DK960106
Clone id TST39A01NGRL0006_I04
Library
Length 627
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_I04. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
GACGATTCTTACTTTTTTGAATACTTTTGTGGATTTCCATATTTGAAAATGTTTTGGGGA
ACTCCTACTTCGTCTATTGATTCGGCGTGGAAGAAACTACGCTGTCAGTCCTTACGCTAG
CCGAATTTTGGAATGACTACTCTACCAATTCTCTCTTTGTTTTCGTGGGATTGCTTGGAG
CATATTTGAAGTACAAATATCTGAAATCGGAAAAACGTTTTATAGTTTTAGACCTCTTCG
TTGCTATTATTGGTTTAGGATCTGCGGCTTTTCATGGTACTATGTTATTTAGTACTCAAC
TGTTTGATGAATTGCCAATGGTTTGGTGCTCTTTGATTCAATTGTTTGTGCTTTTAAGAA
TGCAAGACTTTAAAGACGATAAACAATCATCTTGGTCTTTAATTTTGGACGACAATATCG
CAAAAGTACTCGTTGTATTCGGAATTGTTTGGACCGCGAATGCTTACTGGATTCATCGCC
AATACAATATCGCTTTCCAACTCTTCTTTATTGCTACAACTGCTTATGGTTTTTACTTGA
TGTCTGACATCTATCACAAAACGAACAATATTCATGCAAAGAGACTCTTGGTCGTTTACT
TCGCTTCTCTTGGCTTAACTGGAACTT
■■Homology search results ■■ -
sp_hit_id Q9D099
Definition sp|Q9D099|APHC_MOUSE Alkaline phytoceramidase OS=Mus musculus
Align length 105
Score (bit) 56.6
E-value 1.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960106|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_I04, 5'
(609 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9D099|APHC_MOUSE Alkaline phytoceramidase OS=Mus musculus GN... 57 1e-07
sp|Q9NUN7|APHC_HUMAN Alkaline phytoceramidase OS=Homo sapiens GN... 54 5e-07
sp|Q02896|YDC1_YEAST Alkaline ceramidase YDC1 OS=Saccharomyces c... 49 8e-06
sp|P38298|YPC1_YEAST Alkaline ceramidase YPC1 OS=Saccharomyces c... 47 1e-04
sp|Q568I2|ASAH3_DANRE Alkaline ceramidase 1 OS=Danio rerio GN=as... 42 0.002
sp|Q8VD53|ASA3L_MOUSE Alkaline ceramidase 2 OS=Mus musculus GN=A... 40 0.007
sp|Q5QJU3|ASA3L_HUMAN Alkaline ceramidase 2 OS=Homo sapiens GN=A... 40 0.007
sp|Q8R4X1|ASAH3_MOUSE Alkaline ceramidase 1 OS=Mus musculus GN=A... 40 0.009
sp|Q8TDN7|ASAH3_HUMAN Alkaline ceramidase 1 OS=Homo sapiens GN=A... 40 0.012
sp|Q9VIP7|ACASE_DROME Alkaline ceramidase OS=Drosophila melanoga... 35 0.30
sp|Q9T0J1|CRK26_ARATH Cysteine-rich receptor-like protein kinase... 33 1.5
sp|P54707|AT12A_HUMAN Potassium-transporting ATPase alpha chain ... 32 2.5
sp|O45145|ACASE_CAEEL Alkaline ceramidase OS=Caenorhabditis eleg... 32 2.5
sp|Q646G0|T2R46_PAPHA Taste receptor type 2 member 46 OS=Papio h... 31 4.3
sp|Q60WT2|ACASE_CAEBR Alkaline ceramidase OS=Caenorhabditis brig... 31 5.6
sp|P32767|PDR6_YEAST Pleiotropic drug resistance regulatory prot... 30 7.4

>sp|Q9D099|APHC_MOUSE Alkaline phytoceramidase OS=Mus musculus
GN=Phca PE=2 SV=1
Length = 267

Score = 56.6 bits (135), Expect = 1e-07
Identities = 34/105 (32%), Positives = 52/105 (49%)
Frame = +3

Query: 72 EETTLSVLTLAEFWNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDLFVAIIGLGSAA 251
EE + L +AEFWN S +L + + EKR+I L + ++G+GS
Sbjct: 22 EENYVVTLFVAEFWNTVS--NLIMIIPPIFGAIQGIRDRLEKRYIAAYLALTVVGMGSWC 79

Query: 252 FHGTMLFSTQLFDELPMVWCSLIQLFVLLRMQDFKDDKQSSWSLI 386
FH T+ + QL DELPM++ I FV + FK ++ L+
Sbjct: 80 FHMTLKYEMQLLDELPMIYSCCI--FVYCMFECFKTKSSINYHLL 122


>sp|Q9NUN7|APHC_HUMAN Alkaline phytoceramidase OS=Homo sapiens
GN=PHCA PE=1 SV=2
Length = 267

Score = 54.3 bits (129), Expect = 5e-07
Identities = 35/113 (30%), Positives = 55/113 (48%)
Frame = +3

Query: 99 LAEFWNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDLFVAIIGLGSAAFHGTMLFST 278
+AEFWN S +L + + EKR+I L + ++G+GS FH T+ +
Sbjct: 31 IAEFWNTVS--NLIMIIPPMFGAIQSVRDGLEKRYIASYLALTVVGMGSWCFHMTLKYEM 88

Query: 279 QLFDELPMVWCSLIQLFVLLRMQDFKDDKQSSWSLILDDNIAKVLVVFGIVWT 437
QL DELPM++ I FV + FK ++ L+ LV+F ++ T
Sbjct: 89 QLLDELPMIYSCCI--FVYCMFECFKIKNSVNYHLLF------TLVLFSLIVT 133


>sp|Q02896|YDC1_YEAST Alkaline ceramidase YDC1 OS=Saccharomyces
cerevisiae GN=YDC1 PE=1 SV=1
Length = 317

Score = 48.9 bits (115), Expect(2) = 8e-06
Identities = 39/163 (23%), Positives = 75/163 (46%), Gaps = 8/163 (4%)
Frame = +3

Query: 111 WNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDLFVAIIGLGSAAFHGTMLFSTQLFD 290
W++ TNS+F+ E R+I++ + +++G+GS FH T+ + QL D
Sbjct: 39 WSNTITNSIFLMTAFYSTYSAWRNKL-ETRYILIGMGFSLVGIGSWLFHMTLQYRYQLLD 97

Query: 291 ELPMVWCSLIQLFVL------LRMQDFKDDKQSSWSLILDDNIAKVLVVFGIVWTANAYW 452
ELPM++ ++I + + + ++D K K+SS+ + + ++ GIV +
Sbjct: 98 ELPMLYATIIPSWSIFAETQEILIKDEKKRKESSFRI----QMVISFIMCGIVTILTWIY 153

Query: 453 IHRQYNIAFQLFFIATTAYGFYLMS--DIYHKTNNIHAKRLLV 575
+ Q FQ+ + T L YH ++ K L +
Sbjct: 154 VVVQKPAIFQVLYGILTLLVVVLSGWLTYYHVHDSFAKKNLFI 196



Score = 21.2 bits (43), Expect(2) = 8e-06
Identities = 7/10 (70%), Positives = 8/10 (80%)
Frame = +1

Query: 34 FWGTPTSSID 63
+WG PTS ID
Sbjct: 15 YWGKPTSLID 24


>sp|P38298|YPC1_YEAST Alkaline ceramidase YPC1 OS=Saccharomyces
cerevisiae GN=YPC1 PE=1 SV=1
Length = 316

Score = 46.6 bits (109), Expect = 1e-04
Identities = 43/164 (26%), Positives = 73/164 (44%), Gaps = 10/164 (6%)
Frame = +3

Query: 111 WNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDLFVAIIGLGSAAFHGTMLFSTQLFD 290
W++ TNS+F+ + EKRF+++ ++G+GS FH T+ + QL D
Sbjct: 40 WSNTLTNSVFI-LSAIYTTYSAYKNKLEKRFLLIGFGYGLVGVGSWLFHMTLKYRFQLLD 98

Query: 291 ELPMVWCSLIQLFVLLRMQDFKDDKQSSWSLILDDNIAKVL--------VVFGIVWTANA 446
ELPM++ I + L+ ++ +L+ DN KV V+ G+ T +
Sbjct: 99 ELPMIYAMCIPTWSLV--------CEAKEALLNGDNHKKVPLFEQIFIGVIIGLAVTTAS 150

Query: 447 --YWIHRQYNIAFQLFFIATTAYGFYLMSDIYHKTNNIHAKRLL 572
Y I++ +I LF + S Y ++ AKR L
Sbjct: 151 ILYVIYKNVDIHQILFGVQIVVVAATAGSLTYRYVHDPLAKRNL 194


>sp|Q568I2|ASAH3_DANRE Alkaline ceramidase 1 OS=Danio rerio GN=asah3
PE=2 SV=1
Length = 266

Score = 42.0 bits (97), Expect = 0.002
Identities = 39/166 (23%), Positives = 70/166 (42%), Gaps = 6/166 (3%)
Frame = +3

Query: 120 YSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDL---FVAIIGLGSAAFHGTMLFSTQLFD 290
++T S F+F +++R + + L + +G+ S FH T+ F Q+ D
Sbjct: 29 FNTMSSFIFFVISPIMLYLLHPYAKERNLAVHLVWIMMVFVGIFSMYFHMTLSFMGQMLD 88

Query: 291 ELPMVWCSLIQL---FVLLRMQDFKDDKQSSWSLILDDNIAKVLVVFGIVWTANAYWIHR 461
EL ++W I F F D+ S L+L I L F + TANAY
Sbjct: 89 ELSILWVLAIGYSLWFPRKHFPSFVKDRTSFARLVLTITIISTLSSF-VKPTANAY---- 143

Query: 462 QYNIAFQLFFIATTAYGFYLMSDIYHKTNNIHAKRLLVVYFASLGL 599
A + +++ ++ + + +R+L + +AS+GL
Sbjct: 144 -----------ALNCFAIHILYSLFVELKSCTDERVLRLAWASIGL 178


>sp|Q8VD53|ASA3L_MOUSE Alkaline ceramidase 2 OS=Mus musculus
GN=Asah3l PE=2 SV=1
Length = 275

Score = 40.4 bits (93), Expect = 0.007
Identities = 23/89 (25%), Positives = 38/89 (42%), Gaps = 3/89 (3%)
Frame = +3

Query: 72 EETTLSVLTLAEFWNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDLFVAIIGLGSAA 251
E+ V +AEF+N S F+ ++ + ++G+GS
Sbjct: 21 EDNYTIVPAIAEFYNTISNVLFFILPPICMCLFRQYATCFNSGIYLIWTLLVVVGIGSVY 80

Query: 252 FHGTMLFSTQLFDELPMVW---CSLIQLF 329
FH T+ F Q+ DEL ++W C+L F
Sbjct: 81 FHATLSFLGQMLDELAILWVLMCALAMWF 109


>sp|Q5QJU3|ASA3L_HUMAN Alkaline ceramidase 2 OS=Homo sapiens
GN=ASAH3L PE=2 SV=2
Length = 275

Score = 40.4 bits (93), Expect = 0.007
Identities = 23/89 (25%), Positives = 38/89 (42%), Gaps = 3/89 (3%)
Frame = +3

Query: 72 EETTLSVLTLAEFWNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDLFVAIIGLGSAA 251
E+ V +AEF+N S F+ ++ + ++G+GS
Sbjct: 21 EDNYTIVPAIAEFYNTISNVLFFILPPICMCLFRQYATCFNSGIYLIWTLLVVVGIGSVY 80

Query: 252 FHGTMLFSTQLFDELPMVW---CSLIQLF 329
FH T+ F Q+ DEL ++W C+L F
Sbjct: 81 FHATLSFLGQMLDELAVLWVLMCALAMWF 109


>sp|Q8R4X1|ASAH3_MOUSE Alkaline ceramidase 1 OS=Mus musculus
GN=Asah3 PE=1 SV=1
Length = 273

Score = 40.0 bits (92), Expect = 0.009
Identities = 38/151 (25%), Positives = 61/151 (40%), Gaps = 4/151 (2%)
Frame = +3

Query: 99 LAEFWNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDLFVAIIGLGSAAFHGTMLFST 278
+AEF+N +S +F + F + + +IGL S FH T+ F
Sbjct: 34 VAEFYNTFSNVFFLIFGPLMMFLMHPYAQKRTRCFYGVSVLFMLIGLFSMYFHMTLSFLG 93

Query: 279 QLFDELPMVWCSLIQLFVLLRMQDF----KDDKQSSWSLILDDNIAKVLVVFGIVWTANA 446
QL DE+ ++W V L F K ++ L+ I + F + T NA
Sbjct: 94 QLLDEISILWLLASGYSVWLPRCYFPKFVKGNRFYFSCLVTITTIISTFLTF-VKPTVNA 152

Query: 447 YWIHRQYNIAFQLFFIATTAYGFYLMSDIYH 539
Y ++ +IA + +I T Y D+ H
Sbjct: 153 YALN---SIAIHILYIVRTEYKKIRDDDLRH 180


>sp|Q8TDN7|ASAH3_HUMAN Alkaline ceramidase 1 OS=Homo sapiens
GN=ASAH3 PE=2 SV=1
Length = 264

Score = 39.7 bits (91), Expect = 0.012
Identities = 22/70 (31%), Positives = 33/70 (47%)
Frame = +3

Query: 99 LAEFWNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDLFVAIIGLGSAAFHGTMLFST 278
+AEF+N +S F+F + V+ + IIGL S FH T+ F
Sbjct: 25 VAEFYNTFSNIPFFIFGPLMMLLMHPYAQKRSRYIYVVWVLFMIIGLFSMYFHMTLSFLG 84

Query: 279 QLFDELPMVW 308
QL DE+ ++W
Sbjct: 85 QLLDEIAILW 94


>sp|Q9VIP7|ACASE_DROME Alkaline ceramidase OS=Drosophila
melanogaster GN=bwa PE=2 SV=2
Length = 283

Score = 35.0 bits (79), Expect = 0.30
Identities = 30/122 (24%), Positives = 51/122 (41%), Gaps = 10/122 (8%)
Frame = +3

Query: 99 LAEFWNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFI-----VLDLFVAIIGLGSAAFHGT 263
+AEF N +S N LF+ + RF+ V+ + + ++GL S FH T
Sbjct: 40 IAEFVNTFS-NFLFILLPPVLIMLFKEYG----RFVTPGIHVIWVLLIVVGLSSMYFHAT 94

Query: 264 MLFSTQLFDELPMVWCSLIQLFVLLRMQDF-----KDDKQSSWSLILDDNIAKVLVVFGI 428
+ QL DEL ++W + + + + D K SW ++L + G+
Sbjct: 95 LSLIGQLLDELAILWVFMAAFSLFYPKRYYPKFVKNDRKTFSWLMLL-----SAIAATGL 149

Query: 429 VW 434
W
Sbjct: 150 SW 151


tr_hit_id B6NXU3
Definition tr|B6NXU3|B6NXU3_BRAFL Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae
Align length 179
Score (bit) 62.0
E-value 3.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960106|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_I04, 5'
(609 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6NXU3|B6NXU3_BRAFL Putative uncharacterized protein (Fragmen... 62 3e-08
tr|B6P1J1|B6P1J1_BRAFL Putative uncharacterized protein OS=Branc... 62 3e-08
tr|B3SCA9|B3SCA9_TRIAD Putative uncharacterized protein OS=Trich... 57 4e-07
tr|Q8CIG2|Q8CIG2_MOUSE Phca protein OS=Mus musculus GN=Phca PE=2... 57 1e-06
tr|A9V3Q7|A9V3Q7_MONBE Predicted protein OS=Monosiga brevicollis... 56 1e-06
tr|A7MBH7|A7MBH7_BOVIN PHCA protein OS=Bos taurus GN=PHCA PE=2 SV=1 56 2e-06
tr|Q5XGP2|Q5XGP2_XENLA LOC495272 protein OS=Xenopus laevis GN=ph... 54 5e-06
tr|Q08VK6|Q08VK6_STIAU Alkaline phytoceramidase OS=Stigmatella a... 54 5e-06
tr|B2RC99|B2RC99_HUMAN cDNA, FLJ95927, Homo sapiens phytoceramid... 54 5e-06
tr|A8E5U9|A8E5U9_XENTR LOC100127611 protein OS=Xenopus tropicali... 54 9e-06
tr|A9SEJ5|A9SEJ5_PHYPA Predicted protein OS=Physcomitrella paten... 54 9e-06
tr|Q6TMJ1|Q6TMJ1_DICDI Alkaline dihydroceramidase OS=Dictyosteli... 54 9e-06
tr|B4FVC6|B4FVC6_MAIZE Putative uncharacterized protein OS=Zea m... 52 3e-05
tr|Q96U10|Q96U10_NEUCR Putative uncharacterized protein B7F18.05... 52 3e-05
tr|Q84LH5|Q84LH5_ORYSJ Os03g0698900 protein OS=Oryza sativa subs... 51 5e-05
tr|B8AQ01|B8AQ01_ORYSI Putative uncharacterized protein OS=Oryza... 51 5e-05
tr|A9U2Y6|A9U2Y6_PHYPA Predicted protein OS=Physcomitrella paten... 51 5e-05
tr|A9S829|A9S829_PHYPA Predicted protein OS=Physcomitrella paten... 50 8e-05
tr|B5VT78|B5VT78_YEAS6 YPL087Wp-like protein OS=Saccharomyces ce... 49 1e-04
tr|B3LKY5|B3LKY5_YEAS1 Alkaline ceramidase YDC1 OS=Saccharomyces... 49 1e-04
tr|A6ZWG4|A6ZWG4_YEAS7 Alkaline dihydroceramidase OS=Saccharomyc... 49 1e-04
tr|B4FSP4|B4FSP4_MAIZE Putative uncharacterized protein OS=Zea m... 50 1e-04
tr|A4RPT5|A4RPT5_MAGGR Putative uncharacterized protein OS=Magna... 50 1e-04
tr|Q5A0Z2|Q5A0Z2_CANAL Putative uncharacterized protein YDC1 OS=... 47 2e-04
tr|A9T9C5|A9T9C5_PHYPA Predicted protein OS=Physcomitrella paten... 49 3e-04
tr|B7Z2Z6|B7Z2Z6_HUMAN cDNA FLJ57307, highly similar to Alkaline... 48 5e-04
tr|B7Z1R2|B7Z1R2_HUMAN cDNA FLJ51673, highly similar to Alkaline... 48 5e-04
tr|B0CRK3|B0CRK3_LACBS Predicted protein OS=Laccaria bicolor (st... 48 5e-04
tr|A7R5K1|A7R5K1_VITVI Chromosome undetermined scaffold_984, who... 47 7e-04
tr|Q55DQ0|Q55DQ0_DICDI Alkaline dihydroceramidase OS=Dictyosteli... 47 7e-04

>tr|B6NXU3|B6NXU3_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_238691 PE=4 SV=1
Length = 249

Score = 62.0 bits (149), Expect = 3e-08
Identities = 50/179 (27%), Positives = 81/179 (45%)
Frame = +3

Query: 72 EETTLSVLTLAEFWNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDLFVAIIGLGSAA 251
EE + +AEFWN S +L + + E R++V + ++G+GS
Sbjct: 22 EENYVVTEYVAEFWNTIS--NLAMIIPPILAGIKAYQEKLETRYVVSFFSILVVGIGSWC 79

Query: 252 FHGTMLFSTQLFDELPMVWCSLIQLFVLLRMQDFKDDKQSSWSLILDDNIAKVLVVFGIV 431
FH T+L+ QLFDELPM+W S I +F L F K + +IL LV++ +
Sbjct: 80 FHMTLLYEMQLFDELPMIWGSCIFVFDL--FHSFTPPKYQNLPMIL------CLVLYSFI 131

Query: 432 WTANAYWIHRQYNIAFQLFFIATTAYGFYLMSDIYHKTNNIHAKRLLVVYFASLGLTGT 608
T A +I + I + + F+ D+ + N+ A ++F +L GT
Sbjct: 132 IT--AVYISIKNPIFHEAAYAVLVFTLFFKSVDMLRQPNSSRA-----LFFTALATYGT 183


>tr|B6P1J1|B6P1J1_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_241023 PE=4 SV=1
Length = 231

Score = 61.6 bits (148), Expect = 3e-08
Identities = 41/126 (32%), Positives = 61/126 (48%)
Frame = +3

Query: 72 EETTLSVLTLAEFWNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDLFVAIIGLGSAA 251
EE + +AEFWN S +L + + E R++V + ++G+GS
Sbjct: 22 EENYVVTEYVAEFWNTIS--NLAMIIPPILAGIKAYQEKLETRYVVSFFSILVVGIGSWC 79

Query: 252 FHGTMLFSTQLFDELPMVWCSLIQLFVLLRMQDFKDDKQSSWSLILDDNIAKVLVVFGIV 431
FH T+L+ QLFDELPM+W S I +F L F K + +IL LV++ +
Sbjct: 80 FHMTLLYEMQLFDELPMIWGSCIFVFDL--FHSFTPPKYQNLPMIL------CLVLYSFI 131

Query: 432 WTANAY 449
TA Y
Sbjct: 132 ITAVIY 137


>tr|B3SCA9|B3SCA9_TRIAD Putative uncharacterized protein
OS=Trichoplax adhaerens GN=TRIADDRAFT_33194 PE=4 SV=1
Length = 277

Score = 57.4 bits (137), Expect(2) = 4e-07
Identities = 31/91 (34%), Positives = 48/91 (52%)
Frame = +3

Query: 72 EETTLSVLTLAEFWNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDLFVAIIGLGSAA 251
EE + +AEFWN S ++F V E F + + + ++G+GS
Sbjct: 27 EENYIVCKYMAEFWNTIS--NIFTIVLPMMGYAMDWSSPLEVHFRLQYVALIVVGIGSWC 84

Query: 252 FHGTMLFSTQLFDELPMVWCSLIQLFVLLRM 344
FHGT+L+ QL DELPM++ S I L+ L ++
Sbjct: 85 FHGTLLYQLQLLDELPMIYGSAIMLYALFQV 115



Score = 20.8 bits (42), Expect(2) = 4e-07
Identities = 6/9 (66%), Positives = 8/9 (88%)
Frame = +1

Query: 37 WGTPTSSID 63
WG PTS++D
Sbjct: 16 WGAPTSTLD 24


>tr|Q8CIG2|Q8CIG2_MOUSE Phca protein OS=Mus musculus GN=Phca PE=2
SV=1
Length = 174

Score = 56.6 bits (135), Expect = 1e-06
Identities = 34/105 (32%), Positives = 52/105 (49%)
Frame = +3

Query: 72 EETTLSVLTLAEFWNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDLFVAIIGLGSAA 251
EE + L +AEFWN S +L + + EKR+I L + ++G+GS
Sbjct: 22 EENYVVTLFVAEFWNTVS--NLIMIIPPIFGAIQGIRDRLEKRYIAAYLALTVVGMGSWC 79

Query: 252 FHGTMLFSTQLFDELPMVWCSLIQLFVLLRMQDFKDDKQSSWSLI 386
FH T+ + QL DELPM++ I FV + FK ++ L+
Sbjct: 80 FHMTLKYEMQLLDELPMIYSCCI--FVYCMFECFKTKSSINYHLL 122


>tr|A9V3Q7|A9V3Q7_MONBE Predicted protein OS=Monosiga brevicollis
GN=37733 PE=4 SV=1
Length = 270

Score = 56.2 bits (134), Expect = 1e-06
Identities = 31/91 (34%), Positives = 51/91 (56%)
Frame = +3

Query: 99 LAEFWNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDLFVAIIGLGSAAFHGTMLFST 278
+AEFWN S +L++ V EKR++ L +A++GLGS FH T+ +
Sbjct: 31 IAEFWNTVS--NLWIMVPSLLGAWHVLQLGLEKRYLFAFLSLAMVGLGSWLFHMTLRWEN 88

Query: 279 QLFDELPMVWCSLIQLFVLLRMQDFKDDKQS 371
QL DELPMV+ + + +F ++ + DK++
Sbjct: 89 QLLDELPMVYSASVMIFGIVDYRWSHPDKRA 119


>tr|A7MBH7|A7MBH7_BOVIN PHCA protein OS=Bos taurus GN=PHCA PE=2 SV=1
Length = 267

Score = 55.8 bits (133), Expect = 2e-06
Identities = 38/122 (31%), Positives = 58/122 (47%)
Frame = +3

Query: 72 EETTLSVLTLAEFWNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDLFVAIIGLGSAA 251
EE +AEFWN S +L + + EKR+I L + ++G+GS
Sbjct: 22 EENYAVTWYIAEFWNTVS--NLIMILPPIFGAMQSVRSGLEKRYIASYLALTVVGMGSWC 79

Query: 252 FHGTMLFSTQLFDELPMVWCSLIQLFVLLRMQDFKDDKQSSWSLILDDNIAKVLVVFGIV 431
FH T+ + QL DELPM++ I FV + FK K ++ L+ LV+F ++
Sbjct: 80 FHMTLKYEMQLLDELPMIYSCCI--FVYCMFECFKMKKSVNYHLLF------TLVLFSLI 131

Query: 432 WT 437
T
Sbjct: 132 VT 133


>tr|Q5XGP2|Q5XGP2_XENLA LOC495272 protein OS=Xenopus laevis GN=phca
PE=2 SV=1
Length = 267

Score = 54.3 bits (129), Expect = 5e-06
Identities = 35/122 (28%), Positives = 61/122 (50%)
Frame = +3

Query: 72 EETTLSVLTLAEFWNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDLFVAIIGLGSAA 251
EE +AEFWN S +L + + E R++V L +A +G+GS
Sbjct: 22 EENYAVTFYIAEFWNTVS--NLIMILPPIFGAIQTVKDGLETRYLVSFLGLAAVGMGSWC 79

Query: 252 FHGTMLFSTQLFDELPMVWCSLIQLFVLLRMQDFKDDKQSSWSLILDDNIAKVLVVFGIV 431
FH T+ + QL DELPM++ + FV + FK+ +++L++ +L++F ++
Sbjct: 80 FHMTLQYEMQLLDELPMIYSCCV--FVYCLYECFKNRNSYNYALLI------LLILFSLI 131

Query: 432 WT 437
T
Sbjct: 132 VT 133


>tr|Q08VK6|Q08VK6_STIAU Alkaline phytoceramidase OS=Stigmatella
aurantiaca DW4/3-1 GN=STIAU_4140 PE=4 SV=1
Length = 203

Score = 54.3 bits (129), Expect = 5e-06
Identities = 21/49 (42%), Positives = 36/49 (73%)
Frame = +3

Query: 192 EKRFIVLDLFVAIIGLGSAAFHGTMLFSTQLFDELPMVWCSLIQLFVLL 338
E+RF+ +A++G+GS FH T+LF Q+ DELPM++ +LI +++L+
Sbjct: 3 ERRFMAAFAMLAVVGIGSIGFHATLLFQLQMLDELPMLYLALIMVYILV 51


>tr|B2RC99|B2RC99_HUMAN cDNA, FLJ95927, Homo sapiens
phytoceramidase, alkaline (PHCA), mRNA (Phytoceramidase,
alkaline, isoform CRA_b) OS=Homo sapiens GN=PHCA PE=2
SV=1
Length = 267

Score = 54.3 bits (129), Expect = 5e-06
Identities = 35/113 (30%), Positives = 55/113 (48%)
Frame = +3

Query: 99 LAEFWNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDLFVAIIGLGSAAFHGTMLFST 278
+AEFWN S +L + + EKR+I L + ++G+GS FH T+ +
Sbjct: 31 IAEFWNTVS--NLIMIIPPMFGAIQSVRDGLEKRYIASYLALTVVGMGSWCFHMTLKYEM 88

Query: 279 QLFDELPMVWCSLIQLFVLLRMQDFKDDKQSSWSLILDDNIAKVLVVFGIVWT 437
QL DELPM++ I FV + FK ++ L+ LV+F ++ T
Sbjct: 89 QLLDELPMIYSCCI--FVYCMFECFKIKNSVNYHLLF------TLVLFSLIVT 133


>tr|A8E5U9|A8E5U9_XENTR LOC100127611 protein OS=Xenopus tropicalis
GN=phca PE=2 SV=1
Length = 267

Score = 53.5 bits (127), Expect = 9e-06
Identities = 38/123 (30%), Positives = 62/123 (50%), Gaps = 1/123 (0%)
Frame = +3

Query: 72 EETTLSVLTLAEFWNDYSTNSLFVFVXXXXXXXXXXXXXSEKRFIVLDLFVAIIGLGSAA 251
EE +AEFWN S +L + + E R++V L +A +GLGS
Sbjct: 22 EENYAVSFYIAEFWNTVS--NLIMILPPIYGAIQTVRDGLETRYLVSYLGLAAVGLGSWC 79

Query: 252 FHGTMLFSTQLFDELPMVW-CSLIQLFVLLRMQDFKDDKQSSWSLILDDNIAKVLVVFGI 428
FH T+ + QL DELPM++ CS +FV + FK+ ++ L++ +L++F +
Sbjct: 80 FHMTLQYEMQLLDELPMIYSCS---VFVYCLYECFKNRNSYNYLLLI------LLILFSL 130

Query: 429 VWT 437
+ T
Sbjct: 131 IVT 133