DK960165
Clone id TST39A01NGRL0006_K19
Library
Length 668
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_K19. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
CTTTACATTCTCTGGGTGATTGTGACGATGCTGTGAAGGAGTTCCAAAAAGCTATAGAGC
TCAAGCAAGATCACATTGAGGTTGCCATCGGCAAAAGACCTTGGGAAGAACTTGGTACGG
ATTATGCCTGCTTTCAAAGAAGTTTAGGTGAAATTCGAGAACGGGCAAATGCAACAAGAA
CACAAGAAGAGGCTTTTGATGCTCACATGGCCATAGGAAGAGCTCTCTTTGAACACAGGC
TCTACAAAGAGGCTCTAGTGAGTTTCAGAAGAGCTACTGAGCTGAAACCCACAGATGTGA
GACCCCATTTTCAGTATGGTAACACATTATACTCATTGGGAAGAATCTCAGAAGCACGGG
AGGCATATACCTTGGCTTTGGATGCAGGGGAAATCAGCAGCAGTCAATGGGGTAGCCTGC
TTCCTCAAATTCATGTCAATCTGGGCATAGCTTTGGAAGGCGAGGGTATGCTTCTTGGTG
CTAGTGAGCACTATAAGGAGGCGGCTATACGTGAACCCAAGCACTATAGAGCTTTGAAGC
ATCTGGGAAGTGCTTTATATGGTGTTGGTGAGTATAGAGCGGCAAAGAAAGCTCTCACAG
AGGCTATTTTTCTGAATCCAGATTATGCAGATGCGCATTGTGATCTTGGTTCCACTTTAC
ATTCTCTG
■■Homology search results ■■ -
sp_hit_id O23052
Definition sp|O23052|Y1515_ARATH Uncharacterized TPR repeat-containing protein At1g05150 OS=Arabidopsis thaliana
Align length 189
Score (bit) 258.0
E-value 2.0e-68
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960165|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_K19, 5'
(668 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O23052|Y1515_ARATH Uncharacterized TPR repeat-containing prot... 258 2e-68
sp|Q8S8L9|Y2245_ARATH Uncharacterized TPR repeat-containing prot... 256 8e-68
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylgluc... 67 9e-11
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylgluc... 67 9e-11
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylgl... 67 9e-11
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylgl... 67 9e-11
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylgl... 64 7e-10
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-... 61 5e-09
sp|Q6ZXV5|TMTC3_HUMAN Transmembrane and TPR repeat-containing pr... 56 2e-07
sp|Q56A06|TMTC2_MOUSE Transmembrane and TPR repeat-containing pr... 54 7e-07
sp|Q3UV71|TMTC1_MOUSE Transmembrane and TPR repeat-containing pr... 52 2e-06
sp|Q8N394|TMTC2_HUMAN Transmembrane and TPR repeat-containing pr... 52 3e-06
sp|Q8BG19|TMTC4_MOUSE Transmembrane and TPR repeat-containing pr... 52 4e-06
sp|Q5T4D3|TMTC4_HUMAN Transmembrane and TPR repeat-containing pr... 51 6e-06
sp|Q6DCD5|TMTC2_XENLA Transmembrane and TPR repeat-containing pr... 51 6e-06
sp|O94556|APC8_SCHPO Anaphase-promoting complex subunit 8 OS=Sch... 51 6e-06
sp|Q7K4B6|TMTC3_DROME Transmembrane and TPR repeat-containing pr... 49 2e-05
sp|Q8IUR5|TMTC1_HUMAN Transmembrane and TPR repeat-containing pr... 48 4e-05
sp|Q20144|TMTC1_CAEEL Transmembrane and TPR repeat-containing pr... 48 4e-05
sp|Q57711|Y941_METJA TPR repeat-containing protein MJ0941 OS=Met... 46 2e-04
sp|P17885|BIMA_EMENI Protein bimA OS=Emericella nidulans GN=bimA... 45 3e-04
sp|Q9VQE9|TMTC1_DROME Transmembrane and TPR repeat-containing pr... 44 6e-04
sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-... 44 6e-04
sp|Q5ZMQ9|PEX5_CHICK Peroxisomal targeting signal 1 receptor OS=... 44 8e-04
sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-... 42 0.003
sp|Q8LP10|SPY_EUSGR Probable UDP-N-acetylglucosamine--peptide N-... 42 0.003
sp|Q9V3X5|TMTC2_DROME Transmembrane and TPR repeat-containing pr... 42 0.004
sp|Q8RVB2|SPY_SOLLC Probable UDP-N-acetylglucosamine--peptide N-... 42 0.004
sp|Q58741|Y1345_METJA TPR repeat-containing protein MJ1345 OS=Me... 41 0.005
sp|O70525|PEX5_CAVPO Peroxisomal targeting signal 1 receptor OS=... 41 0.007

>sp|O23052|Y1515_ARATH Uncharacterized TPR repeat-containing protein
At1g05150 OS=Arabidopsis thaliana GN=At1g05150 PE=1 SV=1
Length = 808

Score = 258 bits (659), Expect = 2e-68
Identities = 124/189 (65%), Positives = 152/189 (80%)
Frame = +3

Query: 102 WEELGTDYACFQRSLGEIRERANATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATE 281
WEE DY F + LG +R +A+ R++EEAFD HMAIGR L+EH+L+KEALVSF+RA E
Sbjct: 203 WEESSHDYGVFVKELGVLRSKADGARSREEAFDGHMAIGRVLYEHQLFKEALVSFKRACE 262

Query: 282 LKPTDVRPHFQYGNTLYSLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEG 461
L+PTDVRPHF+ GN LY LG+ E+++ + LAL+A E +QW LLPQI+VNLGIALEG
Sbjct: 263 LQPTDVRPHFKAGNCLYVLGKCKESKDEFLLALEAAESGGNQWAYLLPQIYVNLGIALEG 322

Query: 462 EGMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHC 641
EGM+L A E+Y+EAAI P H+RALK LGSAL+GVGEYRAA KAL EAI+L PDYADAHC
Sbjct: 323 EGMVLSACEYYREAAILCPTHFRALKLLGSALFGVGEYRAAVKALEEAIYLKPDYADAHC 382

Query: 642 DLGSTLHSL 668
DL S+LHS+
Sbjct: 383 DLASSLHSM 391



Score = 55.1 bits (131), Expect = 3e-07
Identities = 63/216 (29%), Positives = 86/216 (39%), Gaps = 12/216 (5%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIEVAIGKRPWEELGTD-YACFQRSLGEIRERANATR 179
L+ LG C ++ EF A+E + G W L Y +L +A
Sbjct: 278 LYVLGKCKESKDEFLLALEAAES------GGNQWAYLLPQIYVNLGIALEGEGMVLSACE 331

Query: 180 TQEEA-------FDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSL 338
EA F A +G ALF Y+ A+ + A LKP H ++L+S+
Sbjct: 332 YYREAAILCPTHFRALKLLGSALFGVGEYRAAVKALEEAIYLKPDYADAHCDLASSLHSM 391

Query: 339 GRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLG----ASEHYKEAA 506
G A E + A+D L HV+ L G M LG ASE Y
Sbjct: 392 GEDERAIEVFQRAID------------LKPGHVDALYNLGGLYMDLGRFQRASEMYTRVL 439

Query: 507 IREPKHYRALKHLGSALYGVGEYRAAKKALTEAIFL 614
P H+RA + +L G GE AK+AL EA+ L
Sbjct: 440 TVWPNHWRAQLNKAVSLLGAGETEEAKRALKEALKL 475



Score = 42.0 bits (97), Expect = 0.003
Identities = 50/185 (27%), Positives = 71/185 (38%), Gaps = 24/185 (12%)
Frame = +3

Query: 153 IRERANATRTQEEAF-------DAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHF 311
+ E A + EEA DAH + +L + A+ F+RA +LKP V +
Sbjct: 357 VGEYRAAVKALEEAIYLKPDYADAHCDLASSLHSMGEDERAIEVFQRAIDLKPGHVDALY 416

Query: 312 QYGNTLYSLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEH 491
G LGR A E YT L + + W + +N ++L G G A
Sbjct: 417 NLGGLYMDLGRFQRASEMYTRVL---TVWPNHW-----RAQLNKAVSLLGAGETEEAKRA 468

Query: 492 YKEA-----------AIREPKHYRAL--KHLGSALYGVGEYRAAK----KALTEAIFLNP 620
KEA AI KH + K+ G+ G G + + K + E L P
Sbjct: 469 LKEALKLTNRVELHDAISHLKHLQKKKGKNNGNGNGGEGPFIVVEPSKFKTVGEKTTLRP 528

Query: 621 DYADA 635
D A A
Sbjct: 529 DLATA 533


>sp|Q8S8L9|Y2245_ARATH Uncharacterized TPR repeat-containing protein
At2g32450 OS=Arabidopsis thaliana GN=At2g32450 PE=1 SV=1
Length = 802

Score = 256 bits (654), Expect = 8e-68
Identities = 122/189 (64%), Positives = 152/189 (80%)
Frame = +3

Query: 102 WEELGTDYACFQRSLGEIRERANATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATE 281
WEE DY F + LG +R +A+ R++EEAFD HMAIG+ L+EH+L+KEALVSF+RA E
Sbjct: 198 WEESSHDYGVFVKELGVLRSKADGARSREEAFDGHMAIGKVLYEHQLFKEALVSFKRACE 257

Query: 282 LKPTDVRPHFQYGNTLYSLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEG 461
L+PTDVRPHF+ GN LY LG+ E+++ + LAL+A E +QW LLPQI+VNLGI+LEG
Sbjct: 258 LQPTDVRPHFKAGNCLYVLGKYKESKDEFLLALEAAESGGNQWAYLLPQIYVNLGISLEG 317

Query: 462 EGMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHC 641
EGM+L A E+Y+EAAI P HYRALK LGSAL+GVGEYRAA KAL EAI+L PDYADAHC
Sbjct: 318 EGMVLSACEYYREAAILCPTHYRALKLLGSALFGVGEYRAAVKALEEAIYLKPDYADAHC 377

Query: 642 DLGSTLHSL 668
DL S+LH++
Sbjct: 378 DLASSLHAM 386



Score = 52.0 bits (123), Expect = 3e-06
Identities = 43/136 (31%), Positives = 60/136 (44%), Gaps = 4/136 (2%)
Frame = +3

Query: 213 IGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLALDAGE 392
+G ALF Y+ A+ + A LKP H ++L+++G A E + A+D
Sbjct: 345 LGSALFGVGEYRAAVKALEEAIYLKPDYADAHCDLASSLHAMGEDERAIEVFQRAID--- 401

Query: 393 ISSSQWGSLLPQIHVNLGIALEGEGMLLG----ASEHYKEAAIREPKHYRALKHLGSALY 560
L HV+ L G M LG ASE Y P H+RA + +L
Sbjct: 402 ---------LKPGHVDALYNLGGLYMDLGRFQRASEMYTRVLAVWPNHWRAQLNKAVSLL 452

Query: 561 GVGEYRAAKKALTEAI 608
G GE AK+AL EA+
Sbjct: 453 GAGETEEAKRALKEAL 468



Score = 31.2 bits (69), Expect = 5.2
Identities = 11/26 (42%), Positives = 21/26 (80%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIE 80
LH++G+ + A++ FQ+AI+LK H++
Sbjct: 383 LHAMGEDERAIEVFQRAIDLKPGHVD 408


>sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide
N-acetylglucosaminyltransferase 110 kDa subunit
OS=Rattus norvegicus GN=Ogt PE=1 SV=1
Length = 1036

Score = 67.0 bits (162), Expect = 9e-11
Identities = 72/281 (25%), Positives = 109/281 (38%), Gaps = 64/281 (22%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIEVAIGKRPWEELGTDYACFQRSLGEI----RERAN 170
L +LG ++A + KAIE Q + VA W LG C + GEI
Sbjct: 157 LKALGRLEEAKACYLKAIET-QPNFAVA-----WSNLG----CVFNAQGEIWLAIHHFEK 206

Query: 171 ATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPT------------------- 293
A DA++ +G L E R++ A+ ++ RA L P
Sbjct: 207 AVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLID 266

Query: 294 ----------DVRPHF-----QYGNTLYSLGRISEAREAYTLAL---------------- 380
+++PHF N L G ++EA + Y AL
Sbjct: 267 LAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANI 326

Query: 381 --DAGEISSS-----QWGSLLPQI---HVNLGIALEGEGMLLGASEHYKEAAIREPKHYR 530
+ G I + + + P+ H NL L+ +G L A HYKEA P
Sbjct: 327 KREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFAD 386

Query: 531 ALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDLGS 653
A ++G+ L + + + A + T AI +NP +ADAH +L S
Sbjct: 387 AYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLAS 427



Score = 53.5 bits (127), Expect = 1e-06
Identities = 42/154 (27%), Positives = 68/154 (44%)
Frame = +3

Query: 198 DAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLA 377
+A+ +G E +EA+ +R A LKP + + L + G + A +AY A
Sbjct: 80 EAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSA 139

Query: 378 LDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLGSAL 557
L Q+ L + +LG L+ G L A Y +A +P A +LG
Sbjct: 140 L--------QYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVF 191

Query: 558 YGVGEYRAAKKALTEAIFLNPDYADAHCDLGSTL 659
GE A +A+ L+P++ DA+ +LG+ L
Sbjct: 192 NAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL 225



Score = 53.1 bits (126), Expect = 1e-06
Identities = 40/165 (24%), Positives = 71/165 (43%)
Frame = +3

Query: 153 IRERANATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLY 332
I +A R + + D ++ + AL + A+ ++ A + P GN L
Sbjct: 99 IEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLK 158

Query: 333 SLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIR 512
+LGR+ EA+ Y A++ + W NLG +G + A H+++A
Sbjct: 159 ALGRLEEAKACYLKAIETQPNFAVAWS--------NLGCVFNAQGEIWLAIHHFEKAVTL 210

Query: 513 EPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDL 647
+P A +LG+ L + A A A+ L+P++A H +L
Sbjct: 211 DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNL 255



Score = 47.0 bits (110), Expect = 9e-05
Identities = 28/84 (33%), Positives = 40/84 (47%)
Frame = +3

Query: 417 LLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKAL 596
LL + + NLG + G L A EHY+ A +P +L +AL G+ A +A
Sbjct: 77 LLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAY 136

Query: 597 TEAIFLNPDYADAHCDLGSTLHSL 668
A+ NPD DLG+ L +L
Sbjct: 137 VSALQYNPDLYCVRSDLGNLLKAL 160


>sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide
N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus
scrofa GN=OGT PE=2 SV=1
Length = 1046

Score = 67.0 bits (162), Expect = 9e-11
Identities = 72/281 (25%), Positives = 109/281 (38%), Gaps = 64/281 (22%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIEVAIGKRPWEELGTDYACFQRSLGEI----RERAN 170
L +LG ++A + KAIE Q + VA W LG C + GEI
Sbjct: 167 LKALGRLEEAKACYLKAIET-QPNFAVA-----WSNLG----CVFNAQGEIWLAIHHFEK 216

Query: 171 ATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPT------------------- 293
A DA++ +G L E R++ A+ ++ RA L P
Sbjct: 217 AVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLID 276

Query: 294 ----------DVRPHF-----QYGNTLYSLGRISEAREAYTLAL---------------- 380
+++PHF N L G ++EA + Y AL
Sbjct: 277 LAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANI 336

Query: 381 --DAGEISSS-----QWGSLLPQI---HVNLGIALEGEGMLLGASEHYKEAAIREPKHYR 530
+ G I + + + P+ H NL L+ +G L A HYKEA P
Sbjct: 337 KREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFAD 396

Query: 531 ALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDLGS 653
A ++G+ L + + + A + T AI +NP +ADAH +L S
Sbjct: 397 AYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLAS 437



Score = 53.5 bits (127), Expect = 1e-06
Identities = 42/154 (27%), Positives = 68/154 (44%)
Frame = +3

Query: 198 DAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLA 377
+A+ +G E +EA+ +R A LKP + + L + G + A +AY A
Sbjct: 90 EAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSA 149

Query: 378 LDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLGSAL 557
L Q+ L + +LG L+ G L A Y +A +P A +LG
Sbjct: 150 L--------QYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVF 201

Query: 558 YGVGEYRAAKKALTEAIFLNPDYADAHCDLGSTL 659
GE A +A+ L+P++ DA+ +LG+ L
Sbjct: 202 NAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL 235



Score = 53.1 bits (126), Expect = 1e-06
Identities = 40/165 (24%), Positives = 71/165 (43%)
Frame = +3

Query: 153 IRERANATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLY 332
I +A R + + D ++ + AL + A+ ++ A + P GN L
Sbjct: 109 IEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLK 168

Query: 333 SLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIR 512
+LGR+ EA+ Y A++ + W NLG +G + A H+++A
Sbjct: 169 ALGRLEEAKACYLKAIETQPNFAVAWS--------NLGCVFNAQGEIWLAIHHFEKAVTL 220

Query: 513 EPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDL 647
+P A +LG+ L + A A A+ L+P++A H +L
Sbjct: 221 DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNL 265



Score = 47.0 bits (110), Expect = 9e-05
Identities = 28/84 (33%), Positives = 40/84 (47%)
Frame = +3

Query: 417 LLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKAL 596
LL + + NLG + G L A EHY+ A +P +L +AL G+ A +A
Sbjct: 87 LLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAY 146

Query: 597 TEAIFLNPDYADAHCDLGSTLHSL 668
A+ NPD DLG+ L +L
Sbjct: 147 VSALQYNPDLYCVRSDLGNLLKAL 170


>sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide
N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus
musculus GN=Ogt PE=1 SV=2
Length = 1046

Score = 67.0 bits (162), Expect = 9e-11
Identities = 72/281 (25%), Positives = 109/281 (38%), Gaps = 64/281 (22%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIEVAIGKRPWEELGTDYACFQRSLGEI----RERAN 170
L +LG ++A + KAIE Q + VA W LG C + GEI
Sbjct: 167 LKALGRLEEAKACYLKAIET-QPNFAVA-----WSNLG----CVFNAQGEIWLAIHHFEK 216

Query: 171 ATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPT------------------- 293
A DA++ +G L E R++ A+ ++ RA L P
Sbjct: 217 AVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLID 276

Query: 294 ----------DVRPHF-----QYGNTLYSLGRISEAREAYTLAL---------------- 380
+++PHF N L G ++EA + Y AL
Sbjct: 277 LAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANI 336

Query: 381 --DAGEISSS-----QWGSLLPQI---HVNLGIALEGEGMLLGASEHYKEAAIREPKHYR 530
+ G I + + + P+ H NL L+ +G L A HYKEA P
Sbjct: 337 KREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFAD 396

Query: 531 ALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDLGS 653
A ++G+ L + + + A + T AI +NP +ADAH +L S
Sbjct: 397 AYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLAS 437



Score = 53.5 bits (127), Expect = 1e-06
Identities = 42/154 (27%), Positives = 68/154 (44%)
Frame = +3

Query: 198 DAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLA 377
+A+ +G E +EA+ +R A LKP + + L + G + A +AY A
Sbjct: 90 EAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSA 149

Query: 378 LDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLGSAL 557
L Q+ L + +LG L+ G L A Y +A +P A +LG
Sbjct: 150 L--------QYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVF 201

Query: 558 YGVGEYRAAKKALTEAIFLNPDYADAHCDLGSTL 659
GE A +A+ L+P++ DA+ +LG+ L
Sbjct: 202 NAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL 235



Score = 53.1 bits (126), Expect = 1e-06
Identities = 40/165 (24%), Positives = 71/165 (43%)
Frame = +3

Query: 153 IRERANATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLY 332
I +A R + + D ++ + AL + A+ ++ A + P GN L
Sbjct: 109 IEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLK 168

Query: 333 SLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIR 512
+LGR+ EA+ Y A++ + W NLG +G + A H+++A
Sbjct: 169 ALGRLEEAKACYLKAIETQPNFAVAWS--------NLGCVFNAQGEIWLAIHHFEKAVTL 220

Query: 513 EPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDL 647
+P A +LG+ L + A A A+ L+P++A H +L
Sbjct: 221 DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNL 265



Score = 47.0 bits (110), Expect = 9e-05
Identities = 28/84 (33%), Positives = 40/84 (47%)
Frame = +3

Query: 417 LLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKAL 596
LL + + NLG + G L A EHY+ A +P +L +AL G+ A +A
Sbjct: 87 LLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAY 146

Query: 597 TEAIFLNPDYADAHCDLGSTLHSL 668
A+ NPD DLG+ L +L
Sbjct: 147 VSALQYNPDLYCVRSDLGNLLKAL 170


>sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide
N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo
sapiens GN=OGT PE=1 SV=3
Length = 1046

Score = 67.0 bits (162), Expect = 9e-11
Identities = 72/281 (25%), Positives = 109/281 (38%), Gaps = 64/281 (22%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIEVAIGKRPWEELGTDYACFQRSLGEI----RERAN 170
L +LG ++A + KAIE Q + VA W LG C + GEI
Sbjct: 167 LKALGRLEEAKACYLKAIET-QPNFAVA-----WSNLG----CVFNAQGEIWLAIHHFEK 216

Query: 171 ATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPT------------------- 293
A DA++ +G L E R++ A+ ++ RA L P
Sbjct: 217 AVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLID 276

Query: 294 ----------DVRPHF-----QYGNTLYSLGRISEAREAYTLAL---------------- 380
+++PHF N L G ++EA + Y AL
Sbjct: 277 LAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANI 336

Query: 381 --DAGEISSS-----QWGSLLPQI---HVNLGIALEGEGMLLGASEHYKEAAIREPKHYR 530
+ G I + + + P+ H NL L+ +G L A HYKEA P
Sbjct: 337 KREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFAD 396

Query: 531 ALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDLGS 653
A ++G+ L + + + A + T AI +NP +ADAH +L S
Sbjct: 397 AYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLAS 437



Score = 53.5 bits (127), Expect = 1e-06
Identities = 42/154 (27%), Positives = 68/154 (44%)
Frame = +3

Query: 198 DAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLA 377
+A+ +G E +EA+ +R A LKP + + L + G + A +AY A
Sbjct: 90 EAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSA 149

Query: 378 LDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLGSAL 557
L Q+ L + +LG L+ G L A Y +A +P A +LG
Sbjct: 150 L--------QYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVF 201

Query: 558 YGVGEYRAAKKALTEAIFLNPDYADAHCDLGSTL 659
GE A +A+ L+P++ DA+ +LG+ L
Sbjct: 202 NAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL 235



Score = 53.1 bits (126), Expect = 1e-06
Identities = 40/165 (24%), Positives = 71/165 (43%)
Frame = +3

Query: 153 IRERANATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLY 332
I +A R + + D ++ + AL + A+ ++ A + P GN L
Sbjct: 109 IEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLK 168

Query: 333 SLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIR 512
+LGR+ EA+ Y A++ + W NLG +G + A H+++A
Sbjct: 169 ALGRLEEAKACYLKAIETQPNFAVAWS--------NLGCVFNAQGEIWLAIHHFEKAVTL 220

Query: 513 EPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDL 647
+P A +LG+ L + A A A+ L+P++A H +L
Sbjct: 221 DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNL 265



Score = 47.0 bits (110), Expect = 9e-05
Identities = 28/84 (33%), Positives = 40/84 (47%)
Frame = +3

Query: 417 LLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKAL 596
LL + + NLG + G L A EHY+ A +P +L +AL G+ A +A
Sbjct: 87 LLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAY 146

Query: 597 TEAIFLNPDYADAHCDLGSTLHSL 668
A+ NPD DLG+ L +L
Sbjct: 147 VSALQYNPDLYCVRSDLGNLLKAL 170


>sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide
N-acetylglucosaminyltransferase OS=Caenorhabditis
elegans GN=ogt-1 PE=1 SV=2
Length = 1151

Score = 63.9 bits (154), Expect = 7e-10
Identities = 49/155 (31%), Positives = 68/155 (43%), Gaps = 3/155 (1%)
Frame = +3

Query: 198 DAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLA 377
DA+ + AL E EA + +A EL PT N G+I +A Y A
Sbjct: 398 DAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKA 457

Query: 378 LDAGEISSSQWGSLLPQI---HVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLG 548
L+ + P+ H NL L+ +G L A HYKEA P A ++G
Sbjct: 458 LE-----------IYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMG 506

Query: 549 SALYGVGEYRAAKKALTEAIFLNPDYADAHCDLGS 653
+ L +G+ AA AI +NP +ADAH +L S
Sbjct: 507 NTLKEMGDSSAAIACYNRAIQINPAFADAHSNLAS 541



Score = 61.2 bits (147), Expect = 5e-09
Identities = 59/223 (26%), Positives = 92/223 (41%), Gaps = 4/223 (1%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIEVAIGKRPWEELGTDYACFQRSLGEI----RERAN 170
L ++G ++A + KAIE Q VA W LG C S GEI
Sbjct: 271 LKAMGRLEEAKVCYLKAIET-QPQFAVA-----WSNLG----CVFNSQGEIWLAIHHFEK 320

Query: 171 ATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRIS 350
A DA++ +G L E R++ A+ ++ RA L H Y G I
Sbjct: 321 AVTLDPNFLDAYINLGNVLKEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYEQGLID 380

Query: 351 EAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYR 530
A + Y A+D P + NL AL+ +G ++ A + Y +A P H
Sbjct: 381 LAIDTYKKAIDLQPH--------FPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHAD 432

Query: 531 ALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDLGSTL 659
+ +L + G+ A + +A+ + P++A AH +L S L
Sbjct: 433 SQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASIL 475



Score = 53.9 bits (128), Expect = 7e-07
Identities = 38/159 (23%), Positives = 71/159 (44%)
Frame = +3

Query: 171 ATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRIS 350
A + + E DA++ + AL ++A+ ++ A ++ P GN L ++GR+
Sbjct: 219 AVKLKPEFIDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLE 278

Query: 351 EAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYR 530
EA+ Y A++ + W NLG +G + A H+++A +P
Sbjct: 279 EAKVCYLKAIETQPQFAVAWS--------NLGCVFNSQGEIWLAIHHFEKAVTLDPNFLD 330

Query: 531 ALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDL 647
A +LG+ L + A A A+ L+ ++A H +L
Sbjct: 331 AYINLGNVLKEARIFDRAVSAYLRALNLSGNHAVVHGNL 369



Score = 52.0 bits (123), Expect = 3e-06
Identities = 43/163 (26%), Positives = 73/163 (44%)
Frame = +3

Query: 171 ATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRIS 350
A + + +A+ +G E ++AL +++ A +LKP + + L S G +
Sbjct: 185 AIKVNNQCAEAYSNLGNYYKEKGQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDLE 244

Query: 351 EAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYR 530
+A AY AL Q L + +LG L+ G L A Y +A +P+
Sbjct: 245 QAVTAYFNAL--------QINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAV 296

Query: 531 ALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDLGSTL 659
A +LG GE A +A+ L+P++ DA+ +LG+ L
Sbjct: 297 AWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL 339



Score = 41.6 bits (96), Expect = 0.004
Identities = 26/81 (32%), Positives = 41/81 (50%)
Frame = +3

Query: 426 QIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKALTEA 605
+ + NLG + +G L A E+YK A +P+ A +L +AL G+ A A A
Sbjct: 194 EAYSNLGNYYKEKGQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDLEQAVTAYFNA 253

Query: 606 IFLNPDYADAHCDLGSTLHSL 668
+ +NPD DLG+ L ++
Sbjct: 254 LQINPDLYCVRSDLGNLLKAM 274


>sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide
N-acetylglucosaminyltransferase SEC OS=Arabidopsis
thaliana GN=SEC PE=2 SV=1
Length = 977

Score = 61.2 bits (147), Expect = 5e-09
Identities = 62/247 (25%), Positives = 96/247 (38%), Gaps = 34/247 (13%)
Frame = +3

Query: 15 GDCDDAVKEFQKAIELKQDHIEVAIGKRPWEELGTDYA----------CFQRSL------ 146
GD D A++ + AIEL+ + + W L + Y C Q++L
Sbjct: 135 GDTDRAIRYYLIAIELRPNFADA------WSNLASAYMRKGRLSEATQCCQQALSLNPLL 188

Query: 147 --------------GEIRERAN----ATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRR 272
G I E + A R Q A + E AL ++
Sbjct: 189 VDAHSNLGNLMKAQGLIHEAYSCYLEAVRIQPTFAIAWSNLAGLFMESGDLNRALQYYKE 248

Query: 273 ATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIA 452
A +LKP + GN +LGR +EA Y AL S+ +G N+
Sbjct: 249 AVKLKPAFPDAYLNLGNVYKALGRPTEAIMCYQHALQMRPNSAMAFG--------NIASI 300

Query: 453 LEGEGMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYAD 632
+G L A HYK+A R+P+ A +LG+AL +G A + + + L P++
Sbjct: 301 YYEQGQLDLAIRHYKQALSRDPRFLEAYNNLGNALKDIGRVDEAVRCYNQCLALQPNHPQ 360

Query: 633 AHCDLGS 653
A +LG+
Sbjct: 361 AMANLGN 367



Score = 48.1 bits (113), Expect = 4e-05
Identities = 43/172 (25%), Positives = 68/172 (39%)
Frame = +3

Query: 153 IRERANATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLY 332
I A R Q + + + + A E A+ + A EL+P +
Sbjct: 107 IARNEEALRIQPQFAECYGNMANAWKEKGDTDRAIRYYLIAIELRPNFADAWSNLASAYM 166

Query: 333 SLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIR 512
GR+SEA + AL LL H NLG ++ +G++ A Y EA
Sbjct: 167 RKGRLSEATQCCQQALSLNP--------LLVDAHSNLGNLMKAQGLIHEAYSCYLEAVRI 218

Query: 513 EPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDLGSTLHSL 668
+P A +L G+ A + EA+ L P + DA+ +LG+ +L
Sbjct: 219 QPTFAIAWSNLAGLFMESGDLNRALQYYKEAVKLKPAFPDAYLNLGNVYKAL 270



Score = 43.1 bits (100), Expect = 0.001
Identities = 52/239 (21%), Positives = 88/239 (36%), Gaps = 26/239 (10%)
Frame = +3

Query: 15 GDCDDAVKEFQKAIELKQDHIEVAIGKRPWEELGTDYACFQRSLGEIRERANATRTQEEA 194
GD + A++ +++A++LK + + LG Y R I +A + + +
Sbjct: 237 GDLNRALQYYKEAVKLKPAFPDAYLN------LGNVYKALGRPTEAIMCYQHALQMRPNS 290

Query: 195 FDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYT- 371
A I +E A+ +++A P + + GN L +GR+ EA Y
Sbjct: 291 AMAFGNIASIYYEQGQLDLAIRHYKQALSRDPRFLEAYNNLGNALKDIGRVDEAVRCYNQ 350

Query: 372 -LALDAGEISS--------SQWGSLLPQIHV----------------NLGIALEGEGMLL 476
LAL + +W + P + NL I + +G
Sbjct: 351 CLALQPNHPQAMANLGNIYMEWNMMGPASSLFKATLAVTTGLSAPFNNLAIIYKQQGNYS 410

Query: 477 GASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDLGS 653
A Y E +P AL + G+ +G A + AI P A+AH +L S
Sbjct: 411 DAISCYNEVLRIDPLAADALVNRGNTYKEIGRVTEAIQDYMHAINFRPTMAEAHANLAS 469



Score = 40.0 bits (92), Expect = 0.011
Identities = 38/176 (21%), Positives = 71/176 (40%), Gaps = 4/176 (2%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIEVAIGK----RPWEELGTDYACFQRSLGEIRERAN 170
L +G D+AV+ + + + L+ +H + W +G + F+ +L
Sbjct: 335 LKDIGRVDEAVRCYNQCLALQPNHPQAMANLGNIYMEWNMMGPASSLFKATL-------- 386

Query: 171 ATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRIS 350
A T A ++AI + Y +A+ + + P GNT +GR++
Sbjct: 387 AVTTGLSAPFNNLAI--IYKQQGNYSDAISCYNEVLRIDPLAADALVNRGNTYKEIGRVT 444

Query: 351 EAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREP 518
EA + Y A++ + + + H NL A + G + A YK+A + P
Sbjct: 445 EAIQDYMHAIN--------FRPTMAEAHANLASAYKDSGHVEAAITSYKQALLLRP 492



Score = 37.4 bits (85), Expect = 0.073
Identities = 46/195 (23%), Positives = 69/195 (35%), Gaps = 26/195 (13%)
Frame = +3

Query: 153 IRERANATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLY 332
IR A +A+ +G AL + EA+ + + L+P + GN
Sbjct: 311 IRHYKQALSRDPRFLEAYNNLGNALKDIGRVDEAVRCYNQCLALQPNHPQAMANLGNIYM 370

Query: 333 SLGRISEAREAY--TLALDAG--------EISSSQWGSLLPQIH---------------- 434
+ A + TLA+ G I Q G+ I
Sbjct: 371 EWNMMGPASSLFKATLAVTTGLSAPFNNLAIIYKQQGNYSDAISCYNEVLRIDPLAADAL 430

Query: 435 VNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKALTEAIFL 614
VN G + G + A + Y A P A +L SA G AA + +A+ L
Sbjct: 431 VNRGNTYKEIGRVTEAIQDYMHAINFRPTMAEAHANLASAYKDSGHVEAAITSYKQALLL 490

Query: 615 NPDYADAHCDLGSTL 659
PD+ +A C+L TL
Sbjct: 491 RPDFPEATCNLLHTL 505


>sp|Q6ZXV5|TMTC3_HUMAN Transmembrane and TPR repeat-containing
protein 3 OS=Homo sapiens GN=TMTC3 PE=1 SV=2
Length = 915

Score = 56.2 bits (134), Expect = 2e-07
Identities = 42/147 (28%), Positives = 70/147 (47%), Gaps = 7/147 (4%)
Frame = +3

Query: 213 IGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLA--LDA 386
+G AL + ++ AL F +AT ++P D+ H G T +L R EA E+Y +A L
Sbjct: 452 VGHALENEKNFERALKYFLQATHVQPDDIGAHMNVGRTYKNLNRTKEAEESYMMAKSLMP 511

Query: 387 GEISSSQWGSLLPQIHVNLGIAL-----EGEGMLLGASEHYKEAAIREPKHYRALKHLGS 551
I ++ + + H+N+ I L E L A + Y++A P +A G
Sbjct: 512 QIIPGKKYAARIAPNHLNVYINLANLIRANESRLEEADQLYRQAISMRPDFKQAYISRGE 571

Query: 552 ALYGVGEYRAAKKALTEAIFLNPDYAD 632
L + + AK+A +A+ L+ + AD
Sbjct: 572 LLLKMNKPLKAKEAYLKALELDRNNAD 598


>sp|Q56A06|TMTC2_MOUSE Transmembrane and TPR repeat-containing protein
2 OS=Mus musculus GN=Tmtc2 PE=2 SV=1
Length = 836

Score = 53.9 bits (128), Expect = 7e-07
Identities = 49/206 (23%), Positives = 88/206 (42%)
Frame = +3

Query: 6 HSLGDCDDAVKEFQKAIELKQDHIEVAIGKRPWEELGTDYACFQRSLGEIRERANATRTQ 185
H G ++A+ +++AI+ H + + +G Y + + R++
Sbjct: 617 HEQGRYEEALSVYREAIQKMPRHFAP---QSLYNMMGEAYMRLSKLPEAEHWYMESLRSK 673

Query: 186 EEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREA 365
+ AH+ G+ L EA F +A EL PT + YG L R++EA E
Sbjct: 674 TDHIPAHLTYGKLLALTGRKSEAEKFFLKAIELDPTKGNCYMHYGQFLLEESRLTEAAE- 732

Query: 366 YTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHL 545
+A A E+ ++++ + H+ L + A ++Y AA P + AL +L
Sbjct: 733 --MAKKAAELDNTEFDVVFNAAHM-----LRQASLNEAAEKYYDLAARLRPNYPAALMNL 785

Query: 546 GSALYGVGEYRAAKKALTEAIFLNPD 623
G+ L+ G + A+ A+ L PD
Sbjct: 786 GAILHLNGRLQKAEANYLRALQLKPD 811



Score = 38.9 bits (89), Expect = 0.025
Identities = 48/203 (23%), Positives = 75/203 (36%), Gaps = 15/203 (7%)
Frame = +3

Query: 96 RPWEELGTDYACFQRSLGEIRERANATRT----QEEAFDAHMAIGRALFEHRLYKEALVS 263
+ W LG +S +I E +A R + D +G L E+ + EAL
Sbjct: 494 KAWGNLGN----VLKSQSKISEAESAYRNALFYRSNMADMLYNLGLLLQENSRFAEALHY 549

Query: 264 FRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLALDAGEISSSQWGSLLPQIH--- 434
++ A +PT + G L + G+ EAR + L EI P H
Sbjct: 550 YKLAIGSRPTLASAYLNTGIILMNQGKTEEARRTF---LKCSEIPDENLKD--PHAHKSS 604

Query: 435 -----VNLGIALEGEGMLLGASEHYKEAAIREPKHY---RALKHLGSALYGVGEYRAAKK 590
NLG +G A Y+EA + P+H+ +G A + + A+
Sbjct: 605 VTSCLYNLGKLYHEQGRYEEALSVYREAIQKMPRHFAPQSLYNMMGEAYMRLSKLPEAEH 664

Query: 591 ALTEAIFLNPDYADAHCDLGSTL 659
E++ D+ AH G L
Sbjct: 665 WYMESLRSKTDHIPAHLTYGKLL 687


tr_hit_id Q10NP2
Definition tr|Q10NP2|Q10NP2_ORYSJ Os03g0263900 protein OS=Oryza sativa subsp. japonica
Align length 190
Score (bit) 264.0
E-value 3.0e-69
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960165|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_K19, 5'
(668 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q10NP2|Q10NP2_ORYSJ Os03g0263900 protein OS=Oryza sativa subs... 264 3e-69
tr|A3AGB6|A3AGB6_ORYSJ Putative uncharacterized protein OS=Oryza... 264 3e-69
tr|A2XET8|A2XET8_ORYSI Putative uncharacterized protein OS=Oryza... 264 3e-69
tr|B6SSY1|B6SSY1_MAIZE Calcium ion binding protein OS=Zea mays P... 260 5e-68
tr|A7NT17|A7NT17_VITVI Chromosome chr18 scaffold_1, whole genome... 255 2e-66
tr|A5B7X4|A5B7X4_VITVI Putative uncharacterized protein OS=Vitis... 255 2e-66
tr|A9RZU2|A9RZU2_PHYPA Predicted protein OS=Physcomitrella paten... 247 4e-64
tr|A9RQR3|A9RQR3_PHYPA Predicted protein OS=Physcomitrella paten... 247 5e-64
tr|B2J9B9|B2J9B9_NOSP7 TPR repeat-containing protein OS=Nostoc p... 99 2e-19
tr|Q46IU5|Q46IU5_PROMT TPR repeat OS=Prochlorococcus marinus (st... 91 6e-17
tr|Q6SGF9|Q6SGF9_9BACT TPR domain/sulfotransferase domain protei... 91 8e-17
tr|Q46J82|Q46J82_PROMT TPR repeat OS=Prochlorococcus marinus (st... 89 2e-16
tr|Q6SGF8|Q6SGF8_9BACT TPR domain protein OS=uncultured marine b... 87 9e-16
tr|B1G1U7|B1G1U7_9BURK TPR repeat-containing protein OS=Burkhold... 87 1e-15
tr|Q6SES5|Q6SES5_9BACT TPR repeat protein OS=uncultured marine b... 84 6e-15
tr|Q46IU4|Q46IU4_PROMT TPR repeat OS=Prochlorococcus marinus (st... 83 2e-14
tr|Q6SES4|Q6SES4_9BACT TPR repeat protein OS=uncultured marine b... 82 2e-14
tr|B4VVQ3|B4VVQ3_9CYAN Tetratricopeptide repeat family OS=Microc... 82 2e-14
tr|A2CCD1|A2CCD1_PROM3 Putative uncharacterized protein OS=Proch... 82 4e-14
tr|B4C1J7|B4C1J7_9CHRO TPR repeat-containing protein OS=Cyanothe... 82 4e-14
tr|A2BZH7|A2BZH7_PROM1 Putative uncharacterized protein OS=Proch... 81 7e-14
tr|B7K3M3|B7K3M3_SYNP8 TPR repeat-containing protein OS=Synechoc... 81 7e-14
tr|B4D7S1|B4D7S1_9BACT TPR repeat-containing protein OS=Chthonio... 81 7e-14
tr|Q46IF5|Q46IF5_PROMT TPR repeat OS=Prochlorococcus marinus (st... 80 1e-13
tr|A7I7H9|A7I7H9_METB6 TPR repeat-containing protein OS=Methanor... 80 1e-13
tr|Q46H61|Q46H61_PROMT TPR repeat OS=Prochlorococcus marinus (st... 79 2e-13
tr|B4D6D8|B4D6D8_9BACT TPR repeat-containing protein OS=Chthonio... 79 2e-13
tr|B5WAZ0|B5WAZ0_9BURK TPR repeat-containing protein OS=Burkhold... 79 3e-13
tr|Q6SGE6|Q6SGE6_9BACT TPR domain protein OS=uncultured marine b... 79 3e-13
tr|B7K9Z0|B7K9Z0_9CHRO Tetratricopeptide TPR_2 repeat protein OS... 79 3e-13

>tr|Q10NP2|Q10NP2_ORYSJ Os03g0263900 protein OS=Oryza sativa subsp.
japonica GN=Os03g0263900 PE=4 SV=1
Length = 848

Score = 264 bits (675), Expect = 3e-69
Identities = 130/190 (68%), Positives = 153/190 (80%)
Frame = +3

Query: 99 PWEELGTDYACFQRSLGEIRERANATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRAT 278
PW+E DY F + L +R RA+A+R++EEAFD HM IGRAL EHRL+++AL SFRRA
Sbjct: 242 PWDETSRDYLTFVKELAVLRTRADASRSREEAFDNHMVIGRALSEHRLFRDALSSFRRAC 301

Query: 279 ELKPTDVRPHFQYGNTLYSLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALE 458
EL+PTDVRPHF+ GN LY+LGR SEA+E Y LAL+A E SQ +LPQIHVNLGIA+E
Sbjct: 302 ELQPTDVRPHFRAGNCLYALGRHSEAKEEYLLALEAAEAGGSQSADILPQIHVNLGIAME 361

Query: 459 GEGMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAH 638
EGM+LGA EHY+EAAI P H RALK LGSAL+GVGEYRAA+KAL EAIFL PDYADAH
Sbjct: 362 AEGMVLGACEHYREAAILCPSHARALKLLGSALFGVGEYRAAEKALEEAIFLKPDYADAH 421

Query: 639 CDLGSTLHSL 668
CDLGS LH++
Sbjct: 422 CDLGSALHAI 431



Score = 50.8 bits (120), Expect = 7e-05
Identities = 41/133 (30%), Positives = 57/133 (42%), Gaps = 2/133 (1%)
Frame = +3

Query: 213 IGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLALDA-- 386
+G ALF Y+ A + A LKP H G+ L+++G A + + A+D
Sbjct: 390 LGSALFGVGEYRAAEKALEEAIFLKPDYADAHCDLGSALHAIGDDDRAVQEFQKAIDLKP 449

Query: 387 GEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLGSALYGV 566
G + + NLG G + A+E Y P H+RA + AL G
Sbjct: 450 GHVDALY----------NLGGLNMDAGRFVRAAEMYTRVLSIRPNHWRAQLNKAVALLGQ 499

Query: 567 GEYRAAKKALTEA 605
GE AKKAL EA
Sbjct: 500 GESEEAKKALKEA 512



Score = 42.4 bits (98), Expect = 0.026
Identities = 36/118 (30%), Positives = 51/118 (43%), Gaps = 2/118 (1%)
Frame = +3

Query: 198 DAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLA 377
DAH +G AL A+ F++A +LKP V + G GR A E YT
Sbjct: 419 DAHCDLGSALHAIGDDDRAVQEFQKAIDLKPGHVDALYNLGGLNMDAGRFVRAAEMYTRV 478

Query: 378 LDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEA--AIREPKHYRALKHL 545
L I + W + +N +AL G+G A + KEA + + Y A+ HL
Sbjct: 479 L---SIRPNHW-----RAQLNKAVALLGQGESEEAKKALKEAFKMTQRVEVYDAISHL 528



Score = 38.5 bits (88), Expect = 0.38
Identities = 16/26 (61%), Positives = 22/26 (84%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIE 80
LH++GD D AV+EFQKAI+LK H++
Sbjct: 428 LHAIGDDDRAVQEFQKAIDLKPGHVD 453


>tr|A3AGB6|A3AGB6_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_009838 PE=4 SV=1
Length = 810

Score = 264 bits (675), Expect = 3e-69
Identities = 130/190 (68%), Positives = 153/190 (80%)
Frame = +3

Query: 99 PWEELGTDYACFQRSLGEIRERANATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRAT 278
PW+E DY F + L +R RA+A+R++EEAFD HM IGRAL EHRL+++AL SFRRA
Sbjct: 204 PWDETSRDYLTFVKELAVLRTRADASRSREEAFDNHMVIGRALSEHRLFRDALSSFRRAC 263

Query: 279 ELKPTDVRPHFQYGNTLYSLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALE 458
EL+PTDVRPHF+ GN LY+LGR SEA+E Y LAL+A E SQ +LPQIHVNLGIA+E
Sbjct: 264 ELQPTDVRPHFRAGNCLYALGRHSEAKEEYLLALEAAEAGGSQSADILPQIHVNLGIAME 323

Query: 459 GEGMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAH 638
EGM+LGA EHY+EAAI P H RALK LGSAL+GVGEYRAA+KAL EAIFL PDYADAH
Sbjct: 324 AEGMVLGACEHYREAAILCPSHARALKLLGSALFGVGEYRAAEKALEEAIFLKPDYADAH 383

Query: 639 CDLGSTLHSL 668
CDLGS LH++
Sbjct: 384 CDLGSALHAI 393



Score = 50.8 bits (120), Expect = 7e-05
Identities = 41/133 (30%), Positives = 57/133 (42%), Gaps = 2/133 (1%)
Frame = +3

Query: 213 IGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLALDA-- 386
+G ALF Y+ A + A LKP H G+ L+++G A + + A+D
Sbjct: 352 LGSALFGVGEYRAAEKALEEAIFLKPDYADAHCDLGSALHAIGDDDRAVQEFQKAIDLKP 411

Query: 387 GEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLGSALYGV 566
G + + NLG G + A+E Y P H+RA + AL G
Sbjct: 412 GHVDALY----------NLGGLNMDAGRFVRAAEMYTRVLSIRPNHWRAQLNKAVALLGQ 461

Query: 567 GEYRAAKKALTEA 605
GE AKKAL EA
Sbjct: 462 GESEEAKKALKEA 474



Score = 42.4 bits (98), Expect = 0.026
Identities = 36/118 (30%), Positives = 51/118 (43%), Gaps = 2/118 (1%)
Frame = +3

Query: 198 DAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLA 377
DAH +G AL A+ F++A +LKP V + G GR A E YT
Sbjct: 381 DAHCDLGSALHAIGDDDRAVQEFQKAIDLKPGHVDALYNLGGLNMDAGRFVRAAEMYTRV 440

Query: 378 LDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEA--AIREPKHYRALKHL 545
L I + W + +N +AL G+G A + KEA + + Y A+ HL
Sbjct: 441 L---SIRPNHW-----RAQLNKAVALLGQGESEEAKKALKEAFKMTQRVEVYDAISHL 490



Score = 38.5 bits (88), Expect = 0.38
Identities = 16/26 (61%), Positives = 22/26 (84%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIE 80
LH++GD D AV+EFQKAI+LK H++
Sbjct: 390 LHAIGDDDRAVQEFQKAIDLKPGHVD 415


>tr|A2XET8|A2XET8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10852 PE=4 SV=1
Length = 848

Score = 264 bits (675), Expect = 3e-69
Identities = 130/190 (68%), Positives = 153/190 (80%)
Frame = +3

Query: 99 PWEELGTDYACFQRSLGEIRERANATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRAT 278
PW+E DY F + L +R RA+A+R++EEAFD HM IGRAL EHRL+++AL SFRRA
Sbjct: 242 PWDETSRDYLTFVKELAVLRTRADASRSREEAFDNHMVIGRALSEHRLFRDALSSFRRAC 301

Query: 279 ELKPTDVRPHFQYGNTLYSLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALE 458
EL+PTDVRPHF+ GN LY+LGR SEA+E Y LAL+A E SQ +LPQIHVNLGIA+E
Sbjct: 302 ELQPTDVRPHFRAGNCLYALGRHSEAKEEYLLALEAAEAGGSQSADILPQIHVNLGIAME 361

Query: 459 GEGMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAH 638
EGM+LGA EHY+EAAI P H RALK LGSAL+GVGEYRAA+KAL EAIFL PDYADAH
Sbjct: 362 AEGMVLGACEHYREAAILCPSHARALKLLGSALFGVGEYRAAEKALEEAIFLKPDYADAH 421

Query: 639 CDLGSTLHSL 668
CDLGS LH++
Sbjct: 422 CDLGSALHAI 431



Score = 50.8 bits (120), Expect = 7e-05
Identities = 41/133 (30%), Positives = 57/133 (42%), Gaps = 2/133 (1%)
Frame = +3

Query: 213 IGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLALDA-- 386
+G ALF Y+ A + A LKP H G+ L+++G A + + A+D
Sbjct: 390 LGSALFGVGEYRAAEKALEEAIFLKPDYADAHCDLGSALHAIGDDDRAVQEFQKAIDLKP 449

Query: 387 GEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLGSALYGV 566
G + + NLG G + A+E Y P H+RA + AL G
Sbjct: 450 GHVDALY----------NLGGLNMDAGRFVRAAEMYTRVLSIRPNHWRAQLNKAVALLGQ 499

Query: 567 GEYRAAKKALTEA 605
GE AKKAL EA
Sbjct: 500 GESEEAKKALKEA 512



Score = 42.4 bits (98), Expect = 0.026
Identities = 36/118 (30%), Positives = 51/118 (43%), Gaps = 2/118 (1%)
Frame = +3

Query: 198 DAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLA 377
DAH +G AL A+ F++A +LKP V + G GR A E YT
Sbjct: 419 DAHCDLGSALHAIGDDDRAVQEFQKAIDLKPGHVDALYNLGGLNMDAGRFVRAAEMYTRV 478

Query: 378 LDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEA--AIREPKHYRALKHL 545
L I + W + +N +AL G+G A + KEA + + Y A+ HL
Sbjct: 479 L---SIRPNHW-----RAQLNKAVALLGQGESEEAKKALKEAFKMTQRVEVYDAISHL 528



Score = 38.5 bits (88), Expect = 0.38
Identities = 16/26 (61%), Positives = 22/26 (84%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIE 80
LH++GD D AV+EFQKAI+LK H++
Sbjct: 428 LHAIGDDDRAVQEFQKAIDLKPGHVD 453


>tr|B6SSY1|B6SSY1_MAIZE Calcium ion binding protein OS=Zea mays PE=2
SV=1
Length = 840

Score = 260 bits (665), Expect = 5e-68
Identities = 128/190 (67%), Positives = 152/190 (80%)
Frame = +3

Query: 99 PWEELGTDYACFQRSLGEIRERANATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRAT 278
PW+E DY F + L +R RA+A+R++EEAFD HM IGRAL EHRL+++AL SFRRA
Sbjct: 234 PWDETSRDYLTFVKELAVLRTRADASRSREEAFDNHMVIGRALSEHRLFRDALASFRRAC 293

Query: 279 ELKPTDVRPHFQYGNTLYSLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALE 458
EL+PTDVRPHF+ GN LY+LGR +EA+E Y LAL+A E SQ +LPQIHVNLGIA+E
Sbjct: 294 ELQPTDVRPHFRAGNCLYALGRHAEAKEEYLLALEAAEAGGSQSADILPQIHVNLGIAME 353

Query: 459 GEGMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAH 638
EGM+LGA EHY+EAAI P H RALK LGSAL+GVGEYRAA+KAL EAIFL DYADAH
Sbjct: 354 AEGMVLGACEHYREAAILCPSHARALKLLGSALFGVGEYRAAEKALEEAIFLKEDYADAH 413

Query: 639 CDLGSTLHSL 668
CDLGS LH++
Sbjct: 414 CDLGSALHAV 423



Score = 47.4 bits (111), Expect = 8e-04
Identities = 39/133 (29%), Positives = 56/133 (42%), Gaps = 2/133 (1%)
Frame = +3

Query: 213 IGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLALDA-- 386
+G ALF Y+ A + A LK H G+ L+++G A + + A+D
Sbjct: 382 LGSALFGVGEYRAAEKALEEAIFLKEDYADAHCDLGSALHAVGEDDRAIQEFQTAIDLKP 441

Query: 387 GEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLGSALYGV 566
G + + NLG G + A+E Y P H+RA + AL G
Sbjct: 442 GHVDALY----------NLGGLNMDAGRFVRAAEMYTRVLSIRPNHWRAQLNKAVALLGQ 491

Query: 567 GEYRAAKKALTEA 605
GE AKKAL +A
Sbjct: 492 GESEEAKKALKDA 504



Score = 42.4 bits (98), Expect = 0.026
Identities = 36/123 (29%), Positives = 53/123 (43%), Gaps = 2/123 (1%)
Frame = +3

Query: 183 QEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEARE 362
+E+ DAH +G AL A+ F+ A +LKP V + G GR A E
Sbjct: 406 KEDYADAHCDLGSALHAVGEDDRAIQEFQTAIDLKPGHVDALYNLGGLNMDAGRFVRAAE 465

Query: 363 AYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEA--AIREPKHYRAL 536
YT L I + W + +N +AL G+G A + K+A + + Y A+
Sbjct: 466 MYTRVL---SIRPNHW-----RAQLNKAVALLGQGESEEAKKALKDAFKMTQRVEVYDAI 517

Query: 537 KHL 545
HL
Sbjct: 518 SHL 520



Score = 33.9 bits (76), Expect = 9.4
Identities = 13/26 (50%), Positives = 21/26 (80%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIE 80
LH++G+ D A++EFQ AI+LK H++
Sbjct: 420 LHAVGEDDRAIQEFQTAIDLKPGHVD 445


>tr|A7NT17|A7NT17_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00014498001
PE=4 SV=1
Length = 818

Score = 255 bits (652), Expect = 2e-66
Identities = 126/189 (66%), Positives = 150/189 (79%)
Frame = +3

Query: 102 WEELGTDYACFQRSLGEIRERANATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATE 281
WEE G DYA F + LG +R +A+ R++EEAFD HMAIGR L+EH+L+KEALVSF+RA E
Sbjct: 197 WEESGHDYALFVKELGVLRTKADGARSREEAFDGHMAIGRVLYEHQLFKEALVSFKRACE 256

Query: 282 LKPTDVRPHFQYGNTLYSLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEG 461
L+P DVR HF+ GN LY LGR EA+E +TLAL+A E +Q LLPQIHVNLGIALEG
Sbjct: 257 LQPVDVRSHFRAGNCLYVLGRHGEAKEEFTLALEAAENGGNQSAYLLPQIHVNLGIALEG 316

Query: 462 EGMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHC 641
EGM++ A EHY+EAAI P H+RALK LGSAL+GVGEYRAA KAL EAIF+ DYADAHC
Sbjct: 317 EGMVMSACEHYREAAILCPTHFRALKLLGSALFGVGEYRAAVKALEEAIFMKADYADAHC 376

Query: 642 DLGSTLHSL 668
DL S LH++
Sbjct: 377 DLASALHAM 385



Score = 47.0 bits (110), Expect = 0.001
Identities = 40/140 (28%), Positives = 58/140 (41%), Gaps = 2/140 (1%)
Frame = +3

Query: 195 FDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYTL 374
F A +G ALF Y+ A+ + A +K H + L+++G +A +
Sbjct: 338 FRALKLLGSALFGVGEYRAAVKALEEAIFMKADYADAHCDLASALHAMGEGEKAIPVFQK 397

Query: 375 ALDA--GEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLG 548
A+D G + + NLG G ASE Y P H+RA +
Sbjct: 398 AIDLKPGHVDALY----------NLGGLYMDMGRFQRASEMYTRVLAVCPNHWRAQLNKA 447

Query: 549 SALYGVGEYRAAKKALTEAI 608
+L G GE AKKAL EA+
Sbjct: 448 VSLLGAGEAEEAKKALKEAL 467


>tr|A5B7X4|A5B7X4_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_011396 PE=4 SV=1
Length = 799

Score = 255 bits (652), Expect = 2e-66
Identities = 126/189 (66%), Positives = 150/189 (79%)
Frame = +3

Query: 102 WEELGTDYACFQRSLGEIRERANATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATE 281
WEE G DYA F + LG +R +A+ R++EEAFD HMAIGR L+EH+L+KEALVSF+RA E
Sbjct: 197 WEESGHDYALFVKELGVLRTKADGARSREEAFDGHMAIGRVLYEHQLFKEALVSFKRACE 256

Query: 282 LKPTDVRPHFQYGNTLYSLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEG 461
L+P DVR HF+ GN LY LGR EA+E +TLAL+A E +Q LLPQIHVNLGIALEG
Sbjct: 257 LQPVDVRSHFRAGNCLYVLGRHGEAKEEFTLALEAAENGGNQSAYLLPQIHVNLGIALEG 316

Query: 462 EGMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHC 641
EGM++ A EHY+EAAI P H+RALK LGSAL+GVGEYRAA KAL EAIF+ DYADAHC
Sbjct: 317 EGMVMSACEHYREAAILCPTHFRALKLLGSALFGVGEYRAAVKALEEAIFMKADYADAHC 376

Query: 642 DLGSTLHSL 668
DL S LH++
Sbjct: 377 DLASALHAM 385



Score = 47.0 bits (110), Expect = 0.001
Identities = 40/140 (28%), Positives = 58/140 (41%), Gaps = 2/140 (1%)
Frame = +3

Query: 195 FDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYTL 374
F A +G ALF Y+ A+ + A +K H + L+++G +A +
Sbjct: 338 FRALKLLGSALFGVGEYRAAVKALEEAIFMKADYADAHCDLASALHAMGEGEKAIPVFQK 397

Query: 375 ALDA--GEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLG 548
A+D G + + NLG G ASE Y P H+RA +
Sbjct: 398 AIDLKPGHVDALY----------NLGGLYMDMGRFQRASEMYTRVLAVCPNHWRAQLNKA 447

Query: 549 SALYGVGEYRAAKKALTEAI 608
+L G GE AKKAL EA+
Sbjct: 448 VSLLGAGEAEEAKKALKEAL 467


>tr|A9RZU2|A9RZU2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_122143 PE=4 SV=1
Length = 817

Score = 247 bits (631), Expect = 4e-64
Identities = 119/187 (63%), Positives = 145/187 (77%)
Frame = +3

Query: 108 ELGTDYACFQRSLGEIRERANATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELK 287
ELGTD F++ L E+R++ T +EAFD HMA+G++LFE R Y++ALVSF+ A +LK
Sbjct: 216 ELGTDLGLFKKELQELRDKVGKVHTPDEAFDGHMAMGKSLFERRWYEDALVSFQLAVQLK 275

Query: 288 PTDVRPHFQYGNTLYSLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEG 467
P DVR HF GN YSLG EAR +Y AL+AGE ++ +W +LPQ+HVNLGIALEGEG
Sbjct: 276 PQDVRAHFLVGNAFYSLGDFVEARTSYQKALEAGEENAQEWEGILPQVHVNLGIALEGEG 335

Query: 468 MLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDL 647
MLL A +HY+EAAI P+HYRALK LGSALYG+GEYRAA+K L EA+ L PDYADAHCDL
Sbjct: 336 MLLCACDHYREAAILNPRHYRALKLLGSALYGLGEYRAAQKCLEEALVLKPDYADAHCDL 395

Query: 648 GSTLHSL 668
GS LHSL
Sbjct: 396 GSALHSL 402



Score = 53.1 bits (126), Expect = 2e-05
Identities = 53/202 (26%), Positives = 85/202 (42%), Gaps = 2/202 (0%)
Frame = +3

Query: 6 HSLGDCDDAVKEFQKAIELKQDHIEVAIGKRPWEELGTDYACFQRS--LGEIRERANATR 179
+SLGD +A +QKA+E +++ + G P + A L A
Sbjct: 290 YSLGDFVEARTSYQKALEAGEENAQEWEGILPQVHVNLGIALEGEGMLLCACDHYREAAI 349

Query: 180 TQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAR 359
+ A +G AL+ Y+ A A LKP H G+ L+SL + +A
Sbjct: 350 LNPRHYRALKLLGSALYGLGEYRAAQKCLEEALVLKPDYADAHCDLGSALHSLHDVEQAI 409

Query: 360 EAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALK 539
+ A+D ++ + +L NLG L+ A+E Y++ +P+ +RA
Sbjct: 410 SEFQKAID---LNPNHVDALY-----NLGGLLKDSLRYERAAEMYQKVIQLKPRDWRAQL 461

Query: 540 HLGSALYGVGEYRAAKKALTEA 605
+ +L G GE AKKA EA
Sbjct: 462 NRAVSLLGAGEQEEAKKAFKEA 483



Score = 39.7 bits (91), Expect = 0.17
Identities = 30/122 (24%), Positives = 46/122 (37%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIEVAIGKRPWEELGTDYACFQRSLGEIRERANATRT 182
LHSL D + A+ EFQKAI+L +H+
Sbjct: 399 LHSLHDVEQAISEFQKAIDLNPNHV----------------------------------- 423

Query: 183 QEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEARE 362
DA +G L + Y+ A +++ +LKP D R +L G EA++
Sbjct: 424 -----DALYNLGGLLKDSLRYERAAEMYQKVIQLKPRDWRAQLNRAVSLLGAGEQEEAKK 478

Query: 363 AY 368
A+
Sbjct: 479 AF 480


>tr|A9RQR3|A9RQR3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_117969 PE=4 SV=1
Length = 809

Score = 247 bits (630), Expect = 5e-64
Identities = 118/192 (61%), Positives = 148/192 (77%)
Frame = +3

Query: 93 KRPWEELGTDYACFQRSLGEIRERANATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRR 272
KR ELGTD+ F++ L E+RER T +EAFD HMA+G++LFE ++AL+SF+
Sbjct: 200 KRGEGELGTDFGVFKKDLQELRERVGKVHTPDEAFDGHMAMGKSLFEREWLEQALISFQL 259

Query: 273 ATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIA 452
A +LKP DVR HF GN+LYSLGR EAR +Y AL+AGE ++ +W +LPQ+HVNLGIA
Sbjct: 260 AVQLKPQDVRAHFLVGNSLYSLGRYEEARTSYQKALEAGEENAQEWQGILPQVHVNLGIA 319

Query: 453 LEGEGMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYAD 632
LEGEGML+ A +HY+EAAI P+HYRALK LGSAL+G+GEYRAA+K L EA+ L PDY D
Sbjct: 320 LEGEGMLMCACDHYREAAILNPRHYRALKLLGSALFGLGEYRAAQKCLEEALVLKPDYTD 379

Query: 633 AHCDLGSTLHSL 668
AHCDLGS LH+L
Sbjct: 380 AHCDLGSALHAL 391



Score = 48.1 bits (113), Expect = 5e-04
Identities = 52/206 (25%), Positives = 85/206 (41%), Gaps = 5/206 (2%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIEVAIGKRPWEELGTDYA-----CFQRSLGEIRERA 167
L+SLG ++A +QKA+E +++ + G P + A + RE
Sbjct: 278 LYSLGRYEEARTSYQKALEAGEENAQEWQGILPQVHVNLGIALEGEGMLMCACDHYRE-- 335

Query: 168 NATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRI 347
A + A +G ALF Y+ A A LKP H G+ L++L
Sbjct: 336 -AAILNPRHYRALKLLGSALFGLGEYRAAQKCLEEALVLKPDYTDAHCDLGSALHALHDD 394

Query: 348 SEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHY 527
+A + +D ++ + +L NLG L+ G A+E Y + P+ +
Sbjct: 395 EQAILEFQKTID---LNPNHVDAL-----YNLGGLLKDSGRYERAAEMYAKVIQLRPRDW 446

Query: 528 RALKHLGSALYGVGEYRAAKKALTEA 605
RA + +L G GE ++KA EA
Sbjct: 447 RAQLNRAVSLLGAGEQEDSRKAFKEA 472


>tr|B2J9B9|B2J9B9_NOSP7 TPR repeat-containing protein OS=Nostoc
punctiforme (strain ATCC 29133 / PCC 73102)
GN=Npun_R0666 PE=4 SV=1
Length = 532

Score = 99.4 bits (246), Expect = 2e-19
Identities = 67/224 (29%), Positives = 110/224 (49%), Gaps = 4/224 (1%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIEVA--IGK--RPWEELGTDYACFQRSLGEIRERAN 170
LH+ G +A+ +QKA+++ +++ +GK +L A +QR+L
Sbjct: 210 LHTQGKLSEAIAAYQKALQIDPNYVNAHCNLGKALHTQGKLSEAMAAYQRAL-------- 261

Query: 171 ATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRIS 350
R D H +G AL + EA+ ++++A ++ P V H G L++ G++S
Sbjct: 262 --RLDPNDADTHCNLGIALHDQGKLSEAIAAYQKALQIDPNYVNAHCNLGKALHTQGKLS 319

Query: 351 EAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYR 530
EA AY AL +S H NLG+ L +G L A Y++A +P +
Sbjct: 320 EAMAAYQRALRVDPNYASA--------HCNLGVTLYHQGKLSEAIAAYQKALQIDPNYVN 371

Query: 531 ALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDLGSTLH 662
A +LG AL+ G+ A A A+ ++P+YA AHC+LG TL+
Sbjct: 372 AHCNLGKALHTQGKLSEAMAAYQRALRVDPNYASAHCNLGVTLY 415



Score = 92.4 bits (228), Expect = 2e-17
Identities = 68/224 (30%), Positives = 101/224 (45%), Gaps = 4/224 (1%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQD----HIEVAIGKRPWEELGTDYACFQRSLGEIRERAN 170
LH+ G +A+ +Q+A+ L + H + I +L A +Q++L
Sbjct: 244 LHTQGKLSEAMAAYQRALRLDPNDADTHCNLGIALHDQGKLSEAIAAYQKAL-------- 295

Query: 171 ATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRIS 350
+ +AH +G+AL EA+ +++RA + P H G TLY G++S
Sbjct: 296 --QIDPNYVNAHCNLGKALHTQGKLSEAMAAYQRALRVDPNYASAHCNLGVTLYHQGKLS 353

Query: 351 EAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYR 530
EA AY AL Q H NLG AL +G L A Y+ A +P +
Sbjct: 354 EAIAAYQKAL--------QIDPNYVNAHCNLGKALHTQGKLSEAMAAYQRALRVDPNYAS 405

Query: 531 ALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDLGSTLH 662
A +LG LY G+ A A A+ L+P+ AD HC+LG LH
Sbjct: 406 AHCNLGVTLYHQGKLSEAIAAYQRALRLDPNDADTHCNLGIALH 449



Score = 90.1 bits (222), Expect = 1e-16
Identities = 64/223 (28%), Positives = 103/223 (46%), Gaps = 4/223 (1%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIEVA--IGK--RPWEELGTDYACFQRSLGEIRERAN 170
LH G +A+ +QKA+++ +++ +GK +L A +QR+L
Sbjct: 278 LHDQGKLSEAIAAYQKALQIDPNYVNAHCNLGKALHTQGKLSEAMAAYQRAL-------- 329

Query: 171 ATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRIS 350
R AH +G L+ EA+ ++++A ++ P V H G L++ G++S
Sbjct: 330 --RVDPNYASAHCNLGVTLYHQGKLSEAIAAYQKALQIDPNYVNAHCNLGKALHTQGKLS 387

Query: 351 EAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYR 530
EA AY AL +S H NLG+ L +G L A Y+ A +P
Sbjct: 388 EAMAAYQRALRVDPNYASA--------HCNLGVTLYHQGKLSEAIAAYQRALRLDPNDAD 439

Query: 531 ALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDLGSTL 659
+LG AL+ G+ A A A+ ++P+ ADAHC+LG L
Sbjct: 440 THCNLGIALHDQGKLSEAIAAYQRALLIDPNDADAHCNLGIAL 482



Score = 89.0 bits (219), Expect = 2e-16
Identities = 54/156 (34%), Positives = 82/156 (52%), Gaps = 2/156 (1%)
Frame = +3

Query: 201 AHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAY--TL 374
AH A+G L EA+ ++++A ++ P V H G L++ G++SEA AY L
Sbjct: 202 AHNALGVVLHTQGKLSEAIAAYQKALQIDPNYVNAHCNLGKALHTQGKLSEAMAAYQRAL 261

Query: 375 ALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLGSA 554
LD + + H NLGIAL +G L A Y++A +P + A +LG A
Sbjct: 262 RLDPNDADT----------HCNLGIALHDQGKLSEAIAAYQKALQIDPNYVNAHCNLGKA 311

Query: 555 LYGVGEYRAAKKALTEAIFLNPDYADAHCDLGSTLH 662
L+ G+ A A A+ ++P+YA AHC+LG TL+
Sbjct: 312 LHTQGKLSEAMAAYQRALRVDPNYASAHCNLGVTLY 347



Score = 87.0 bits (214), Expect = 9e-16
Identities = 63/218 (28%), Positives = 101/218 (46%), Gaps = 4/218 (1%)
Frame = +3

Query: 24 DDAVKEFQKAIELKQD----HIEVAIGKRPWEELGTDYACFQRSLGEIRERANATRTQEE 191
++AV +++ A+ L + H + + +L A +Q++L +
Sbjct: 183 EEAVVKYKAALSLDPNSVYAHNALGVVLHTQGKLSEAIAAYQKAL----------QIDPN 232

Query: 192 AFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRISEAREAYT 371
+AH +G+AL EA+ +++RA L P D H G L+ G++SEA AY
Sbjct: 233 YVNAHCNLGKALHTQGKLSEAMAAYQRALRLDPNDADTHCNLGIALHDQGKLSEAIAAYQ 292

Query: 372 LALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYRALKHLGS 551
AL Q H NLG AL +G L A Y+ A +P + A +LG
Sbjct: 293 KAL--------QIDPNYVNAHCNLGKALHTQGKLSEAMAAYQRALRVDPNYASAHCNLGV 344

Query: 552 ALYGVGEYRAAKKALTEAIFLNPDYADAHCDLGSTLHS 665
LY G+ A A +A+ ++P+Y +AHC+LG LH+
Sbjct: 345 TLYHQGKLSEAIAAYQKALQIDPNYVNAHCNLGKALHT 382



Score = 77.8 bits (190), Expect = 6e-13
Identities = 61/213 (28%), Positives = 96/213 (45%), Gaps = 6/213 (2%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQD----HIEVAIGKRPWEELGTDYACFQRSLGEIRERAN 170
LH+ G +A+ +Q+A+ + + H + + +L A +Q++L
Sbjct: 312 LHTQGKLSEAMAAYQRALRVDPNYASAHCNLGVTLYHQGKLSEAIAAYQKAL-------- 363

Query: 171 ATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRIS 350
+ +AH +G+AL EA+ +++RA + P H G TLY G++S
Sbjct: 364 --QIDPNYVNAHCNLGKALHTQGKLSEAMAAYQRALRVDPNYASAHCNLGVTLYHQGKLS 421

Query: 351 EAREAY--TLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKH 524
EA AY L LD + + H NLGIAL +G L A Y+ A + +P
Sbjct: 422 EAIAAYQRALRLDPNDADT----------HCNLGIALHDQGKLSEAIAAYQRALLIDPND 471

Query: 525 YRALKHLGSALYGVGEYRAAKKALTEAIFLNPD 623
A +LG AL G G+ A L A+ LNP+
Sbjct: 472 ADAHCNLGIALKGQGKLEEAIAELEIAVRLNPN 504


>tr|Q46IU5|Q46IU5_PROMT TPR repeat OS=Prochlorococcus marinus
(strain NATL2A) GN=PMN2A_1093 PE=4 SV=1
Length = 681

Score = 90.9 bits (224), Expect = 6e-17
Identities = 69/226 (30%), Positives = 110/226 (48%), Gaps = 4/226 (1%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIEVAIGKRPWEELGTDYACFQRSLGEIRERA----N 170
L+ LG +A +KAIE+K D+ + + LG LG+++E
Sbjct: 136 LNDLGKLKEAEISTRKAIEIKPDYADA------YSNLGN----ILNDLGKLQEAELSYRK 185

Query: 171 ATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRIS 350
A + + +AH +G L E +EA +S+R+A E+KP H+ GN L LG++
Sbjct: 186 AIEIKPDYAEAHYNLGNLLKELGKLQEAELSYRKAIEIKPDFAEAHYNLGNILNDLGKLQ 245

Query: 351 EAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYR 530
EA +Y A+ EI + H NLG L G L A Y++A +P
Sbjct: 246 EAELSYRKAI---EIKPD-----FAEAHYNLGNILNDLGKLQEAELSYRKAIEIKPDFAE 297

Query: 531 ALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDLGSTLHSL 668
A +LG+ L +G+ + A+ + +AI + PD+A+AH +LG+ L L
Sbjct: 298 AHYNLGNLLKELGKLQEAELSYRKAIEIKPDFAEAHYNLGNLLKEL 343



Score = 89.0 bits (219), Expect = 2e-16
Identities = 71/226 (31%), Positives = 109/226 (48%), Gaps = 4/226 (1%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIEVAIGKRPWEELGTDYACFQRSLGEIRERANATRT 182
L SLG +A +KAIE+K D + LG LG+++E +TR
Sbjct: 102 LKSLGKLKEAEISTRKAIEIKPDFAKAHYN------LGN----ILNDLGKLKEAEISTRK 151

Query: 183 QEEA----FDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRIS 350
E DA+ +G L + +EA +S+R+A E+KP H+ GN L LG++
Sbjct: 152 AIEIKPDYADAYSNLGNILNDLGKLQEAELSYRKAIEIKPDYAEAHYNLGNLLKELGKLQ 211

Query: 351 EAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYR 530
EA +Y A+ EI + H NLG L G L A Y++A +P
Sbjct: 212 EAELSYRKAI---EIKPD-----FAEAHYNLGNILNDLGKLQEAELSYRKAIEIKPDFAE 263

Query: 531 ALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDLGSTLHSL 668
A +LG+ L +G+ + A+ + +AI + PD+A+AH +LG+ L L
Sbjct: 264 AHYNLGNILNDLGKLQEAELSYRKAIEIKPDFAEAHYNLGNLLKEL 309



Score = 85.5 bits (210), Expect = 3e-15
Identities = 66/219 (30%), Positives = 107/219 (48%), Gaps = 4/219 (1%)
Frame = +3

Query: 3 LHSLGDCDDAVKEFQKAIELKQDHIEVAIGKRPWEELGTDYACFQRSLGEIRERA----N 170
L+ LG +A ++KAIE+K D+ E LG + LG+++E
Sbjct: 170 LNDLGKLQEAELSYRKAIEIKPDYAEAHYN------LGN----LLKELGKLQEAELSYRK 219

Query: 171 ATRTQEEAFDAHMAIGRALFEHRLYKEALVSFRRATELKPTDVRPHFQYGNTLYSLGRIS 350
A + + +AH +G L + +EA +S+R+A E+KP H+ GN L LG++
Sbjct: 220 AIEIKPDFAEAHYNLGNILNDLGKLQEAELSYRKAIEIKPDFAEAHYNLGNILNDLGKLQ 279

Query: 351 EAREAYTLALDAGEISSSQWGSLLPQIHVNLGIALEGEGMLLGASEHYKEAAIREPKHYR 530
EA +Y A+ EI + H NLG L+ G L A Y++A +P
Sbjct: 280 EAELSYRKAI---EIKPD-----FAEAHYNLGNLLKELGKLQEAELSYRKAIEIKPDFAE 331

Query: 531 ALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCDL 647
A +LG+ L +G+ + A+ + +AI + PDYA+A +L
Sbjct: 332 AHYNLGNLLKELGKLQEAELSYRKAIEIKPDYAEAFWNL 370



Score = 83.2 bits (204), Expect = 1e-14
Identities = 61/192 (31%), Positives = 97/192 (50%), Gaps = 4/192 (2%)
Frame = +3

Query: 105 EELGTDYACFQRSLGEIRERANATRTQEEA----FDAHMAIGRALFEHRLYKEALVSFRR 272
E ++Y +SLG+++E +TR E AH +G L + KEA +S R+
Sbjct: 92 ERAFSNYGVILKSLGKLKEAEISTRKAIEIKPDFAKAHYNLGNILNDLGKLKEAEISTRK 151

Query: 273 ATELKPTDVRPHFQYGNTLYSLGRISEAREAYTLALDAGEISSSQWGSLLPQIHVNLGIA 452
A E+KP + GN L LG++ EA +Y A+ EI + H NLG
Sbjct: 152 AIEIKPDYADAYSNLGNILNDLGKLQEAELSYRKAI---EIKPDY-----AEAHYNLGNL 203

Query: 453 LEGEGMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYAD 632
L+ G L A Y++A +P A +LG+ L +G+ + A+ + +AI + PD+A+
Sbjct: 204 LKELGKLQEAELSYRKAIEIKPDFAEAHYNLGNILNDLGKLQEAELSYRKAIEIKPDFAE 263

Query: 633 AHCDLGSTLHSL 668
AH +LG+ L+ L
Sbjct: 264 AHYNLGNILNDL 275



Score = 56.2 bits (134), Expect = 2e-06
Identities = 42/128 (32%), Positives = 64/128 (50%), Gaps = 3/128 (2%)
Frame = +3

Query: 294 DVRPHFQYGNTLYSLGRISEAREAYTLALDAGEISSSQWGSLLP---QIHVNLGIALEGE 464
D R YG L SLG++ EA EIS+ + + P + H NLG L
Sbjct: 91 DERAFSNYGVILKSLGKLKEA-----------EISTRKAIEIKPDFAKAHYNLGNILNDL 139

Query: 465 GMLLGASEHYKEAAIREPKHYRALKHLGSALYGVGEYRAAKKALTEAIFLNPDYADAHCD 644
G L A ++A +P + A +LG+ L +G+ + A+ + +AI + PDYA+AH +
Sbjct: 140 GKLKEAEISTRKAIEIKPDYADAYSNLGNILNDLGKLQEAELSYRKAIEIKPDYAEAHYN 199

Query: 645 LGSTLHSL 668
LG+ L L
Sbjct: 200 LGNLLKEL 207