentatricopeptide repeat-containing
protein At1g69350, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E66 PE=3 SV=1
Length = 787

Score = 138 bits (348), Expect = 2e-32
Identities = 71/218 (32%), Positives = 127/218 (58%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A G+ AL + QM + I PDA T A S+ AC NAG V G++IH +++ + D
Sbjct: 381 AHRGMVIQALGLFRQMVTQRIKPDAFTLASSISACENAGLVPLGKQIHGHVIRTDVS-DE 439

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
FV NSLI MY+K G + A F I+ + V +W +++ GF ++ EA+ LFD M++
Sbjct: 440 FVQNSLIDMYSKSGSVDSASTVFNQIKHRSVVTWNSMLCGFSQNGNSVEAISLFDYMYHS 499

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
+ ++ V+F+ ++A + + +KG+ ++ +L++ G + D + L++MY KCG L +
Sbjct: 500 YLEMNEVTFLAVIQACSSIGSLEKGKWVHHKLIISGLK-DLFTDTALIDMYAKCGDLNAA 558

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ VF + +++V+W++++ Y HG A+ F +M
Sbjct: 559 ETVFRAMSSRSIVSWSSMINAYGMHGRIGSAISTFNQM 596



Score = 124 bits (311), Expect = 4e-28
Identities = 66/218 (30%), Positives = 117/218 (53%), Gaps = 1/218 (0%)
Frame = +1

Query: 4 EHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHF 183
E+G AL ++ M ++G+ PDAVT ++ C G + + +H +I ++ D
Sbjct: 179 ENGEVVKALRMFKCMVDDGVEPDAVTMISVVEGCAELGCLRIARSVHGQITRKMFDLDET 238

Query: 184 VGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEG 363
+ NSL+ MY+KCG LL ++ F I K+ SWTA+++ + +AL F +M G
Sbjct: 239 LCNSLLTMYSKCGDLLSSERIFEKIAKKNAVSWTAMISSYNRGEFSEKALRSFSEMIKSG 298

Query: 364 VSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDY-SVGSCLVEMYGKCGLLADS 540
+ + V+ L + G + ++G+ ++ V + + +Y S+ LVE+Y +CG L+D
Sbjct: 299 IEPNLVTLYSVLSSCGLIGLIREGKSVHGFAVRRELDPNYESLSLALVELYAECGKLSDC 358

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ V + D+ +VAWN+L+ Y G AL F++M
Sbjct: 359 ETVLRVVSDRNIVAWNSLISLYAHRGMVIQALGLFRQM 396



Score = 109 bits (273), Expect = 1e-23
Identities = 58/215 (26%), Positives = 112/215 (52%), Gaps = 1/215 (0%)
Frame = +1

Query: 13 LSDLALECYEQMKEEGISPDAVTFACSLKAC-GNAGAVDEGQEIHNEIMQRGLGKDHFVG 189
L D A++ Y ++ E F L+AC G+ + G ++H I++ G+ D +
Sbjct: 80 LLDAAIDLYHRLVSETTQISKFVFPSVLRACAGSREHLSVGGKVHGRIIKGGVDDDAVIE 139

Query: 190 NSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVS 369
SL+ MY + G L A++ F + +D+ +W+ L++ +E+ +AL +F M ++GV
Sbjct: 140 TSLLCMYGQTGNLSDAEKVFDGMPVRDLVAWSTLVSSCLENGEVVKALRMFKCMVDDGVE 199

Query: 370 LDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQV 549
DAV+ + ++ L + ++ ++ K F+ D ++ + L+ MY KCG L S+++
Sbjct: 200 PDAVTMISVVEGCAELGCLRIARSVHGQITRKMFDLDETLCNSLLTMYSKCGDLLSSERI 259

Query: 550 FDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
F+ + + V+W A++ Y + E AL F M
Sbjct: 260 FEKIAKKNAVSWTAMISSYNRGEFSEKALRSFSEM 294



Score = 102 bits (253), Expect = 2e-21
Identities = 54/214 (25%), Positives = 110/214 (51%), Gaps = 1/214 (0%)
Frame = +1

Query: 16 SDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH-FVGN 192
S+ AL + +M + GI P+ VT L +CG G + EG+ +H ++R L ++ +
Sbjct: 284 SEKALRSFSEMIKSGIEPNLVTLYSVLSSCGLIGLIREGKSVHGFAVRRELDPNYESLSL 343

Query: 193 SLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSL 372
+L+ +Y +CG L + + +++ +W +L++ + +AL LF +M + +
Sbjct: 344 ALVELYAECGKLSDCETVLRVVSDRNIVAWNSLISLYAHRGMVIQALGLFRQMVTQRIKP 403

Query: 373 DAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVF 552
DA + S+ A G+QI+ ++ ++ V + L++MY K G + + VF
Sbjct: 404 DAFTLASSISACENAGLVPLGKQIHGHVIRTDVSDEF-VQNSLIDMYSKSGSVDSASTVF 462

Query: 553 DTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ + ++VV WN+++ G+ ++G A+ F M
Sbjct: 463 NQIKHRSVVTWNSMLCGFSQNGNSVEAISLFDYM 496



Score = 91.3 bits (225), Expect = 4e-18
Identities = 51/204 (25%), Positives = 108/204 (52%), Gaps = 3/204 (1%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
+++G S A+ ++ M + + VTF ++AC + G++++G+ +H++++ GL KD
Sbjct: 481 SQNGNSVEAISLFDYMYHSYLEMNEVTFLAVIQACSSIGSLEKGKWVHHKLIISGL-KDL 539

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
F +LI MY KCG L A+ F + ++ + SW++++ + H R A+ F++M
Sbjct: 540 FTDTALIDMYAKCGDLNAAETVFRAMSSRSIVSWSSMINAYGMHGRIGSAISTFNQMVES 599

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
G + V F+ L A G + ++G+ ++ + G + +C +++ + G L ++
Sbjct: 600 GTKPNEVVFMNVLSACGHSGSVEEGKYYFNLMKSFGVSPNSEHFACFIDLLSRSGDLKEA 659

Query: 541 QQVFDTLP---DQTVVAWNALMGG 603
+ +P D +V W +L+ G
Sbjct: 660 YRTIKEMPFLADASV--WGSLVNG 681


>sp|Q9LR69|PPR8_ARATH Pentatricopeptide repeat-containing protein
At1g03540 OS=Arabidopsis thaliana GN=PCMP-E4 PE=2 SV=1
Length = 609

Score = 138 bits (347), Expect = 3e-32
Identities = 67/206 (32%), Positives = 119/206 (57%)
Frame = +1

Query: 37 YEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYMYTK 216
Y + +G+ PD TF L ACGN + +G+EIH +++ G+G + V +SL+ MY K
Sbjct: 253 YAMHRGKGLVPDGSTFGTVLTACGNLRRLKQGKEIHGKLITNGIGSNVVVESSLLDMYGK 312

Query: 217 CGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVCS 396
CG + +A++ F + K+ SW+AL+ G+ ++ +A+E+F +M + D F
Sbjct: 313 CGSVREARQVFNGMSKKNSVSWSALLGGYCQNGEHEKAIEIFREMEEK----DLYCFGTV 368

Query: 397 LKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTV 576
LKA GL A + G++I+ + V +G G+ V S L+++YGK G + + +V+ + + +
Sbjct: 369 LKACAGLAAVRLGKEIHGQYVRRGCFGNVIVESALIDLYGKSGCIDSASRVYSKMSIRNM 428

Query: 577 VAWNALMGGYVEHGYGEVALDCFQRM 654
+ WNA++ ++G GE A+ F M
Sbjct: 429 ITWNAMLSALAQNGRGEEAVSFFNDM 454



Score = 136 bits (343), Expect = 8e-32
Identities = 71/211 (33%), Positives = 122/211 (57%), Gaps = 1/211 (0%)
Frame = +1

Query: 25 ALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIY 204
ALE + +M G+ + T + ++KAC G V G+ H ++ G +HF+ ++L Y
Sbjct: 147 ALEVFVEMVSFGLDANEFTLSSAVKACSELGEVRLGRCFHGVVITHGFEWNHFISSTLAY 206

Query: 205 MYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMH-NEGVSLDAV 381
+Y + A+ F + DV WTA+++ F ++ + EAL LF MH +G+ D
Sbjct: 207 LYGVNREPVDARRVFDEMPEPDVICWTAVLSAFSKNDLYEEALGLFYAMHRGKGLVPDGS 266

Query: 382 SFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTL 561
+F L A G LR K+G++I+ +L+ G + V S L++MYGKCG + +++QVF+ +
Sbjct: 267 TFGTVLTACGNLRRLKQGKEIHGKLITNGIGSNVVVESSLLDMYGKCGSVREARQVFNGM 326

Query: 562 PDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ V+W+AL+GGY ++G E A++ F+ M
Sbjct: 327 SKKNSVSWSALLGGYCQNGEHEKAIEIFREM 357



Score = 98.2 bits (243), Expect = 3e-20
Identities = 55/192 (28%), Positives = 99/192 (51%), Gaps = 1/192 (0%)
Frame = +1

Query: 82 FACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYMYTKCGL-LLKAQEAFYNI 258
+A L+ C + G + H +++ GL D VGNSL+ +Y K G + + + F
Sbjct: 64 YASLLQTCNKVFSFIHGIQFHAHVVKSGLETDRNVGNSLLSLYFKLGPGMRETRRVFDGR 123

Query: 259 QTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVCSLKASGGLRAAKKGE 438
KD SWT++M+G+V +ALE+F +M + G+ + + ++KA L + G
Sbjct: 124 FVKDAISWTSMMSGYVTGKEHVKALEVFVEMVSFGLDANEFTLSSAVKACSELGEVRLGR 183

Query: 439 QIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTVVAWNALMGGYVEHG 618
+ ++ GFE ++ + S L +YG D+++VFD +P+ V+ W A++ + ++
Sbjct: 184 CFHGVVITHGFEWNHFISSTLAYLYGVNREPVDARRVFDEMPEPDVICWTAVLSAFSKND 243

Query: 619 YGEVALDCFQRM 654
E AL F M
Sbjct: 244 LYEEALGLFYAM 255



Score = 90.1 bits (222), Expect = 9e-18
Identities = 53/202 (26%), Positives = 103/202 (50%), Gaps = 3/202 (1%)
Frame = +1

Query: 4 EHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHF 183
++G + A+E + +M+E+ D F LKAC AV G+EIH + ++RG +
Sbjct: 343 QNGEHEKAIEIFREMEEK----DLYCFGTVLKACAGLAAVRLGKEIHGQYVRRGCFGNVI 398

Query: 184 VGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEG 363
V ++LI +Y K G + A + + +++ +W A+++ ++ R EA+ F+ M +G
Sbjct: 399 VESALIDLYGKSGCIDSASRVYSKMSIRNMITWNAMLSALAQNGRGEEAVSFFNDMVKKG 458

Query: 364 VSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMK--GFEGDYSVGSCLVEMYGKCGLLAD 537
+ D +SF+ L A G +G Y L+ K G + SC++++ G+ GL +
Sbjct: 459 IKPDYISFIAILTACGHTGMVDEGRN-YFVLMAKSYGIKPGTEHYSCMIDLLGRAGLFEE 517

Query: 538 SQQVFDTLPDQTVVA-WNALMG 600
++ + + + + W L+G
Sbjct: 518 AENLLERAECRNDASLWGVLLG 539



Score = 46.2 bits (108), Expect = 2e-04
Identities = 28/104 (26%), Positives = 55/104 (52%), Gaps = 4/104 (3%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGL---- 168
A++G + A+ + M ++GI PD ++F L ACG+ G VDEG+ + +M +
Sbjct: 439 AQNGRGEEAVSFFNDMVKKGIKPDYISFIAILTACGHTGMVDEGRN-YFVLMAKSYGIKP 497

Query: 169 GKDHFVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTG 300
G +H+ + +I + + GL +A+ + ++ AS ++ G
Sbjct: 498 GTEHY--SCMIDLLGRAGLFEEAENLLERAECRNDASLWGVLLG 539


>sp|P0C898|PP232_ARATH Putative pentatricopeptide repeat-containing
protein At3g15130 OS=Arabidopsis thaliana GN=PCMP-H86
PE=3 SV=1
Length = 689

Score = 137 bits (345), Expect = 5e-32
Identities = 70/187 (37%), Positives = 113/187 (60%)
Frame = +1

Query: 94 LKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYMYTKCGLLLKAQEAFYNIQTKDV 273
L+ C G D+G ++H +++ G G + N LI MY KC L A + F ++ ++V
Sbjct: 13 LRVCTRKGLSDQGGQVHCYLLKSGSGLNLITSNYLIDMYCKCREPLMAYKVFDSMPERNV 72

Query: 274 ASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVCSLKASGGLRAAKKGEQIYSE 453
SW+ALM+G V + + +L LF +M +G+ + +F +LKA G L A +KG QI+
Sbjct: 73 VSWSALMSGHVLNGDLKGSLSLFSEMGRQGIYPNEFTFSTNLKACGLLNALEKGLQIHGF 132

Query: 454 LVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTVVAWNALMGGYVEHGYGEVA 633
+ GFE VG+ LV+MY KCG + ++++VF + D+++++WNA++ G+V GYG A
Sbjct: 133 CLKIGFEMMVEVGNSLVDMYSKCGRINEAEKVFRRIVDRSLISWNAMIAGFVHAGYGSKA 192

Query: 634 LDCFQRM 654
LD F M
Sbjct: 193 LDTFGMM 199



Score = 127 bits (319), Expect = 5e-29
Identities = 69/214 (32%), Positives = 118/214 (55%), Gaps = 4/214 (1%)
Frame = +1

Query: 25 ALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIY 204
+L + +M +GI P+ TF+ +LKACG A+++G +IH ++ G VGNSL+
Sbjct: 91 SLSLFSEMGRQGIYPNEFTFSTNLKACGLLNALEKGLQIHGFCLKIGFEMMVEVGNSLVD 150

Query: 205 MYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVS--LDA 378
MY+KCG + +A++ F I + + SW A++ GFV +AL+ F M + D
Sbjct: 151 MYSKCGRINEAEKVFRRIVDRSLISWNAMIAGFVHAGYGSKALDTFGMMQEANIKERPDE 210

Query: 379 VSFVCSLKASGGLRAAKKGEQIYSELVMKGFE--GDYSVGSCLVEMYGKCGLLADSQQVF 552
+ LKA G+QI+ LV GF ++ LV++Y KCG L +++ F
Sbjct: 211 FTLTSLLKACSSTGMIYAGKQIHGFLVRSGFHCPSSATITGSLVDLYVKCGYLFSARKAF 270

Query: 553 DTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
D + ++T+++W++L+ GY + G A+ F+R+
Sbjct: 271 DQIKEKTMISWSSLILGYAQEGEFVEAMGLFKRL 304



Score = 112 bits (281), Expect = 1e-24
Identities = 62/219 (28%), Positives = 115/219 (52%), Gaps = 4/219 (1%)
Frame = +1

Query: 10 GLSDLALECYEQMKEEGIS--PDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLG--KD 177
G AL+ + M+E I PD T LKAC + G + G++IH +++ G
Sbjct: 187 GYGSKALDTFGMMQEANIKERPDEFTLTSLLKACSSTGMIYAGKQIHGFLVRSGFHCPSS 246

Query: 178 HFVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHN 357
+ SL+ +Y KCG L A++AF I+ K + SW++L+ G+ + F EA+ LF ++
Sbjct: 247 ATITGSLVDLYVKCGYLFSARKAFDQIKEKTMISWSSLILGYAQEGEFVEAMGLFKRLQE 306

Query: 358 EGVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLAD 537
+D+ + + ++G+Q+ + V + SV + +V+MY KCGL+ +
Sbjct: 307 LNSQIDSFALSSIIGVFADFALLRQGKQMQALAVKLPSGLETSVLNSVVDMYLKCGLVDE 366

Query: 538 SQQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+++ F + + V++W ++ GY +HG G+ ++ F M
Sbjct: 367 AEKCFAEMQLKDVISWTVVITGYGKHGLGKKSVRIFYEM 405



Score = 91.3 bits (225), Expect = 4e-18
Identities = 53/208 (25%), Positives = 110/208 (52%), Gaps = 2/208 (0%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+ G A+ +++++E D+ + + + + +G+++ ++ G +
Sbjct: 289 AQEGEFVEAMGLFKRLQELNSQIDSFALSSIIGVFADFALLRQGKQMQALAVKLPSGLET 348

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
V NS++ MY KCGL+ +A++ F +Q KDV SWT ++TG+ +H ++++ +F +M
Sbjct: 349 SVLNSVVDMYLKCGLVDEAEKCFAEMQLKDVISWTVVITGYGKHGLGKKSVRIFYEMLRH 408

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELV-MKGFEGDYSVGSCLVEMYGKCGLLAD 537
+ D V ++ L A K+GE+++S+L+ G + +C+V++ G+ G L +
Sbjct: 409 NIEPDEVCYLAVLSACSHSGMIKEGEELFSKLLETHGIKPRVEHYACVVDLLGRAGRLKE 468

Query: 538 SQQVFDTLP-DQTVVAWNALMGGYVEHG 618
++ + DT+P V W L+ HG
Sbjct: 469 AKHLIDTMPIKPNVGIWQTLLSLCRVHG 496


tr_hit_id Q5W964
Definition tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens
Align length 217
Score (bit) 174.0
E-value 4.0e-42
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960105|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_I03, 5'
(656 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens PE=2 SV=1 174 4e-42
tr|A9TNX6|A9TNX6_PHYPA Predicted protein OS=Physcomitrella paten... 174 4e-42
tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella paten... 166 2e-39
tr|A7PW61|A7PW61_VITVI Chromosome chr8 scaffold_34, whole genome... 162 2e-38
tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 ... 161 4e-38
tr|A7PAH3|A7PAH3_VITVI Chromosome chr14 scaffold_9, whole genome... 160 8e-38
tr|A5B3U0|A5B3U0_VITVI Putative uncharacterized protein OS=Vitis... 159 1e-37
tr|A9RJW2|A9RJW2_PHYPA Predicted protein OS=Physcomitrella paten... 157 7e-37
tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea... 156 1e-36
tr|A9T5P5|A9T5P5_PHYPA Predicted protein OS=Physcomitrella paten... 156 1e-36
tr|A9S537|A9S537_PHYPA Predicted protein OS=Physcomitrella paten... 155 2e-36
tr|A7NVQ9|A7NVQ9_VITVI Chromosome chr18 scaffold_1, whole genome... 154 5e-36
tr|A5AJZ0|A5AJZ0_VITVI Putative uncharacterized protein OS=Vitis... 154 5e-36
tr|Q5W965|Q5W965_PHYPA PPR868-14 OS=Physcomitrella patens PE=2 SV=1 154 6e-36
tr|A9SDQ1|A9SDQ1_PHYPA Predicted protein OS=Physcomitrella paten... 154 6e-36
tr|A7QDH6|A7QDH6_VITVI Chromosome chr10 scaffold_81, whole genom... 152 1e-35
tr|Q94E87|Q94E87_ORYSJ PPR-repeat protein-like (Putative unchara... 152 2e-35
tr|A2WQ53|A2WQ53_ORYSI Putative uncharacterized protein OS=Oryza... 152 2e-35
tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella paten... 152 2e-35
tr|A9SQ58|A9SQ58_PHYPA Predicted protein OS=Physcomitrella paten... 152 2e-35
tr|A9TDA2|A9TDA2_PHYPA Predicted protein OS=Physcomitrella paten... 151 3e-35
tr|A9U2Q7|A9U2Q7_PHYPA Predicted protein OS=Physcomitrella paten... 151 4e-35
tr|A9T480|A9T480_PHYPA Predicted protein (Fragment) OS=Physcomit... 151 4e-35
tr|Q7F2F8|Q7F2F8_ORYSJ P0402A09.8 protein (P0455C04.2 protein) O... 150 5e-35
tr|Q655L5|Q655L5_ORYSJ Putative uncharacterized protein P0672D08... 150 5e-35
tr|B8ACR8|B8ACR8_ORYSI Putative uncharacterized protein OS=Oryza... 150 5e-35
tr|A2ZN87|A2ZN87_ORYSJ Putative uncharacterized protein OS=Oryza... 150 5e-35
tr|A7PUI0|A7PUI0_VITVI Chromosome chr7 scaffold_31, whole genome... 150 9e-35
tr|A5CA14|A5CA14_VITVI Putative uncharacterized protein OS=Vitis... 150 9e-35
tr|Q7XUF2|Q7XUF2_ORYSJ Os04g0488200 protein OS=Oryza sativa subs... 149 1e-34

>tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens PE=2 SV=1
Length = 986

Score = 174 bits (441), Expect = 4e-42
Identities = 81/217 (37%), Positives = 137/217 (63%)
Frame = +1

Query: 4 EHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHF 183
+HGL + A + +EQM ++ + PD TF L AC +A VD+G+E++N I++ G D F
Sbjct: 188 QHGLYEEAFKLHEQMVQDSVKPDKRTFVSMLNACADARNVDKGRELYNLILKAGWDTDLF 247

Query: 184 VGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEG 363
VG +LI M+ KCG + A + F N+ T+D+ +WT+++TG H RF++A LF +M EG
Sbjct: 248 VGTALINMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARHGRFKQACNLFQRMEEEG 307

Query: 364 VSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQ 543
V D V+FV L+A A ++G+++++ + G++ + VG+ ++ MY KCG + D+
Sbjct: 308 VQPDKVAFVSLLRACNHPEALEQGKKVHARMKEVGWDTEIYVGTAILSMYTKCGSMEDAL 367

Query: 544 QVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+VFD + + VV+W A++ G+ +HG + A F +M
Sbjct: 368 EVFDLVKGRNVVSWTAMIAGFAQHGRIDEAFLFFNKM 404



Score = 168 bits (426), Expect = 2e-40
Identities = 81/218 (37%), Positives = 130/218 (59%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A HG A +++M+EEG+ PD V F L+AC + A+++G+++H + + G +
Sbjct: 288 ARHGRFKQACNLFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGKKVHARMKEVGWDTEI 347

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
+VG +++ MYTKCG + A E F ++ ++V SWTA++ GF +H R EA F+KM
Sbjct: 348 YVGTAILSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQHGRIDEAFLFFNKMIES 407

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
G+ + V+F+ L A A K+G+QI ++ G+ D V + L+ MY KCG L D+
Sbjct: 408 GIEPNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSDDRVRTALLSMYAKCGSLKDA 467

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+VF+ + Q VVAWNA++ YV+H + AL FQ +
Sbjct: 468 HRVFEKISKQNVVAWNAMITAYVQHEQYDNALATFQAL 505



Score = 154 bits (388), Expect = 6e-36
Identities = 72/217 (33%), Positives = 125/217 (57%)
Frame = +1

Query: 4 EHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHF 183
+H D AL ++ + +EGI P++ TF L C ++ +++ G+ +H IM+ GL D
Sbjct: 491 QHEQYDNALATFQALLKEGIKPNSSTFTSILNVCKSSDSLELGKWVHFLIMKAGLESDLH 550

Query: 184 VGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEG 363
V N+L+ M+ CG L+ A+ F ++ +D+ SW ++ GFV+H + + A + F M G
Sbjct: 551 VSNALVSMFVNCGDLMSAKNLFNDMPKRDLVSWNTIIAGFVQHGKNQVAFDYFKMMQESG 610

Query: 364 VSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQ 543
+ D ++F L A A +G ++++ + F+ D VG+ L+ MY KCG + D+
Sbjct: 611 IKPDKITFTGLLNACASPEALTEGRRLHALITEAAFDCDVLVGTGLISMYTKCGSIEDAH 670

Query: 544 QVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
QVF LP + V +W +++ GY +HG G+ AL+ F +M
Sbjct: 671 QVFHKLPKKNVYSWTSMIAGYAQHGRGKEALELFYQM 707



Score = 150 bits (380), Expect = 5e-35
Identities = 73/218 (33%), Positives = 122/218 (55%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+HG D A + +M E GI P+ VTF L AC + A+ GQ+I + I++ G G D
Sbjct: 389 AQHGRIDEAFLFFNKMIESGIEPNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSDD 448

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
V +L+ MY KCG L A F I ++V +W A++T +V+H ++ AL F + E
Sbjct: 449 RVRTALLSMYAKCGSLKDAHRVFEKISKQNVVAWNAMITAYVQHEQYDNALATFQALLKE 508

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
G+ ++ +F L + + G+ ++ ++ G E D V + LV M+ CG L +
Sbjct: 509 GIKPNSSTFTSILNVCKSSDSLELGKWVHFLIMKAGLESDLHVSNALVSMFVNCGDLMSA 568

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ +F+ +P + +V+WN ++ G+V+HG +VA D F+ M
Sbjct: 569 KNLFNDMPKRDLVSWNTIIAGFVQHGKNQVAFDYFKMM 606



Score = 142 bits (358), Expect = 2e-32
Identities = 71/210 (33%), Positives = 121/210 (57%)
Frame = +1

Query: 25 ALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIY 204
A++ E++ I T++ L+ C + +G+ I+N I + G+ D F+ N+LI
Sbjct: 94 AMQVLERVDSSHIQIYRQTYSALLQLCIKFKNLGDGERIYNHIKKSGVQPDIFMRNTLIN 153

Query: 205 MYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVS 384
MY KCG + A++ F +++ KDV SW L+ G+V+H + EA +L ++M + V D +
Sbjct: 154 MYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGLYEEAFKLHEQMVQDSVKPDKRT 213

Query: 385 FVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLP 564
FV L A R KG ++Y+ ++ G++ D VG+ L+ M+ KCG + D+ +VFD LP
Sbjct: 214 FVSMLNACADARNVDKGRELYNLILKAGWDTDLFVGTALINMHIKCGDIGDATKVFDNLP 273

Query: 565 DQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ +V W +++ G HG + A + FQRM
Sbjct: 274 TRDLVTWTSMITGLARHGRFKQACNLFQRM 303



Score = 134 bits (337), Expect = 5e-30
Identities = 74/219 (33%), Positives = 118/219 (53%), Gaps = 3/219 (1%)
Frame = +1

Query: 4 EHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHF 183
+HG + +A + ++ M+E GI PD +TF L AC + A+ EG+ +H I + D
Sbjct: 592 QHGKNQVAFDYFKMMQESGIKPDKITFTGLLNACASPEALTEGRRLHALITEAAFDCDVL 651

Query: 184 VGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEG 363
VG LI MYTKCG + A + F+ + K+V SWT+++ G+ +H R +EALELF +M EG
Sbjct: 652 VGTGLISMYTKCGSIEDAHQVFHKLPKKNVYSWTSMIAGYAQHGRGKEALELFYQMQQEG 711

Query: 364 VSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQ 543
V D ++FV +L A ++G + + E C+V+++G+ GLL ++
Sbjct: 712 VKPDWITFVGALSACAHAGLIEEGLHHFQSMKEFNIEPRMEHYGCMVDLFGRAGLLNEAV 771

Query: 544 QVFDTL---PDQTVVAWNALMGGYVEHGYGEVALDCFQR 651
+ + PD V W AL+G H E+A Q+
Sbjct: 772 EFIIKMQVEPDSRV--WGALLGACQVHLNVELAEKAAQK 808



Score = 75.9 bits (185), Expect = 2e-12
Identities = 35/130 (26%), Positives = 70/130 (53%)
Frame = +1

Query: 265 KDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVCSLKASGGLRAAKKGEQI 444
KD A++ + +F EA+++ +++ + + + ++ L+ + GE+I
Sbjct: 73 KDTQKANAVLNRLSKAGQFNEAMQVLERVDSSHIQIYRQTYSALLQLCIKFKNLGDGERI 132

Query: 445 YSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTVVAWNALMGGYVEHGYG 624
Y+ + G + D + + L+ MY KCG ++Q+FD + ++ V +WN L+GGYV+HG
Sbjct: 133 YNHIKKSGVQPDIFMRNTLINMYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGLY 192

Query: 625 EVALDCFQRM 654
E A ++M
Sbjct: 193 EEAFKLHEQM 202



Score = 58.5 bits (140), Expect = 3e-07
Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 1/126 (0%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+HG ALE + QM++EG+ PD +TF +L AC +AG ++EG + + +
Sbjct: 692 AQHGRGKEALELFYQMQQEGVKPDWITFVGALSACAHAGLIEEGLHHFQSMKEFNIEPRM 751

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTK-DVASWTALMTGFVEHSRFREALELFDKMHN 357
++ ++ + GLL +A E +Q + D W AL+ H +EL +K
Sbjct: 752 EHYGCMVDLFGRAGLLNEAVEFIIKMQVEPDSRVWGALLGACQVHLN----VELAEKAAQ 807

Query: 358 EGVSLD 375
+ + LD
Sbjct: 808 KKLELD 813


>tr|A9TNX6|A9TNX6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_224041 PE=4 SV=1
Length = 986

Score = 174 bits (441), Expect = 4e-42
Identities = 81/217 (37%), Positives = 137/217 (63%)
Frame = +1

Query: 4 EHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHF 183
+HGL + A + +EQM ++ + PD TF L AC +A VD+G+E++N I++ G D F
Sbjct: 188 QHGLYEEAFKLHEQMVQDSVKPDKRTFVSMLNACADARNVDKGRELYNLILKAGWDTDLF 247

Query: 184 VGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEG 363
VG +LI M+ KCG + A + F N+ T+D+ +WT+++TG H RF++A LF +M EG
Sbjct: 248 VGTALINMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARHGRFKQACNLFQRMEEEG 307

Query: 364 VSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQ 543
V D V+FV L+A A ++G+++++ + G++ + VG+ ++ MY KCG + D+
Sbjct: 308 VQPDKVAFVSLLRACNHPEALEQGKKVHARMKEVGWDTEIYVGTAILSMYTKCGSMEDAL 367

Query: 544 QVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+VFD + + VV+W A++ G+ +HG + A F +M
Sbjct: 368 EVFDLVKGRNVVSWTAMIAGFAQHGRIDEAFLFFNKM 404



Score = 168 bits (426), Expect = 2e-40
Identities = 81/218 (37%), Positives = 130/218 (59%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A HG A +++M+EEG+ PD V F L+AC + A+++G+++H + + G +
Sbjct: 288 ARHGRFKQACNLFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGKKVHARMKEVGWDTEI 347

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
+VG +++ MYTKCG + A E F ++ ++V SWTA++ GF +H R EA F+KM
Sbjct: 348 YVGTAILSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQHGRIDEAFLFFNKMIES 407

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
G+ + V+F+ L A A K+G+QI ++ G+ D V + L+ MY KCG L D+
Sbjct: 408 GIEPNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSDDRVRTALLSMYAKCGSLKDA 467

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+VF+ + Q VVAWNA++ YV+H + AL FQ +
Sbjct: 468 HRVFEKISKQNVVAWNAMITAYVQHEQYDNALATFQAL 505



Score = 153 bits (386), Expect = 1e-35
Identities = 72/217 (33%), Positives = 125/217 (57%)
Frame = +1

Query: 4 EHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHF 183
+H D AL ++ + +EGI P++ TF L C ++ +++ G+ +H IM+ GL D
Sbjct: 491 QHEQYDNALATFQALLKEGIKPNSSTFTSILNVCKSSDSLELGKWVHFLIMKAGLESDLH 550

Query: 184 VGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEG 363
V N+L+ M+ CG L+ A+ F ++ +D+ SW ++ GFV+H + + A + F M G
Sbjct: 551 VSNALVSMFVNCGDLMSAKNLFNDMPKRDLVSWNTIIAGFVQHGKNQVAFDYFKMMQESG 610

Query: 364 VSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQ 543
+ D ++F L A A +G ++++ + F+ D VG+ L+ MY KCG + D+
Sbjct: 611 IKPDKITFTGLLNACASPEALTEGRRLHALITEAAFDCDVLVGTGLISMYTKCGSIEDAH 670

Query: 544 QVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
QVF LP + V +W +++ GY +HG G+ AL+ F +M
Sbjct: 671 QVFHKLPKKNVYSWTSMITGYAQHGRGKEALELFYQM 707



Score = 150 bits (380), Expect = 5e-35
Identities = 73/218 (33%), Positives = 122/218 (55%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+HG D A + +M E GI P+ VTF L AC + A+ GQ+I + I++ G G D
Sbjct: 389 AQHGRIDEAFLFFNKMIESGIEPNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSDD 448

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
V +L+ MY KCG L A F I ++V +W A++T +V+H ++ AL F + E
Sbjct: 449 RVRTALLSMYAKCGSLKDAHRVFEKISKQNVVAWNAMITAYVQHEQYDNALATFQALLKE 508

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
G+ ++ +F L + + G+ ++ ++ G E D V + LV M+ CG L +
Sbjct: 509 GIKPNSSTFTSILNVCKSSDSLELGKWVHFLIMKAGLESDLHVSNALVSMFVNCGDLMSA 568

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ +F+ +P + +V+WN ++ G+V+HG +VA D F+ M
Sbjct: 569 KNLFNDMPKRDLVSWNTIIAGFVQHGKNQVAFDYFKMM 606



Score = 142 bits (358), Expect = 2e-32
Identities = 71/210 (33%), Positives = 121/210 (57%)
Frame = +1

Query: 25 ALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIY 204
A++ E++ I T++ L+ C + +G+ I+N I + G+ D F+ N+LI
Sbjct: 94 AMQVLERVDSSHIQIYRQTYSALLQLCIKFKNLGDGERIYNHIKKSGVQPDIFMWNTLIN 153

Query: 205 MYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVS 384
MY KCG + A++ F +++ KDV SW L+ G+V+H + EA +L ++M + V D +
Sbjct: 154 MYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGLYEEAFKLHEQMVQDSVKPDKRT 213

Query: 385 FVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLP 564
FV L A R KG ++Y+ ++ G++ D VG+ L+ M+ KCG + D+ +VFD LP
Sbjct: 214 FVSMLNACADARNVDKGRELYNLILKAGWDTDLFVGTALINMHIKCGDIGDATKVFDNLP 273

Query: 565 DQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ +V W +++ G HG + A + FQRM
Sbjct: 274 TRDLVTWTSMITGLARHGRFKQACNLFQRM 303



Score = 136 bits (342), Expect = 1e-30
Identities = 75/219 (34%), Positives = 119/219 (54%), Gaps = 3/219 (1%)
Frame = +1

Query: 4 EHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHF 183
+HG + +A + ++ M+E GI PD +TF L AC + A+ EG+ +H I + D
Sbjct: 592 QHGKNQVAFDYFKMMQESGIKPDKITFTGLLNACASPEALTEGRRLHALITEAAFDCDVL 651

Query: 184 VGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEG 363
VG LI MYTKCG + A + F+ + K+V SWT+++TG+ +H R +EALELF +M EG
Sbjct: 652 VGTGLISMYTKCGSIEDAHQVFHKLPKKNVYSWTSMITGYAQHGRGKEALELFYQMQQEG 711

Query: 364 VSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQ 543
V D ++FV +L A ++G + + E C+V+++G+ GLL ++
Sbjct: 712 VKPDWITFVGALSACAHAGLIEEGLHHFQSMKEFNIEPRMEHYGCMVDLFGRAGLLNEAV 771

Query: 544 QVFDTL---PDQTVVAWNALMGGYVEHGYGEVALDCFQR 651
+ + PD V W AL+G H E+A Q+
Sbjct: 772 EFIIKMQVEPDSRV--WGALLGACQVHLNVELAEKAAQK 808



Score = 75.9 bits (185), Expect = 2e-12
Identities = 35/130 (26%), Positives = 70/130 (53%)
Frame = +1

Query: 265 KDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVCSLKASGGLRAAKKGEQI 444
KD A++ + +F EA+++ +++ + + + ++ L+ + GE+I
Sbjct: 73 KDTQKANAVLNRLSKAGQFNEAMQVLERVDSSHIQIYRQTYSALLQLCIKFKNLGDGERI 132

Query: 445 YSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTVVAWNALMGGYVEHGYG 624
Y+ + G + D + + L+ MY KCG ++Q+FD + ++ V +WN L+GGYV+HG
Sbjct: 133 YNHIKKSGVQPDIFMWNTLINMYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGLY 192

Query: 625 EVALDCFQRM 654
E A ++M
Sbjct: 193 EEAFKLHEQM 202



Score = 58.5 bits (140), Expect = 3e-07
Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 1/126 (0%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+HG ALE + QM++EG+ PD +TF +L AC +AG ++EG + + +
Sbjct: 692 AQHGRGKEALELFYQMQQEGVKPDWITFVGALSACAHAGLIEEGLHHFQSMKEFNIEPRM 751

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTK-DVASWTALMTGFVEHSRFREALELFDKMHN 357
++ ++ + GLL +A E +Q + D W AL+ H +EL +K
Sbjct: 752 EHYGCMVDLFGRAGLLNEAVEFIIKMQVEPDSRVWGALLGACQVHLN----VELAEKAAQ 807

Query: 358 EGVSLD 375
+ + LD
Sbjct: 808 KKLELD 813


>tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192620 PE=4 SV=1
Length = 902

Score = 166 bits (419), Expect = 2e-39
Identities = 81/217 (37%), Positives = 130/217 (59%)
Frame = +1

Query: 4 EHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHF 183
++G + AL+ QM++ G++PD T L +C + GA++ G+EIH + MQ GL D
Sbjct: 103 QYGYIEKALKLLRQMQQHGLAPDRTTIMSFLSSCKSPGALEWGREIHFQAMQAGLLFDVK 162

Query: 184 VGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEG 363
V N ++ MY KCG + +A+E F ++ K V SWT + G+ + R A E+F KM EG
Sbjct: 163 VANCILNMYAKCGSIEEAREVFDKMEKKSVVSWTITIGGYADCGRSETAFEIFQKMEQEG 222

Query: 364 VSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQ 543
V + ++++ L A A K G+ ++S ++ G E D +VG+ LV+MY KCG D +
Sbjct: 223 VVPNRITYISVLNAFSSPAALKWGKAVHSRILNAGHESDTAVGTALVKMYAKCGSYKDCR 282

Query: 544 QVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
QVF+ L ++ ++AWN ++GG E GY E A + + +M
Sbjct: 283 QVFEKLVNRDLIAWNTMIGGLAEGGYWEEASEVYNQM 319



Score = 165 bits (418), Expect = 2e-39
Identities = 76/218 (34%), Positives = 134/218 (61%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+ G AL Y++M++ G+ P+ VT+ L AC + A++ G+ IH ++++ GL D
Sbjct: 405 AKSGFGAEALTVYQEMQQAGVEPNRVTYTSILNACSSPAALEWGRRIHQQVVEAGLATDA 464

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
VGN+L+ MY+ CG + A++ F + +D+ ++ A++ G+ H+ +EAL+LFD++ E
Sbjct: 465 HVGNTLVNMYSMCGSVKDARQVFDRMIQRDIVAYNAMIGGYAAHNLGKEALKLFDRLQEE 524

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
G+ D V+++ L A + + +I++ + GF D SVG+ LV Y KCG +D+
Sbjct: 525 GLKPDKVTYINMLNACANSGSLEWAREIHTLVRKGGFFSDTSVGNALVSTYAKCGSFSDA 584

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
VF+ + + V++WNA++GG +HG G+ AL F+RM
Sbjct: 585 SIVFEKMTKRNVISWNAIIGGSAQHGRGQDALQLFERM 622



Score = 158 bits (400), Expect = 2e-37
Identities = 82/218 (37%), Positives = 126/218 (57%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
AE G + A E Y QM+ EG+ P+ +T+ L AC N+ A+ G+EIH+ + + G D
Sbjct: 304 AEGGYWEEASEVYNQMQREGVMPNKITYVILLNACVNSAALHWGKEIHSRVAKAGFTSDI 363

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
V N+LI MY++CG + A+ F + KDV SWTA++ G + EAL ++ +M
Sbjct: 364 GVQNALISMYSRCGSIKDARLVFDKMVRKDVISWTAMIGGLAKSGFGAEALTVYQEMQQA 423

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
GV + V++ L A A + G +I+ ++V G D VG+ LV MY CG + D+
Sbjct: 424 GVEPNRVTYTSILNACSSPAALEWGRRIHQQVVEAGLATDAHVGNTLVNMYSMCGSVKDA 483

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+QVFD + + +VA+NA++GGY H G+ AL F R+
Sbjct: 484 RQVFDRMIQRDIVAYNAMIGGYAAHNLGKEALKLFDRL 521



Score = 147 bits (372), Expect = 4e-34
Identities = 69/218 (31%), Positives = 124/218 (56%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+ G S+ A E +++M++EG+ P+ +T+ L A + A+ G+ +H+ I+ G D
Sbjct: 203 ADCGRSETAFEIFQKMEQEGVVPNRITYISVLNAFSSPAALKWGKAVHSRILNAGHESDT 262

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
VG +L+ MY KCG ++ F + +D+ +W ++ G E + EA E++++M E
Sbjct: 263 AVGTALVKMYAKCGSYKDCRQVFEKLVNRDLIAWNTMIGGLAEGGYWEEASEVYNQMQRE 322

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
GV + +++V L A A G++I+S + GF D V + L+ MY +CG + D+
Sbjct: 323 GVMPNKITYVILLNACVNSAALHWGKEIHSRVAKAGFTSDIGVQNALISMYSRCGSIKDA 382

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ VFD + + V++W A++GG + G+G AL +Q M
Sbjct: 383 RLVFDKMVRKDVISWTAMIGGLAKSGFGAEALTVYQEM 420



Score = 128 bits (322), Expect = 3e-28
Identities = 71/218 (32%), Positives = 118/218 (54%), Gaps = 7/218 (3%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A H L AL+ +++++EEG+ PD VT+ L AC N+G+++ +EIH + + G D
Sbjct: 506 AAHNLGKEALKLFDRLQEEGLKPDKVTYINMLNACANSGSLEWAREIHTLVRKGGFFSDT 565

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
VGN+L+ Y KCG A F + ++V SW A++ G +H R ++AL+LF++M E
Sbjct: 566 SVGNALVSTYAKCGSFSDASIVFEKMTKRNVISWNAIIGGSAQHGRGQDALQLFERMKME 625

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSV------GSCLVEMYGKC 522
GV D V+FV L A ++G + + + D+++ C+V++ G+
Sbjct: 626 GVKPDIVTFVSLLSACSHAGLLEEGRRYFCSM-----SQDFAIIPTIEHYGCMVDLLGRA 680

Query: 523 GLLADSQQVFDTLPDQ-TVVAWNALMGGYVEHGYGEVA 633
G L +++ + T+P Q W AL+G HG VA
Sbjct: 681 GQLDEAEALIKTMPFQANTRIWGALLGACRIHGNVPVA 718



Score = 122 bits (306), Expect = 2e-26
Identities = 62/217 (28%), Positives = 122/217 (56%), Gaps = 5/217 (2%)
Frame = +1

Query: 19 DLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSL 198
D A++ + ++++G ++ + LK C + G+++H I+Q D + N+L
Sbjct: 5 DGAVDVVQYLQQQGAQVNSSDYMKMLKRCIEVKDLVAGRQVHQHIIQHRTVPDQYTVNAL 64

Query: 199 IYMYTKCGLLLKAQEAFYNIQ--TKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSL 372
I MY +CG + +A++ + + + V SW A++ G++++ +AL+L +M G++
Sbjct: 65 INMYIQCGSIEEARQVWKKLSYMERTVHSWNAMVVGYIQYGYIEKALKLLRQMQQHGLAP 124

Query: 373 DA---VSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQ 543
D +SF+ S K+ G L + G +I+ + + G D V +C++ MY KCG + +++
Sbjct: 125 DRTTIMSFLSSCKSPGAL---EWGREIHFQAMQAGLLFDVKVANCILNMYAKCGSIEEAR 181

Query: 544 QVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+VFD + ++VV+W +GGY + G E A + FQ+M
Sbjct: 182 EVFDKMEKKSVVSWTITIGGYADCGRSETAFEIFQKM 218


>tr|A7PW61|A7PW61_VITVI Chromosome chr8 scaffold_34, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00025485001
PE=4 SV=1
Length = 989

Score = 162 bits (409), Expect = 2e-38
Identities = 72/217 (33%), Positives = 131/217 (60%)
Frame = +1

Query: 4 EHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHF 183
+H L AL+ +++M+ +GI D + F+ ++ AC A+++GQ+IH + G +D
Sbjct: 493 QHDLFAEALKLFQEMENQGIRSDNIGFSSAISACAGIQALNQGQQIHAQSYISGYSEDLS 552

Query: 184 VGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEG 363
+GN+L+ +Y +CG A AF I KD SW AL++GF + EAL++F +M+ G
Sbjct: 553 IGNALVSLYARCGRAQDAYLAFEKIDAKDNISWNALISGFAQSGHCEEALQVFSQMNQAG 612

Query: 364 VSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQ 543
V + +F ++ A+ K+G+QI++ ++ G++ + + L+ +Y KCG + D++
Sbjct: 613 VEANLFTFGSAVSATANTANIKQGKQIHAMMIKTGYDSETEASNVLITLYSKCGSIEDAK 672

Query: 544 QVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ F +P++ VV+WNA++ GY +HGYG A+ F+ M
Sbjct: 673 REFFEMPEKNVVSWNAMITGYSQHGYGSEAVSLFEEM 709



Score = 156 bits (394), Expect = 1e-36
Identities = 71/204 (34%), Positives = 126/204 (61%)
Frame = +1

Query: 43 QMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYMYTKCG 222
QM+ EG+ P+ T+ L+ C + GA+D G++IH ++++ G + +V + LI MY K G
Sbjct: 405 QMQIEGLMPNQYTYPSILRTCTSLGALDLGEQIHTQVIKSGFQFNVYVCSVLIDMYAKHG 464

Query: 223 LLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVCSLK 402
L A+ ++ +DV SWTA++ G+ +H F EAL+LF +M N+G+ D + F ++
Sbjct: 465 ELDTARGILQRLREEDVVSWTAMIAGYTQHDLFAEALKLFQEMENQGIRSDNIGFSSAIS 524

Query: 403 ASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTVVA 582
A G++A +G+QI+++ + G+ D S+G+ LV +Y +CG D+ F+ + + ++
Sbjct: 525 ACAGIQALNQGQQIHAQSYISGYSEDLSIGNALVSLYARCGRAQDAYLAFEKIDAKDNIS 584

Query: 583 WNALMGGYVEHGYGEVALDCFQRM 654
WNAL+ G+ + G+ E AL F +M
Sbjct: 585 WNALISGFAQSGHCEEALQVFSQM 608



Score = 133 bits (335), Expect = 8e-30
Identities = 68/218 (31%), Positives = 122/218 (55%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+ G SD AL+ +E+M+ + + PD VT A L AC + GA +G+++H+ +++ G+ D
Sbjct: 290 AQRGFSDRALQLFEKMQLDCMKPDCVTVASLLSACASVGAGYKGKQLHSYVIKMGMSSDL 349

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
+ SL+ +Y KC + A E F +T++V W ++ + + E+ +F +M E
Sbjct: 350 IIEGSLLDLYVKCFDIETAHEYFLTTETENVVLWNVMLVAYGQLGNLSESYWIFLQMQIE 409

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
G+ + ++ L+ L A GEQI+++++ GF+ + V S L++MY K G L +
Sbjct: 410 GLMPNQYTYPSILRTCTSLGALDLGEQIHTQVIKSGFQFNVYVCSVLIDMYAKHGELDTA 469

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ + L ++ VV+W A++ GY +H AL FQ M
Sbjct: 470 RGILQRLREEDVVSWTAMIAGYTQHDLFAEALKLFQEM 507



Score = 111 bits (277), Expect = 4e-23
Identities = 66/215 (30%), Positives = 110/215 (51%), Gaps = 1/215 (0%)
Frame = +1

Query: 13 LSDLALECYEQMKEEGISPDAVTFACSLKAC-GNAGAVDEGQEIHNEIMQRGLGKDHFVG 189
L+ L + M E ++PD TFA L+AC G ++IH +I+ G G V
Sbjct: 91 LASQVLGLFSLMITENVTPDESTFASVLRACSGGKAPFQVTEQIHAKIIHHGFGSSPLVC 150

Query: 190 NSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVS 369
N LI +Y+K G + A+ F + KD SW A+++G ++ R EA+ LF +MH V
Sbjct: 151 NPLIDLYSKNGHVDLAKLVFERLFLKDSVSWVAMISGLSQNGREDEAILLFCQMHKSAVI 210

Query: 370 LDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQV 549
F L A + K GEQ++ +V G + V + LV +Y + G L ++Q+
Sbjct: 211 PTPYVFSSVLSACTKIELFKLGEQLHGFIVKWGLSSETFVCNALVTLYSRWGNLIAAEQI 270

Query: 550 FDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
F + + +++N+L+ G + G+ + AL F++M
Sbjct: 271 FSKMHRRDRISYNSLISGLAQRGFSDRALQLFEKM 305



Score = 108 bits (270), Expect = 3e-22
Identities = 57/206 (27%), Positives = 108/206 (52%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
+++G D A+ + QM + + P F+ L AC G+++H I++ GL +
Sbjct: 189 SQNGREDEAILLFCQMHKSAVIPTPYVFSSVLSACTKIELFKLGEQLHGFIVKWGLSSET 248

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
FV N+L+ +Y++ G L+ A++ F + +D S+ +L++G + AL+LF+KM +
Sbjct: 249 FVCNALVTLYSRWGNLIAAEQIFSKMHRRDRISYNSLISGLAQRGFSDRALQLFEKMQLD 308

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
+ D V+ L A + A KG+Q++S ++ G D + L+++Y KC + +
Sbjct: 309 CMKPDCVTVASLLSACASVGAGYKGKQLHSYVIKMGMSSDLIIEGSLLDLYVKCFDIETA 368

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHG 618
+ F T + VV WN ++ Y + G
Sbjct: 369 HEYFLTTETENVVLWNVMLVAYGQLG 394



Score = 100 bits (249), Expect = 8e-20
Identities = 54/207 (26%), Positives = 105/207 (50%), Gaps = 2/207 (0%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+ G + AL+ + QM + G+ + TF ++ A N + +G++IH +++ G +
Sbjct: 593 AQSGHCEEALQVFSQMNQAGVEANLFTFGSAVSATANTANIKQGKQIHAMMIKTGYDSET 652

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
N LI +Y+KCG + A+ F+ + K+V SW A++TG+ +H EA+ LF++M
Sbjct: 653 EASNVLITLYSKCGSIEDAKREFFEMPEKNVVSWNAMITGYSQHGYGSEAVSLFEEMKQL 712

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMK-GFEGDYSVGSCLVEMYGKCGLLAD 537
G+ + V+FV L A + +G + + + G C+V++ G+ LL
Sbjct: 713 GLMPNHVTFVGVLSACSHVGLVNEGLSYFRSMSKEHGLVPKPEHYVCVVDLLGRAALLCC 772

Query: 538 SQQVFDTLP-DQTVVAWNALMGGYVEH 615
+++ + +P + + W L+ H
Sbjct: 773 AREFIEEMPIEPDAMIWRTLLSACTVH 799



Score = 43.1 bits (100), Expect = 0.015
Identities = 24/83 (28%), Positives = 43/83 (51%)
Frame = +1

Query: 406 SGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTVVAW 585
SG L AKK +++ + GF+G+ +GS L+++Y G + ++ ++FD +P V W
Sbjct: 23 SGSLLDAKK---LHARIFKSGFDGEDVLGSRLIDIYLAHGEVDNAIKLFDDIPSSNVSFW 79

Query: 586 NALMGGYVEHGYGEVALDCFQRM 654
N ++ G + L F M
Sbjct: 80 NKVISGLLAKKLASQVLGLFSLM 102


>tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 SV=2
Length = 1106

Score = 161 bits (407), Expect = 4e-38
Identities = 76/218 (34%), Positives = 131/218 (60%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+HG + A + +++M+ E + PD +TFA L C N A++ G++IH I + GL D
Sbjct: 508 AQHGSYETAYKLFQEMQNEELEPDNITFASVLSGCKNPEALELGKQIHGRITESGLQLDV 567

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
+GN+LI MY +CG L A+ F+++Q +DV SWTA++ G + +A+ELF +M NE
Sbjct: 568 NLGNALINMYIRCGSLQDARNVFHSLQHRDVMSWTAMIGGCADQGEDMKAIELFWQMQNE 627

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
G +F LK +G+++ + ++ G+E D VG+ L+ Y K G + D+
Sbjct: 628 GFRPVKSTFSSILKVCTSSACLDEGKKVIAYILNSGYELDTGVGNALISAYSKSGSMTDA 687

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
++VFD +P + +V+WN ++ GY ++G G+ A++ +M
Sbjct: 688 REVFDKMPSRDIVSWNKIIAGYAQNGLGQTAVEFAYQM 725



Score = 156 bits (394), Expect = 1e-36
Identities = 72/210 (34%), Positives = 123/210 (58%)
Frame = +1

Query: 25 ALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIY 204
A+ Y+QM+ EG+ P VTF L AC N+ A +G+ IH +I++ G+ + + N+L+
Sbjct: 415 AMRLYKQMQSEGVKPGRVTFLHLLSACANSSAYADGKMIHEDILRSGIKSNGHLANALMN 474

Query: 205 MYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVS 384
MY +CG L++AQ F Q +DV SW +++ G +H + A +LF +M NE + D ++
Sbjct: 475 MYRRCGSLMEAQNVFEGTQARDVISWNSMIAGHAQHGSYETAYKLFQEMQNEELEPDNIT 534

Query: 385 FVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLP 564
F L A + G+QI+ + G + D ++G+ L+ MY +CG L D++ VF +L
Sbjct: 535 FASVLSGCKNPEALELGKQIHGRITESGLQLDVNLGNALINMYIRCGSLQDARNVFHSLQ 594

Query: 565 DQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ V++W A++GG + G A++ F +M
Sbjct: 595 HRDVMSWTAMIGGCADQGEDMKAIELFWQM 624



Score = 150 bits (380), Expect = 5e-35
Identities = 73/218 (33%), Positives = 126/218 (57%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+HG + A E Y +M+ +G++ + T+ L AC + A++ G+ IH+ I + G D
Sbjct: 306 AQHGHNVEAFEQYYRMRSDGVALNRTTYLSILNACSTSKALEAGKLIHSHISEDGHSSDV 365

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
+GN+LI MY +CG L KA+E FY + +D+ SW A++ G+ EA+ L+ +M +E
Sbjct: 366 QIGNALISMYARCGDLPKARELFYTMPKRDLISWNAIIAGYARREDRGEAMRLYKQMQSE 425

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
GV V+F+ L A A G+ I+ +++ G + + + + L+ MY +CG L ++
Sbjct: 426 GVKPGRVTFLHLLSACANSSAYADGKMIHEDILRSGIKSNGHLANALMNMYRRCGSLMEA 485

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
Q VF+ + V++WN+++ G+ +HG E A FQ M
Sbjct: 486 QNVFEGTQARDVISWNSMIAGHAQHGSYETAYKLFQEM 523



Score = 150 bits (380), Expect = 5e-35
Identities = 74/218 (33%), Positives = 125/218 (57%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+ G A+E + QM+ EG P TF+ LK C ++ +DEG+++ I+ G D
Sbjct: 609 ADQGEDMKAIELFWQMQNEGFRPVKSTFSSILKVCTSSACLDEGKKVIAYILNSGYELDT 668

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
VGN+LI Y+K G + A+E F + ++D+ SW ++ G+ ++ + A+E +M +
Sbjct: 669 GVGNALISAYSKSGSMTDAREVFDKMPSRDIVSWNKIIAGYAQNGLGQTAVEFAYQMQEQ 728

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
V + SFV L A A ++G+++++E+V + +GD VG+ L+ MY KCG ++
Sbjct: 729 DVVPNKFSFVSLLNACSSFSALEEGKRVHAEIVKRKLQGDVRVGAALISMYAKCGSQGEA 788

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
Q+VFD + ++ VV WNA++ Y +HG AL F M
Sbjct: 789 QEVFDNIIEKNVVTWNAMINAYAQHGLASKALGFFNCM 826



Score = 134 bits (338), Expect = 4e-30
Identities = 70/218 (32%), Positives = 123/218 (56%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+ G A + +E+M+ G P+ +T+ L AC + ++ G++IH++I++ G +D
Sbjct: 104 AQQGFKKKAFQLFEEMQNAGFIPNKITYISILTACYSPAELENGKKIHSQIIKAGYQRDP 163

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
V NSL+ MY KCG L +A++ F I +DV S+ ++ + + + +E L LF +M +E
Sbjct: 164 RVQNSLLSMYGKCGDLPRARQVFAGISPRDVVSYNTMLGLYAQKAYVKECLGLFGQMSSE 223

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
G+S D V+++ L A +G++I+ V +G D VG+ LV M +CG + +
Sbjct: 224 GISPDKVTYINLLDAFTTPSMLDEGKRIHKLTVEEGLNSDIRVGTALVTMCVRCGDVDSA 283

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+Q F D+ VV +NAL+ +HG+ A + + RM
Sbjct: 284 KQAFKGTADRDVVVYNALIAALAQHGHNVEAFEQYYRM 321



Score = 133 bits (334), Expect = 1e-29
Identities = 67/209 (32%), Positives = 116/209 (55%)
Frame = +1

Query: 28 LECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYM 207
L + QM EGISPD VT+ L A +DEG+ IH ++ GL D VG +L+ M
Sbjct: 214 LGLFGQMSSEGISPDKVTYINLLDAFTTPSMLDEGKRIHKLTVEEGLNSDIRVGTALVTM 273

Query: 208 YTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSF 387
+CG + A++AF +DV + AL+ +H EA E + +M ++GV+L+ ++
Sbjct: 274 CVRCGDVDSAKQAFKGTADRDVVVYNALIAALAQHGHNVEAFEQYYRMRSDGVALNRTTY 333

Query: 388 VCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPD 567
+ L A +A + G+ I+S + G D +G+ L+ MY +CG L ++++F T+P
Sbjct: 334 LSILNACSTSKALEAGKLIHSHISEDGHSSDVQIGNALISMYARCGDLPKARELFYTMPK 393

Query: 568 QTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ +++WNA++ GY A+ +++M
Sbjct: 394 RDLISWNAIIAGYARREDRGEAMRLYKQM 422



Score = 117 bits (294), Expect = 5e-25
Identities = 58/195 (29%), Positives = 110/195 (56%)
Frame = +1

Query: 70 DAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYMYTKCGLLLKAQEAF 249
+ T+ L+ C + E + IH ++++ +G D F+ N LI MY KC +L A + F
Sbjct: 26 ERATYVALLQNCTRKRLLPEAKRIHAQMVEAWVGPDIFLSNLLINMYVKCRSVLDAHQVF 85

Query: 250 YNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVCSLKASGGLRAAK 429
+ +DV SW +L++ + + ++A +LF++M N G + ++++ L A +
Sbjct: 86 KEMPRRDVISWNSLISCYAQQGFKKKAFQLFEEMQNAGFIPNKITYISILTACYSPAELE 145

Query: 430 KGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTVVAWNALMGGYV 609
G++I+S+++ G++ D V + L+ MYGKCG L ++QVF + + VV++N ++G Y
Sbjct: 146 NGKKIHSQIIKAGYQRDPRVQNSLLSMYGKCGDLPRARQVFAGISPRDVVSYNTMLGLYA 205

Query: 610 EHGYGEVALDCFQRM 654
+ Y + L F +M
Sbjct: 206 QKAYVKECLGLFGQM 220



Score = 117 bits (292), Expect = 8e-25
Identities = 69/213 (32%), Positives = 109/213 (51%), Gaps = 7/213 (3%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A++GL A+E QM+E+ + P+ +F L AC + A++EG+ +H EI++R L D
Sbjct: 710 AQNGLGQTAVEFAYQMQEQDVVPNKFSFVSLLNACSSFSALEEGKRVHAEIVKRKLQGDV 769

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
VG +LI MY KCG +AQE F NI K+V +W A++ + +H +AL F+ M E
Sbjct: 770 RVGAALISMYAKCGSQGEAQEVFDNIIEKNVVTWNAMINAYAQHGLASKALGFFNCMEKE 829

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSV------GSCLVEMYGKC 522
G+ D +F L A +G QI+S + E +Y V CLV + G+
Sbjct: 830 GIKPDGSTFTSILSACNHAGLVLEGYQIFSSM-----ESEYGVLPTIEHYGCLVGLLGRA 884

Query: 523 GLLADSQQVFDTLP-DQTVVAWNALMGGYVEHG 618
+++ + + +P W L+G HG
Sbjct: 885 RRFQEAETLINQMPFPPDAAVWETLLGACRIHG 917


>tr|A7PAH3|A7PAH3_VITVI Chromosome chr14 scaffold_9, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00038113001
PE=4 SV=1
Length = 778

Score = 160 bits (404), Expect = 8e-38
Identities = 80/217 (36%), Positives = 125/217 (57%)
Frame = +1

Query: 4 EHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHF 183
++G + L + M + G+ PD T+ LKAC A++ G EIHN I++ LG D F
Sbjct: 355 QNGNEEKTLSLFVWMLQSGMEPDEFTYGSVLKACAGWQALNCGMEIHNRIIKSRLGLDSF 414

Query: 184 VGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEG 363
VG +LI MY+KCG++ KA++ + + V SW A+++GF + EA + F KM G
Sbjct: 415 VGIALIDMYSKCGMMEKAEKLHDRLAEQTVVSWNAIISGFSLQKQSEEAQKTFSKMLEMG 474

Query: 364 VSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQ 543
V D ++ L L + G+QI+++++ K + D + S LV+MY KCG + D Q
Sbjct: 475 VDPDNFTYATILDTCANLVTVELGKQIHAQIIKKELQSDAYISSTLVDMYSKCGNMQDFQ 534

Query: 544 QVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+F+ P++ V WNA++ GY +HG GE AL F+ M
Sbjct: 535 LIFEKAPNRDFVTWNAMVCGYAQHGLGEEALKIFEYM 571



Score = 117 bits (292), Expect = 8e-25
Identities = 62/211 (29%), Positives = 114/211 (54%), Gaps = 2/211 (0%)
Frame = +1

Query: 28 LECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIH-NEIMQRGLGKDHF-VGNSLI 201
LE +++M++ G+ TFA ++C A+ G ++H + + + L + + V N+++
Sbjct: 260 LELFKEMQKAGVGVSQSTFASVFRSCAGLSALRLGSQLHVHGLSMKSLCQSNICVANAIL 319

Query: 202 YMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAV 381
MY KCG L++A F + ++D SW A++ ++ + L LF M G+ D
Sbjct: 320 DMYGKCGALVEACLVFEEMVSRDAVSWNAIIAAHEQNGNEEKTLSLFVWMLQSGMEPDEF 379

Query: 382 SFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTL 561
++ LKA G +A G +I++ ++ D VG L++MY KCG++ ++++ D L
Sbjct: 380 TYGSVLKACAGWQALNCGMEIHNRIIKSRLGLDSFVGIALIDMYSKCGMMEKAEKLHDRL 439

Query: 562 PDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+QTVV+WNA++ G+ E A F +M
Sbjct: 440 AEQTVVSWNAIISGFSLQKQSEEAQKTFSKM 470



Score = 113 bits (283), Expect = 9e-24
Identities = 64/208 (30%), Positives = 111/208 (53%), Gaps = 2/208 (0%)
Frame = +1

Query: 28 LECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYM 207
++ + QM G D TFA LK+C + G +IH ++ G D G++L+ M
Sbjct: 159 IDVFLQMGRMGTVFDRTTFAVVLKSCSSLEDHGGGIQIHGLAVKMGFDCDVVTGSALLDM 218

Query: 208 YTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSF 387
Y KC L + + F+++ K+ SW+A++ G V++ R LELF +M GV + +F
Sbjct: 219 YAKCKKLDCSIQFFHSMPEKNWVSWSAIIAGCVQNDDLRGGLELFKEMQKAGVGVSQSTF 278

Query: 388 VCSLKASGGLRAAKKGEQIYSE-LVMKGF-EGDYSVGSCLVEMYGKCGLLADSQQVFDTL 561
++ GL A + G Q++ L MK + + V + +++MYGKCG L ++ VF+ +
Sbjct: 279 ASVFRSCAGLSALRLGSQLHVHGLSMKSLCQSNICVANAILDMYGKCGALVEACLVFEEM 338

Query: 562 PDQTVVAWNALMGGYVEHGYGEVALDCF 645
+ V+WNA++ + ++G E L F
Sbjct: 339 VSRDAVSWNAIIAAHEQNGNEEKTLSLF 366



Score = 113 bits (283), Expect = 9e-24
Identities = 62/208 (29%), Positives = 112/208 (53%), Gaps = 2/208 (0%)
Frame = +1

Query: 16 SDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNS 195
S+ A + + +M E G+ PD T+A L C N V+ G++IH +I+++ L D ++ ++
Sbjct: 460 SEEAQKTFSKMLEMGVDPDNFTYATILDTCANLVTVELGKQIHAQIIKKELQSDAYISST 519

Query: 196 LIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLD 375
L+ MY+KCG + Q F +D +W A++ G+ +H EAL++F+ M E V +
Sbjct: 520 LVDMYSKCGNMQDFQLIFEKAPNRDFVTWNAMVCGYAQHGLGEEALKIFEYMQLENVKPN 579

Query: 376 AVSFVCSLKASGGLRAAKKG-EQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVF 552
+F+ L+A G + +KG +S L G + SC+V++ G+ G ++ + ++
Sbjct: 580 HATFLAVLRACGHMGLVEKGLHYFHSMLSNYGLDPQLEHYSCVVDIMGRSGQVSKALELI 639

Query: 553 DTLP-DQTVVAWNALMGGYVEHGYGEVA 633
+ +P + V W L+ HG EVA
Sbjct: 640 EGMPFEADAVIWRTLLSICKIHGNVEVA 667



Score = 92.8 bits (229), Expect = 2e-17
Identities = 61/223 (27%), Positives = 102/223 (45%), Gaps = 31/223 (13%)
Frame = +1

Query: 79 TFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYMYTKC------------- 219
TF+ + C + A+ G++ H ++ FV N LI MY KC
Sbjct: 44 TFSHIFQECSDRKALCPGKQAHARMILTEFKPTVFVTNCLIQMYIKCSDLEFAFKVFDGM 103

Query: 220 ------------------GLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFD 345
G + AQ+ F + +DV SW +L++G++ + R+ +++F
Sbjct: 104 PQRDTVSWNAMLFGYAGRGDIGVAQKLFDAMPERDVVSWNSLISGYLHNGDHRKVIDVFL 163

Query: 346 KMHNEGVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCG 525
+M G D +F LK+ L G QI+ V GF+ D GS L++MY KC
Sbjct: 164 QMGRMGTVFDRTTFAVVLKSCSSLEDHGGGIQIHGLAVKMGFDCDVVTGSALLDMYAKCK 223

Query: 526 LLADSQQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
L S Q F ++P++ V+W+A++ G V++ L+ F+ M
Sbjct: 224 KLDCSIQFFHSMPEKNWVSWSAIIAGCVQNDDLRGGLELFKEM 266



Score = 48.5 bits (114), Expect = 4e-04
Identities = 29/101 (28%), Positives = 52/101 (51%), Gaps = 2/101 (1%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEG-QEIHNEIMQRGLGKD 177
A+HGL + AL+ +E M+ E + P+ TF L+ACG+ G V++G H+ + GL
Sbjct: 556 AQHGLGEEALKIFEYMQLENVKPNHATFLAVLRACGHMGLVEKGLHYFHSMLSNYGLDPQ 615

Query: 178 HFVGNSLIYMYTKCGLLLKAQEAFYNIQTK-DVASWTALMT 297
+ ++ + + G + KA E + + D W L++
Sbjct: 616 LEHYSCVVDIMGRSGQVSKALELIEGMPFEADAVIWRTLLS 656


>tr|A5B3U0|A5B3U0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_035978 PE=4 SV=1
Length = 814

Score = 159 bits (402), Expect = 1e-37
Identities = 79/217 (36%), Positives = 125/217 (57%)
Frame = +1

Query: 4 EHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHF 183
++G + L + M + G+ PD T+ LKAC A++ G EIHN I++ +G D F
Sbjct: 391 QNGNEEKTLSLFVWMLQSGMEPDEFTYGSVLKACAGWQALNCGMEIHNRIIKSRMGLDSF 450

Query: 184 VGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEG 363
VG +LI MY+KCG++ KA++ + + V SW A+++GF + EA + F KM G
Sbjct: 451 VGIALIDMYSKCGMMEKAEKLHDRLAEQTVVSWNAIISGFSLQKQSEEAQKTFSKMLEMG 510

Query: 364 VSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQ 543
V D ++ L L + G+QI+++++ K + D + S LV+MY KCG + D Q
Sbjct: 511 VDPDNFTYATILDTCANLVTVELGKQIHAQIIKKELQSDAYISSTLVDMYSKCGNMQDFQ 570

Query: 544 QVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+F+ P++ V WNA++ GY +HG GE AL F+ M
Sbjct: 571 LIFEKAPNRDFVTWNAMVCGYAQHGLGEEALKIFEYM 607



Score = 114 bits (286), Expect = 4e-24
Identities = 62/208 (29%), Positives = 112/208 (53%), Gaps = 2/208 (0%)
Frame = +1

Query: 16 SDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNS 195
S+ A + + +M E G+ PD T+A L C N V+ G++IH +I+++ L D ++ ++
Sbjct: 496 SEEAQKTFSKMLEMGVDPDNFTYATILDTCANLVTVELGKQIHAQIIKKELQSDAYISST 555

Query: 196 LIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLD 375
L+ MY+KCG + Q F +D +W A++ G+ +H EAL++F+ M E V +
Sbjct: 556 LVDMYSKCGNMQDFQLIFEKAPNRDFVTWNAMVCGYAQHGLGEEALKIFEYMQLENVKPN 615

Query: 376 AVSFVCSLKASGGLRAAKKG-EQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVF 552
+F+ L+A G + +KG +S L G + SC+V++ G+ G ++ + ++
Sbjct: 616 HATFLAVLRACGHMGLVEKGLHYFHSMLSNYGLDPQLEHYSCVVDIMGRSGQVSKALELI 675

Query: 553 DTLP-DQTVVAWNALMGGYVEHGYGEVA 633
+ +P + V W L+ HG EVA
Sbjct: 676 EGMPFEADAVIWRTLLSXCKIHGNVEVA 703



Score = 113 bits (282), Expect = 1e-23
Identities = 61/210 (29%), Positives = 110/210 (52%)
Frame = +1

Query: 25 ALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIY 204
AL + +++ G+ D V+ + + +AC EG ++H M+ + V N+++
Sbjct: 297 ALGMFRLLQKSGLGLDEVSLSGAXRACAVIKGDLEGLQVHGLSMKSLCQSNICVANAILD 356

Query: 205 MYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVS 384
MY KCG L++A F + ++D SW A++ ++ + L LF M G+ D +
Sbjct: 357 MYGKCGALVEACLVFEEMVSRDAVSWNAIIAAHEQNGNEEKTLSLFVWMLQSGMEPDEFT 416

Query: 385 FVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLP 564
+ LKA G +A G +I++ ++ D VG L++MY KCG++ ++++ D L
Sbjct: 417 YGSVLKACAGWQALNCGMEIHNRIIKSRMGLDSFVGIALIDMYSKCGMMEKAEKLHDRLA 476

Query: 565 DQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+QTVV+WNA++ G+ E A F +M
Sbjct: 477 EQTVVSWNAIISGFSLQKQSEEAQKTFSKM 506



Score = 86.3 bits (212), Expect = 2e-15
Identities = 43/171 (25%), Positives = 87/171 (50%), Gaps = 1/171 (0%)
Frame = +1

Query: 136 EIHNEIMQRGLGKDHFVGNSLIYMYTKCGLLLKAQEAFYN-IQTKDVASWTALMTGFVEH 312
++H ++ G D +G + + MY KC L +N + ++ S+ A++ G+
Sbjct: 232 QLHGHALKTDFGTDVVIGTATLDMYMKCNNLSDCSNQLFNSLPNHNLQSYNAIIVGYARS 291

Query: 313 SRFREALELFDKMHNEGVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVG 492
+ EAL +F + G+ LD VS + +A ++ +G Q++ + + + V
Sbjct: 292 DKGIEALGMFRLLQKSGLGLDEVSLSGAXRACAVIKGDLEGLQVHGLSMKSLCQSNICVA 351

Query: 493 SCLVEMYGKCGLLADSQQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCF 645
+ +++MYGKCG L ++ VF+ + + V+WNA++ + ++G E L F
Sbjct: 352 NAILDMYGKCGALVEACLVFEEMVSRDAVSWNAIIAAHEQNGNEEKTLSLF 402



Score = 71.6 bits (174), Expect = 4e-11
Identities = 48/163 (29%), Positives = 70/163 (42%), Gaps = 15/163 (9%)
Frame = +1

Query: 79 TFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYMYTKCGLLLKAQEAFYNI 258
TF+ + C + A+ G++ H ++ FV N LI MY KC L A + F +
Sbjct: 44 TFSHIFQECSDRKALCPGKQAHARMILTEFKPTVFVTNCLIQMYIKCSDLGFAFKVFDGM 103

Query: 259 QTKDVASWTALMTGFVEHSRFREALELFD---------------KMHNEGVSLDAVSFVC 393
+D SW A++ G+ A +LFD +M G D +F
Sbjct: 104 PQRDTVSWNAMLFGYAGRGDIGVAQKLFDAMPGTGCGVVELFDFRMGRMGTVFDRTTFAV 163

Query: 394 SLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKC 522
LK+ L G QI+ V GF+ D GS L++MY KC
Sbjct: 164 VLKSCSSLEDHGGGIQIHGLAVKMGFDCDVVTGSALLDMYAKC 206



Score = 55.1 bits (131), Expect = 4e-06
Identities = 27/79 (34%), Positives = 45/79 (56%)
Frame = +1

Query: 418 RAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTVVAWNALM 597
+A G+Q ++ +++ F+ V +CL++MY KC L + +VFD +P + V+WNA++
Sbjct: 56 KALCPGKQAHARMILTEFKPTVFVTNCLIQMYIKCSDLGFAFKVFDGMPQRDTVSWNAML 115

Query: 598 GGYVEHGYGEVALDCFQRM 654
GY G VA F M
Sbjct: 116 FGYAGRGDIGVAQKLFDAM 134



Score = 48.9 bits (115), Expect = 3e-04
Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 2/112 (1%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEG-QEIHNEIMQRGLGKD 177
A+HGL + AL+ +E M+ E + P+ TF L+ACG+ G V++G H+ + GL
Sbjct: 592 AQHGLGEEALKIFEYMQLENVKPNHATFLAVLRACGHMGLVEKGLHYFHSMLSNYGLDPQ 651

Query: 178 HFVGNSLIYMYTKCGLLLKAQEAFYNIQTK-DVASWTALMTGFVEHSRFREA 330
+ ++ + + G + KA E + + D W L++ H A
Sbjct: 652 LEHYSCVVDIMGRSGQVSKALELIEGMPFEADAVIWRTLLSXCKIHGNVEVA 703


>tr|A9RJW2|A9RJW2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_175641 PE=4 SV=1
Length = 723

Score = 157 bits (396), Expect = 7e-37
Identities = 79/219 (36%), Positives = 134/219 (61%), Gaps = 1/219 (0%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+ G D+ALE E M++ ++P+ +TFA L+ C A++ G+++H I+Q G G++
Sbjct: 225 AQQGQVDVALELLETMQQAEVAPNKITFASILQGCTTPAALEHGKKVHRYIIQSGYGREL 284

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
+V NSLI MY KCG L +A++ F ++ +DV +WTA++TG+ + EA+ LF +M +
Sbjct: 285 WVVNSLITMYCKCGGLEEARKLFSDLPHRDVVTWTAMVTGYAQLGFHDEAINLFRRMQQQ 344

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
G+ D ++F L + ++G++I+ +LV G+ D + S LV MY KCG + D+
Sbjct: 345 GIKPDKMTFTSVLTSCSSPAFLQEGKRIHQQLVHAGYNLDVYLQSALVSMYAKCGSMDDA 404

Query: 541 QQVFDTLPDQTVVAWNALMGG-YVEHGYGEVALDCFQRM 654
VF+ + ++ VVAW A++ G +HG AL+ F +M
Sbjct: 405 SLVFNQMSERNVVAWTAIITGCCAQHGRCREALEYFDQM 443



Score = 143 bits (361), Expect = 8e-33
Identities = 73/210 (34%), Positives = 121/210 (57%)
Frame = +1

Query: 25 ALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIY 204
A +CYE MK G PD VTF L A N + GQ++H EI++ GL + VG SL+
Sbjct: 132 AFKCYETMKLAGCKPDKVTFVSLLNAFTNPELLQLGQKVHMEIVEAGLELEPRVGTSLVG 191

Query: 205 MYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVS 384
MY KCG + KA+ F + K+V +WT L+ G+ + + ALEL + M V+ + ++
Sbjct: 192 MYAKCGDISKARVIFDRLPEKNVVTWTLLIAGYAQQGQVDVALELLETMQQAEVAPNKIT 251

Query: 385 FVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLP 564
F L+ A + G++++ ++ G+ + V + L+ MY KCG L +++++F LP
Sbjct: 252 FASILQGCTTPAALEHGKKVHRYIIQSGYGRELWVVNSLITMYCKCGGLEEARKLFSDLP 311

Query: 565 DQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ VV W A++ GY + G+ + A++ F+RM
Sbjct: 312 HRDVVTWTAMVTGYAQLGFHDEAINLFRRM 341



Score = 133 bits (335), Expect = 8e-30
Identities = 68/210 (32%), Positives = 119/210 (56%)
Frame = +1

Query: 25 ALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIY 204
AL M +G + F L+ C ++++G+E+H I++ G+ + ++ N+L+
Sbjct: 31 ALGIMNTMILQGTRVYSDVFRGLLQECARLRSLEQGREVHAAILKSGIQPNRYLENTLLS 90

Query: 205 MYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVS 384
MY KCG L A+ F +I+ +++ SWTA++ FV ++ EA + ++ M G D V+
Sbjct: 91 MYAKCGSLTDARRVFDSIRDRNIVSWTAMIEAFVAGNKNLEAFKCYETMKLAGCKPDKVT 150

Query: 385 FVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLP 564
FV L A + G++++ E+V G E + VG+ LV MY KCG ++ ++ +FD LP
Sbjct: 151 FVSLLNAFTNPELLQLGQKVHMEIVEAGLELEPRVGTSLVGMYAKCGDISKARVIFDRLP 210

Query: 565 DQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
++ VV W L+ GY + G +VAL+ + M
Sbjct: 211 EKNVVTWTLLIAGYAQQGQVDVALELLETM 240



Score = 117 bits (292), Expect = 8e-25
Identities = 59/190 (31%), Positives = 107/190 (56%), Gaps = 2/190 (1%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+ G D A+ + +M+++GI PD +TF L +C + + EG+ IH +++ G D
Sbjct: 326 AQLGFHDEAINLFRRMQQQGIKPDKMTFTSVLTSCSSPAFLQEGKRIHQQLVHAGYNLDV 385

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGF-VEHSRFREALELFDKMHN 357
++ ++L+ MY KCG + A F + ++V +WTA++TG +H R REALE FD+M
Sbjct: 386 YLQSALVSMYAKCGSMDDASLVFNQMSERNVVAWTAIITGCCAQHGRCREALEYFDQMKK 445

Query: 358 EGVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMK-GFEGDYSVGSCLVEMYGKCGLLA 534
+G+ D V+F L A + ++G + + + + G + SC V++ G+ G L
Sbjct: 446 QGIKPDKVTFTSVLSACTHVGLVEEGRKHFRSMYLDYGIKPMVEHYSCFVDLLGRAGHLE 505

Query: 535 DSQQVFDTLP 564
+++ V ++P
Sbjct: 506 EAENVILSMP 515



Score = 66.6 bits (161), Expect = 1e-09
Identities = 31/113 (27%), Positives = 65/113 (57%)
Frame = +1

Query: 316 RFREALELFDKMHNEGVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGS 495
R +EAL + + M +G + + F L+ LR+ ++G ++++ ++ G + + + +
Sbjct: 27 RLKEALGIMNTMILQGTRVYSDVFRGLLQECARLRSLEQGREVHAAILKSGIQPNRYLEN 86

Query: 496 CLVEMYGKCGLLADSQQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
L+ MY KCG L D+++VFD++ D+ +V+W A++ +V A C++ M
Sbjct: 87 TLLSMYAKCGSLTDARRVFDSIRDRNIVSWTAMIEAFVAGNKNLEAFKCYETM 139


>tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 795

Score = 156 bits (394), Expect = 1e-36
Identities = 75/210 (35%), Positives = 127/210 (60%)
Frame = +1

Query: 25 ALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIY 204
AL + +M+ GI P+++T L AC + A+++GQ+IH ++ G + VGN+L+
Sbjct: 306 ALAFFNRMQVRGIKPNSITMVSVLPACAHLFALEQGQQIHGYAIRSGFESNDVVGNALVN 365

Query: 205 MYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVS 384
MY KCG + A + F + K+V +W A+++G+ +H EAL LF +M +G+ D+ +
Sbjct: 366 MYAKCGNVNSAYKLFERMPKKNVVAWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFA 425

Query: 385 FVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLP 564
V L A A ++G+QI+ + GFE + VG+ LV++Y KCG + +Q++F+ +P
Sbjct: 426 IVSVLPACAHFLALEQGKQIHGYTIRSGFESNVVVGTGLVDIYAKCGNVNTAQKLFERMP 485

Query: 565 DQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+Q VV+W ++ Y HG+GE AL F +M
Sbjct: 486 EQDVVSWTTMILAYGIHGHGEDALALFSKM 515



Score = 153 bits (386), Expect = 1e-35
Identities = 77/217 (35%), Positives = 125/217 (57%)
Frame = +1

Query: 4 EHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHF 183
++G + AL Y QM+ GI+PD + F +KACG+ + G+++H +I+ RG D
Sbjct: 97 KNGFWNKALRLYYQMQRTGINPDKLVFLSVIKACGSQSDLQAGRKVHEDIIARGFESDVI 156

Query: 184 VGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEG 363
VG +L MYTKCG L A++ F + +DV SW A++ G+ ++ + EAL LF +M G
Sbjct: 157 VGTALASMYTKCGSLENARQVFDRMPKRDVVSWNAIIAGYSQNGQPYEALALFSEMQVNG 216

Query: 364 VSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQ 543
+ ++ + V + L A ++G+QI+ + G E D V + LV MY KCG + +
Sbjct: 217 IKPNSSTLVSVMPVCAHLLALEQGKQIHCYAIRSGIESDVLVVNGLVNMYAKCGNVNTAH 276

Query: 544 QVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
++F+ +P + V +WNA++GGY + AL F RM
Sbjct: 277 KLFERMPIRDVASWNAIIGGYSLNSQHHEALAFFNRM 313



Score = 151 bits (381), Expect = 4e-35
Identities = 75/218 (34%), Positives = 128/218 (58%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
+++G AL + +M+ GI P++ T + C + A+++G++IH ++ G+ D
Sbjct: 197 SQNGQPYEALALFSEMQVNGIKPNSSTLVSVMPVCAHLLALEQGKQIHCYAIRSGIESDV 256

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
V N L+ MY KCG + A + F + +DVASW A++ G+ +S+ EAL F++M
Sbjct: 257 LVVNGLVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIGGYSLNSQHHEALAFFNRMQVR 316

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
G+ ++++ V L A L A ++G+QI+ + GFE + VG+ LV MY KCG + +
Sbjct: 317 GIKPNSITMVSVLPACAHLFALEQGQQIHGYAIRSGFESNDVVGNALVNMYAKCGNVNSA 376

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
++F+ +P + VVAWNA++ GY +HG+ AL F M
Sbjct: 377 YKLFERMPKKNVVAWNAIISGYSQHGHPHEALALFIEM 414



Score = 105 bits (262), Expect = 2e-21
Identities = 62/209 (29%), Positives = 104/209 (49%), Gaps = 9/209 (4%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
++HG AL + +M+ +GI PD+ L AC + A+++G++IH ++ G +
Sbjct: 399 SQHGHPHEALALFIEMQAQGIKPDSFAIVSVLPACAHFLALEQGKQIHGYTIRSGFESNV 458

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
VG L+ +Y KCG + AQ+ F + +DV SWT ++ + H +AL LF KM
Sbjct: 459 VVGTGLVDIYAKCGNVNTAQKLFERMPEQDVVSWTTMILAYGIHGHGEDALALFSKMQET 518

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVG------SCLVEMYGKC 522
G LD ++F L A +G Q + + + DY + +CLV++ G+
Sbjct: 519 GTKLDHIAFTAILTACSHAGLVDQGLQYF-----QCMKSDYGLAPKLEHYACLVDLLGRA 573

Query: 523 GLLADSQQVFDTL---PDQTVVAWNALMG 600
G L ++ + + PD V W AL+G
Sbjct: 574 GHLDEANGIIKNMSLEPDANV--WGALLG 600



Score = 98.2 bits (243), Expect = 4e-19
Identities = 44/125 (35%), Positives = 76/125 (60%)
Frame = +1

Query: 280 WTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVCSLKASGGLRAAKKGEQIYSELV 459
W + G+V++ + +AL L+ +M G++ D + F+ +KA G + G +++ +++
Sbjct: 88 WKETIIGYVKNGFWNKALRLYYQMQRTGINPDKLVFLSVIKACGSQSDLQAGRKVHEDII 147

Query: 460 MKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTVVAWNALMGGYVEHGYGEVALD 639
+GFE D VG+ L MY KCG L +++QVFD +P + VV+WNA++ GY ++G AL
Sbjct: 148 ARGFESDVIVGTALASMYTKCGSLENARQVFDRMPKRDVVSWNAIIAGYSQNGQPYEALA 207

Query: 640 CFQRM 654
F M
Sbjct: 208 LFSEM 212


>tr|A9T5P5|A9T5P5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_191892 PE=4 SV=1
Length = 905

Score = 156 bits (394), Expect = 1e-36
Identities = 72/210 (34%), Positives = 123/210 (58%)
Frame = +1

Query: 25 ALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIY 204
A+ Y+QM+ EG+ P VTF L AC N+ A +G+ IH +I++ G+ + + N+L+
Sbjct: 415 AMRLYKQMQSEGVKPGRVTFLHLLSACANSSAYADGKMIHEDILRSGIKSNGHLANALMN 474

Query: 205 MYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVS 384
MY +CG L++AQ F Q +DV SW +++ G +H + A +LF +M NE + D ++
Sbjct: 475 MYRRCGSLMEAQNVFEGTQARDVISWNSMIAGHAQHGSYETAYKLFQEMQNEELEPDNIT 534

Query: 385 FVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLP 564
F L A + G+QI+ + G + D ++G+ L+ MY +CG L D++ VF +L
Sbjct: 535 FASVLSGCKNPEALELGKQIHGRITESGLQLDVNLGNALINMYIRCGSLQDARNVFHSLQ 594

Query: 565 DQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ V++W A++GG + G A++ F +M
Sbjct: 595 HRDVMSWTAMIGGCADQGEDMKAIELFWQM 624



Score = 150 bits (380), Expect = 5e-35
Identities = 73/218 (33%), Positives = 126/218 (57%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+HG + A E Y +M+ +G++ + T+ L AC + A++ G+ IH+ I + G D
Sbjct: 306 AQHGHNVEAFEQYYRMRSDGVALNRTTYLSILNACSTSKALEAGKLIHSHISEDGHSSDV 365

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
+GN+LI MY +CG L KA+E FY + +D+ SW A++ G+ EA+ L+ +M +E
Sbjct: 366 QIGNALISMYARCGDLPKARELFYTMPKRDLISWNAIIAGYARREDRGEAMRLYKQMQSE 425

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
GV V+F+ L A A G+ I+ +++ G + + + + L+ MY +CG L ++
Sbjct: 426 GVKPGRVTFLHLLSACANSSAYADGKMIHEDILRSGIKSNGHLANALMNMYRRCGSLMEA 485

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
Q VF+ + V++WN+++ G+ +HG E A FQ M
Sbjct: 486 QNVFEGTQARDVISWNSMIAGHAQHGSYETAYKLFQEM 523



Score = 135 bits (341), Expect = 2e-30
Identities = 70/218 (32%), Positives = 124/218 (56%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+ G A + +E+M+ G P+ +T+ L AC + ++ G++IH++I++ G +D
Sbjct: 104 AQQGFKKKAFQLFEEMQNAGFIPNKITYISILTACYSPAELENGKKIHSQIIKAGYQRDP 163

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
V NSL+ MY KCG L +A++ F I +DV S+ ++ + + + +E L LF +M +E
Sbjct: 164 RVQNSLLSMYGKCGDLPRARQVFAGISPRDVVSYNTMLGLYAQKAYVKECLGLFGQMSSE 223

Query: 361 GVSLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADS 540
G+S D V+++ L A +G++I+ V +G D VG+ LV M +CG + +
Sbjct: 224 GISPDKVTYINLLDAFTTPSMLDEGKRIHKLTVEEGLNSDIRVGTALVTMCVRCGDVDSA 283

Query: 541 QQVFDTLPDQTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+Q F + D+ VV +NAL+ +HG+ A + + RM
Sbjct: 284 KQAFKGIADRDVVVYNALIAALAQHGHNVEAFEQYYRM 321



Score = 135 bits (339), Expect = 3e-30
Identities = 68/209 (32%), Positives = 117/209 (55%)
Frame = +1

Query: 28 LECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYM 207
L + QM EGISPD VT+ L A +DEG+ IH ++ GL D VG +L+ M
Sbjct: 214 LGLFGQMSSEGISPDKVTYINLLDAFTTPSMLDEGKRIHKLTVEEGLNSDIRVGTALVTM 273

Query: 208 YTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSF 387
+CG + A++AF I +DV + AL+ +H EA E + +M ++GV+L+ ++
Sbjct: 274 CVRCGDVDSAKQAFKGIADRDVVVYNALIAALAQHGHNVEAFEQYYRMRSDGVALNRTTY 333

Query: 388 VCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPD 567
+ L A +A + G+ I+S + G D +G+ L+ MY +CG L ++++F T+P
Sbjct: 334 LSILNACSTSKALEAGKLIHSHISEDGHSSDVQIGNALISMYARCGDLPKARELFYTMPK 393

Query: 568 QTVVAWNALMGGYVEHGYGEVALDCFQRM 654
+ +++WNA++ GY A+ +++M
Sbjct: 394 RDLISWNAIIAGYARREDRGEAMRLYKQM 422



Score = 122 bits (306), Expect = 2e-26
Identities = 60/195 (30%), Positives = 111/195 (56%)
Frame = +1

Query: 70 DAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDHFVGNSLIYMYTKCGLLLKAQEAF 249
D T+ L+ C + E + IH ++++ G+G D F+ N LI MY KC +L A + F
Sbjct: 26 DRATYVALLQNCTRKRLLPEAKRIHAQMVEAGVGPDIFLSNLLINMYVKCRSVLDAHQVF 85

Query: 250 YNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNEGVSLDAVSFVCSLKASGGLRAAK 429
+ +DV SW +L++ + + ++A +LF++M N G + ++++ L A +
Sbjct: 86 KEMPRRDVISWNSLISCYAQQGFKKKAFQLFEEMQNAGFIPNKITYISILTACYSPAELE 145

Query: 430 KGEQIYSELVMKGFEGDYSVGSCLVEMYGKCGLLADSQQVFDTLPDQTVVAWNALMGGYV 609
G++I+S+++ G++ D V + L+ MYGKCG L ++QVF + + VV++N ++G Y
Sbjct: 146 NGKKIHSQIIKAGYQRDPRVQNSLLSMYGKCGDLPRARQVFAGISPRDVVSYNTMLGLYA 205

Query: 610 EHGYGEVALDCFQRM 654
+ Y + L F +M
Sbjct: 206 QKAYVKECLGLFGQM 220



Score = 120 bits (300), Expect = 1e-25
Identities = 70/214 (32%), Positives = 112/214 (52%), Gaps = 8/214 (3%)
Frame = +1

Query: 1 AEHGLSDLALECYEQMKEEGISPDAVTFACSLKACGNAGAVDEGQEIHNEIMQRGLGKDH 180
A+HG + A + +++M+ E + PD +TFA L C N A++ G++IH I + GL D
Sbjct: 508 AQHGSYETAYKLFQEMQNEELEPDNITFASVLSGCKNPEALELGKQIHGRITESGLQLDV 567

Query: 181 FVGNSLIYMYTKCGLLLKAQEAFYNIQTKDVASWTALMTGFVEHSRFREALELFDKMHNE 360
+GN+LI MY +CG L A+ F+++Q +DV SWTA++ G + +A+ELF +M NE
Sbjct: 568 NLGNALINMYIRCGSLQDARNVFHSLQHRDVMSWTAMIGGCADQGEDMKAIELFWQMQNE 627

Query: 361 GV-SLDAVSFVCSLKASGGLRAAKKGEQIYSELVMKGFEGDYSV------GSCLVEMYGK 519
G D +F L A +G QI+S + E +Y V CLV + G+
Sbjct: 628 GFRPPDGSTFTSILSACNHAGLVLEGYQIFSSM-----ESEYGVLPTIEHYGCLVGLLGR 682

Query: 520 CGLLADSQQVFDTLP-DQTVVAWNALMGGYVEHG 618
+++ + + +P W L+G HG
Sbjct: 683 ARRFQEAETLINQMPFPPDAAVWETLLGACRIHG 716