DK960237
Clone id TST39A01NGRL0006_N23
Library
Length 597
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_N23. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
TGGCTATGGCGATCTCTACGTTTTTCCCCCTCTTCTTCTGCCTCTCCGGCCTCGCCACCG
CATTGTCCACCCTTCCTCCAACCCTGCAGGAAAGTAATGGTGCTCTCTCAGGCCCGACCT
TCCCCAACAACACATACATTGATCGTAGTTTCTTCCCCTCCGACTTCGTCTTCGGGGCCC
TCACGCTCGCAGTCAAGCATGAAGGCTCTGCGGCAGGCAAAGTTGATAGCATCTGGGACA
CGTATGCCTTAGTAGATGGTGTAGTGCTGGACGGCACCATTCCTGGAAATACTGGAGATC
AGTATTCTCGCTATGCGGAAGATATTGAAGACATGGCCACAATGGGCATGGATGCTTTCC
GTTTCTCAATTGCATGGACTCGAATTTTTCCAAATAGCTCTGAAACACCGAATGCAGAGG
CCATTGACCACTACAATGCAATGATTGACAAGTTAATCGAGAAGGGTATTGAACCCCATG
TCACTCTCTGGGCTGAGGACCATCCCCAGGCATTGGAAGATGCTTATGGCGGTCTCTTGA
GCCCTCTGTTCATAGATGATTTTGTTGCATTTGCCAATGTCTGCTTTGCTGAGTTTG
■■Homology search results ■■ -
sp_hit_id P26204
Definition sp|P26204|BGLS_TRIRP Non-cyanogenic beta-glucosidase OS=Trifolium repens
Align length 173
Score (bit) 124.0
E-value 5.0e-28
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960237|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_N23, 5'
(597 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P26204|BGLS_TRIRP Non-cyanogenic beta-glucosidase OS=Trifoliu... 124 5e-28
sp|P26205|BGLT_TRIRP Cyanogenic beta-glucosidase (Fragment) OS=T... 121 2e-27
sp|P22073|BGLA_PAEPO Beta-glucosidase A OS=Paenibacillus polymyx... 117 4e-26
sp|P49235|BGLC_MAIZE Beta-glucosidase, chloroplastic OS=Zea mays... 115 2e-25
sp|P29736|MYRA_SINAL Myrosinase MA1 OS=Sinapis alba PE=1 SV=2 109 1e-23
sp|Q03506|BGLA_BACCI Beta-glucosidase OS=Bacillus circulans GN=b... 108 3e-23
sp|P42403|BGL2_BACSU Probable beta-glucosidase OS=Bacillus subti... 107 6e-23
sp|P10482|BGLS_CALSA Beta-glucosidase A OS=Caldocellum saccharol... 105 2e-22
sp|P26208|BGLA_CLOTH Beta-glucosidase A OS=Clostridium thermocel... 103 5e-22
sp|Q08638|BGLA_THEMA Beta-glucosidase A OS=Thermotoga maritima G... 101 2e-21
sp|Q9SE50|BGL1_ARATH Beta-glucosidase homolog OS=Arabidopsis tha... 100 6e-21
sp|Q00326|MYRO_BRANA Myrosinase OS=Brassica napus PE=2 SV=1 100 9e-21
sp|P09849|LPH_RABIT Lactase-phlorizin hydrolase OS=Oryctolagus c... 99 2e-20
sp|Q02401|LPH_RAT Lactase-phlorizin hydrolase OS=Rattus norvegic... 98 3e-20
sp|P29092|MYR3_SINAL Myrosinase MB3 OS=Sinapis alba PE=1 SV=1 97 5e-20
sp|Q5RF65|GBA3_PONAB Cytosolic beta-glucosidase OS=Pongo abelii ... 97 8e-20
sp|Q9H227|GBA3_HUMAN Cytosolic beta-glucosidase OS=Homo sapiens ... 96 1e-19
sp|P97265|GBA3_CAVPO Cytosolic beta-glucosidase OS=Cavia porcell... 96 1e-19
sp|P38645|BGLB_MICBI Thermostable beta-glucosidase B OS=Microbis... 96 1e-19
sp|O33843|BGLA_THENE Beta-glucosidase A OS=Thermotoga neapolitan... 96 1e-19
sp|P37702|MYRO_ARATH Myrosinase OS=Arabidopsis thaliana GN=TGG1 ... 95 3e-19
sp|P09848|LPH_HUMAN Lactase-phlorizin hydrolase OS=Homo sapiens ... 95 3e-19
sp|O35082|KLOT_MOUSE Klotho OS=Mus musculus GN=Kl PE=1 SV=1 95 3e-19
sp|Q9UEF7|KLOT_HUMAN Klotho OS=Homo sapiens GN=KL PE=1 SV=2 94 5e-19
sp|Q8WP17|KLOT_MACFA Klotho OS=Macaca fascicularis GN=KL PE=2 SV=1 93 9e-19
sp|Q9Z2Y9|KLOT_RAT Klotho OS=Rattus norvegicus GN=Kl PE=1 SV=1 93 1e-18
sp|Q99N32|KLOTB_MOUSE Beta-klotho OS=Mus musculus GN=Klb PE=1 SV=1 91 6e-18
sp|Q86Z14|KLOTB_HUMAN Beta-klotho OS=Homo sapiens GN=KLB PE=2 SV=1 89 2e-17
sp|Q97EZ2|LACG_CLOAB 6-phospho-beta-galactosidase OS=Clostridium... 88 4e-17
sp|P67769|LACG_STAAW 6-phospho-beta-galactosidase OS=Staphylococ... 86 1e-16

>sp|P26204|BGLS_TRIRP Non-cyanogenic beta-glucosidase OS=Trifolium
repens PE=1 SV=1
Length = 493

Score = 124 bits (310), Expect = 5e-28
Identities = 72/173 (41%), Positives = 99/173 (57%), Gaps = 5/173 (2%)
Frame = +3

Query: 93 SNGALSGPTFPNNTYIDRSFFPSDFVFGALTLAVKHEGSA--AGKVDSIWDTYA-LVDGV 263
S A+ T + + RS FP F+FGA + A + EG+ G+ SIWDT+
Sbjct: 20 STNAVEASTLLDIGNLSRSSFPRGFIFGAGSSAYQFEGAVNEGGRGPSIWDTFTHKYPEK 79

Query: 264 VLDGTIPGNTGDQYSRYAEDIEDMATMGMDAFRFSIAWTRIFPNS--SETPNAEAIDHYN 437
+ DG+ T DQY RY ED+ M MD++RFSI+W RI P S N E I +YN
Sbjct: 80 IRDGSNADITVDQYHRYKEDVGIMKDQNMDSYRFSISWPRILPKGKLSGGINHEGIKYYN 139

Query: 438 AMIDKLIEKGIEPHVTLWAEDHPQALEDAYGGLLSPLFIDDFVAFANVCFAEF 596
+I++L+ GI+P VTL+ D PQ LED YGG L+ I+DF + ++CF EF
Sbjct: 140 NLINELLANGIQPFVTLFHWDLPQVLEDEYGGFLNSGVINDFRDYTDLCFKEF 192


>sp|P26205|BGLT_TRIRP Cyanogenic beta-glucosidase (Fragment)
OS=Trifolium repens GN=LI PE=1 SV=1
Length = 425

Score = 121 bits (304), Expect = 2e-27
Identities = 68/165 (41%), Positives = 99/165 (60%), Gaps = 5/165 (3%)
Frame = +3

Query: 117 TFPNNTYIDRSFFPSDFVFGALTLAVKHEGSAA--GKVDSIWDTYALVDGVVLDGTIPGN 290
+F + + ++RS F FVFG + A ++EG+A GK SIWDT+ + G+
Sbjct: 18 SFDDFSDLNRSCFAPGFVFGTASSAFQYEGAAFEDGKGPSIWDTFTHKYPEKIKDRTNGD 77

Query: 291 TG-DQYSRYAEDIEDMATMGMDAFRFSIAWTRIFPNS--SETPNAEAIDHYNAMIDKLIE 461
D+Y RY EDI M M +DA+RFSI+W R+ P S N E I++YN +I++++
Sbjct: 78 VAIDEYHRYKEDIGIMKDMNLDAYRFSISWPRVLPKGKLSGGVNREGINYYNNLINEVLA 137

Query: 462 KGIEPHVTLWAEDHPQALEDAYGGLLSPLFIDDFVAFANVCFAEF 596
G++P+VTL+ D PQALED Y G L +DDF +A +CF EF
Sbjct: 138 NGMQPYVTLFHWDVPQALEDEYRGFLGRNIVDDFRDYAELCFKEF 182


>sp|P22073|BGLA_PAEPO Beta-glucosidase A OS=Paenibacillus polymyxa
GN=bglA PE=1 SV=1
Length = 448

Score = 117 bits (293), Expect = 4e-26
Identities = 66/150 (44%), Positives = 87/150 (58%), Gaps = 2/150 (1%)
Frame = +3

Query: 153 FPSDFVFGALTLAVKHEGSAA--GKVDSIWDTYALVDGVVLDGTIPGNTGDQYSRYAEDI 326
FP DF++G T A + EG+ G+ SIWDT+A G V +G D Y RY EDI
Sbjct: 6 FPQDFMWGTATAAYQIEGAYQEDGRGLSIWDTFAHTPGKVFNGDNGNVACDSYHRYEEDI 65

Query: 327 EDMATMGMDAFRFSIAWTRIFPNSSETPNAEAIDHYNAMIDKLIEKGIEPHVTLWAEDHP 506
M +G+ +RFS++W RIFPN N E +D+Y+ ++D L + GIEP TL+ D P
Sbjct: 66 RLMKELGIRTYRFSVSWPRIFPNGDGEVNQEGLDYYHRVVDLLNDNGIEPFCTLYHWDLP 125

Query: 507 QALEDAYGGLLSPLFIDDFVAFANVCFAEF 596
QAL+DA GG + I FV FA F EF
Sbjct: 126 QALQDA-GGWGNRRTIQAFVQFAETMFREF 154


>sp|P49235|BGLC_MAIZE Beta-glucosidase, chloroplastic OS=Zea mays
GN=GLU1 PE=1 SV=1
Length = 566

Score = 115 bits (287), Expect = 2e-25
Identities = 66/159 (41%), Positives = 92/159 (57%), Gaps = 8/159 (5%)
Frame = +3

Query: 144 RSFFPSDFVFGALTLAVKHEGS--AAGKVDSIWDTYALVDGV-VLDGTIPGNTGDQYSRY 314
R +FPSDF FGA T A + EG+ GK +S WD + +LDG+ + Y Y
Sbjct: 75 RDWFPSDFTFGAATSAYQIEGAWNEDGKGESNWDHFCHNHPERILDGSNSDIGANSYHMY 134

Query: 315 AEDIEDMATMGMDAFRFSIAWTRIFPNSSETP--NAEAIDHYNAMIDKLIEKGIEPHVTL 488
D+ + MGMDA+RFSI+W RI P ++ N + I +Y +I+ L+E GIEP+VT+
Sbjct: 135 KTDVRLLKEMGMDAYRFSISWPRILPKGTKEGGINPDGIKYYRNLINLLLENGIEPYVTI 194

Query: 489 WAEDHPQALEDAYGGLLS---PLFIDDFVAFANVCFAEF 596
+ D PQALE+ YGG L ++D+ FA VCF F
Sbjct: 195 FHWDVPQALEEKYGGFLDKSHKSIVEDYTYFAKVCFDNF 233


>sp|P29736|MYRA_SINAL Myrosinase MA1 OS=Sinapis alba PE=1 SV=2
Length = 501

Score = 109 bits (272), Expect = 1e-23
Identities = 65/164 (39%), Positives = 93/164 (56%), Gaps = 4/164 (2%)
Frame = +3

Query: 117 TFPNNTYIDRSFFPSDFVFGALTLAVKHEGSAAGKVDSIWD--TYALVDGVVLDGTIPGN 290
T N ++ S F SDF+FG + A + EG+ G+ +IWD T+ + D
Sbjct: 13 TCGNTDALNSSSFSSDFIFGVASSAYQIEGTI-GRGLNIWDGFTHRYPNKSGPDHGNGDT 71

Query: 291 TGDQYSRYAEDIEDMATMGMDAFRFSIAWTRIFPNS--SETPNAEAIDHYNAMIDKLIEK 464
T D +S + +DI+ + + +RFSIAW+RI P S N + ID+Y+ +I LI+K
Sbjct: 72 TCDSFSYWQKDIDVLDELNATGYRFSIAWSRIIPRGKRSRGVNEKGIDYYHGLISGLIKK 131

Query: 465 GIEPHVTLWAEDHPQALEDAYGGLLSPLFIDDFVAFANVCFAEF 596
GI P VTL+ D PQ L+D Y G L P IDDF +A++CF EF
Sbjct: 132 GITPFVTLFHWDLPQTLQDEYEGFLDPQIIDDFKDYADLCFEEF 175


>sp|Q03506|BGLA_BACCI Beta-glucosidase OS=Bacillus circulans GN=bglA
PE=1 SV=3
Length = 450

Score = 108 bits (269), Expect = 3e-23
Identities = 59/149 (39%), Positives = 86/149 (57%), Gaps = 2/149 (1%)
Frame = +3

Query: 153 FPSDFVFGALTLAVKHEGS--AAGKVDSIWDTYALVDGVVLDGTIPGNTGDQYSRYAEDI 326
FPSDF +G T A + EG+ G+ SIWDT+A G V +G D Y R ED+
Sbjct: 6 FPSDFKWGVATAAYQIEGAYNEDGRGMSIWDTFAHTPGKVKNGDNGNVACDSYHRVEEDV 65

Query: 327 EDMATMGMDAFRFSIAWTRIFPNSSETPNAEAIDHYNAMIDKLIEKGIEPHVTLWAEDHP 506
+ + +G+ +RFSI+W R+ P + N +D+Y+ ++D+L+ GIEP TL+ D P
Sbjct: 66 QLLKDLGVKVYRFSISWPRVLPQGTGEVNRAGLDYYHRLVDELLANGIEPFCTLYHWDLP 125

Query: 507 QALEDAYGGLLSPLFIDDFVAFANVCFAE 593
QAL+D GG S + ID F +A + F E
Sbjct: 126 QALQD-QGGWGSRITIDAFAEYAELMFKE 153


>sp|P42403|BGL2_BACSU Probable beta-glucosidase OS=Bacillus subtilis
GN=yckE PE=3 SV=1
Length = 477

Score = 107 bits (266), Expect = 6e-23
Identities = 56/150 (37%), Positives = 83/150 (55%), Gaps = 2/150 (1%)
Frame = +3

Query: 153 FPSDFVFGALTLAVKHEGS--AAGKVDSIWDTYALVDGVVLDGTIPGNTGDQYSRYAEDI 326
FP F++G+ + A + EG+ GK S+WD + + G GT D Y R+ ED+
Sbjct: 9 FPKHFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIPGKTFKGTNGEIAVDHYHRFKEDV 68

Query: 327 EDMATMGMDAFRFSIAWTRIFPNSSETPNAEAIDHYNAMIDKLIEKGIEPHVTLWAEDHP 506
MA MG+ A+RFS++W R+FP N + Y+++ID+L+ IEP +TL+ D P
Sbjct: 69 ALMAEMGLKAYRFSVSWPRVFPKGKGEINEAGLAFYDSLIDELLSHHIEPVLTLYHWDLP 128

Query: 507 QALEDAYGGLLSPLFIDDFVAFANVCFAEF 596
QAL D YGG S I+DF + + F
Sbjct: 129 QALMDEYGGFESRNIIEDFNHYCITLYKRF 158


>sp|P10482|BGLS_CALSA Beta-glucosidase A OS=Caldocellum
saccharolyticum GN=bglA PE=3 SV=1
Length = 455

Score = 105 bits (262), Expect = 2e-22
Identities = 58/143 (40%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
Frame = +3

Query: 153 FPSDFVFGALTLAVKHEGS--AAGKVDSIWDTYALVDGVVLDGTIPGNTGDQYSRYAEDI 326
FP F++GA T + + EG+ GK +SIWD + +L G D Y R+ ED+
Sbjct: 5 FPKGFLWGAATASYQIEGAWNEDGKGESIWDRFTHQKRNILYGHNGDVACDHYHRFEEDV 64

Query: 327 EDMATMGMDAFRFSIAWTRIFPNSSETPNAEAIDHYNAMIDKLIEKGIEPHVTLWAEDHP 506
M +G+ A+RFSIAWTRIFP+ T N + ++ Y+ +I+KL+E GIEP VTL+ D P
Sbjct: 65 SLMKELGLKAYRFSIAWTRIFPDGFGTVNQKGLEFYDRLINKLVENGIEPVVTLYHWDLP 124

Query: 507 QALEDAYGGLLSPLFIDDFVAFA 575
Q L+D GG +P ++ + +A
Sbjct: 125 QKLQD-IGGWANPEIVNYYFDYA 146


>sp|P26208|BGLA_CLOTH Beta-glucosidase A OS=Clostridium thermocellum
(strain ATCC 27405 / DSM 1237) GN=bglA PE=3 SV=1
Length = 448

Score = 103 bits (258), Expect = 5e-22
Identities = 57/147 (38%), Positives = 84/147 (57%), Gaps = 2/147 (1%)
Frame = +3

Query: 153 FPSDFVFGALTLAVKHEGS--AAGKVDSIWDTYALVDGVVLDGTIPGNTGDQYSRYAEDI 326
FP DF++G+ T A + EG+ GK +SIWD ++ G + DG D Y RY EDI
Sbjct: 6 FPKDFIWGSATAAYQIEGAYNEDGKGESIWDRFSHTPGNIADGHTGDVACDHYHRYEEDI 65

Query: 327 EDMATMGMDAFRFSIAWTRIFPNSSETPNAEAIDHYNAMIDKLIEKGIEPHVTLWAEDHP 506
+ M +G+ ++RFSI+W RIFP + N + +D Y + + L+E GI P +TL+ D P
Sbjct: 66 KIMKEIGIKSYRFSISWPRIFPEGTGKLNQKGLDFYKRLTNLLLENGIMPAITLYHWDLP 125

Query: 507 QALEDAYGGLLSPLFIDDFVAFANVCF 587
Q L+D GG + D F ++ V F
Sbjct: 126 QKLQDK-GGWKNRDTTDYFTEYSEVIF 151


>sp|Q08638|BGLA_THEMA Beta-glucosidase A OS=Thermotoga maritima
GN=bglA PE=1 SV=1
Length = 446

Score = 101 bits (252), Expect = 2e-21
Identities = 59/150 (39%), Positives = 84/150 (56%), Gaps = 2/150 (1%)
Frame = +3

Query: 153 FPSDFVFGALTLAVKHEGS--AAGKVDSIWDTYALVDGVVLDGTIPGNTGDQYSRYAEDI 326
FP F++G T + + EGS A G SIW T++ G V +G D Y+R+ EDI
Sbjct: 6 FPEGFLWGVATASYQIEGSPLADGAGMSIWHTFSHTPGNVKNGDTGDVACDHYNRWKEDI 65

Query: 327 EDMATMGMDAFRFSIAWTRIFPNSSETPNAEAIDHYNAMIDKLIEKGIEPHVTLWAEDHP 506
E + +G+ A+RFSI+W RI P + N + +D YN +ID L+EKGI P VT++ D P
Sbjct: 66 EIIEKLGVKAYRFSISWPRILPEGTGRVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLP 125

Query: 507 QALEDAYGGLLSPLFIDDFVAFANVCFAEF 596
AL+ GG + D F ++ V F F
Sbjct: 126 FALQ-LKGGWANREIADWFAEYSRVLFENF 154


tr_hit_id Q9FZE0
Definition tr|Q9FZE0|Q9FZE0_ARATH T1K7.7 protein (Putative beta-glucosidase) OS=Arabidopsis thaliana
Align length 155
Score (bit) 154.0
E-value 3.0e-36
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960237|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0006_N23, 5'
(597 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9FZE0|Q9FZE0_ARATH T1K7.7 protein (Putative beta-glucosidase... 154 3e-36
tr|Q8LF56|Q8LF56_ARATH Beta-glucosidase, putative OS=Arabidopsis... 154 3e-36
tr|Q8L7J2|Q8L7J2_ORYSJ Os03g0212800 protein OS=Oryza sativa subs... 152 1e-35
tr|B8AQS4|B8AQS4_ORYSI Putative uncharacterized protein OS=Oryza... 152 1e-35
tr|Q9AXL6|Q9AXL6_MUSAC Beta-glucosidase (Fragment) OS=Musa acumi... 150 7e-35
tr|Q0DA21|Q0DA21_ORYSJ Os06g0683300 protein (Fragment) OS=Oryza ... 149 1e-34
tr|Q0J0G2|Q0J0G2_ORYSJ Os09g0511700 protein OS=Oryza sativa subs... 148 2e-34
tr|Q0J0G1|Q0J0G1_ORYSJ Os09g0511900 protein (Fragment) OS=Oryza ... 148 2e-34
tr|B7EC24|B7EC24_ORYSJ cDNA clone:J013063O11, full insert sequen... 148 2e-34
tr|A3C0K2|A3C0K2_ORYSJ Putative uncharacterized protein OS=Oryza... 148 2e-34
tr|A2Z317|A2Z317_ORYSI Putative uncharacterized protein OS=Oryza... 148 2e-34
tr|Q9ZT64|Q9ZT64_PINCO Beta-glucosidase OS=Pinus contorta PE=2 SV=1 148 3e-34
tr|B8BDH9|B8BDH9_ORYSI Putative uncharacterized protein OS=Oryza... 147 3e-34
tr|B8BDH8|B8BDH8_ORYSI Putative uncharacterized protein OS=Oryza... 147 3e-34
tr|B7F7K7|B7F7K7_ORYSJ cDNA clone:J033069H08, full insert sequen... 147 3e-34
tr|B8BG74|B8BG74_ORYSI Putative uncharacterized protein OS=Oryza... 146 1e-33
tr|Q94HQ6|Q94HQ6_ORYSA Putative beta-glucosidase OS=Oryza sativa... 145 2e-33
tr|Q339X2|Q339X2_ORYSJ Os10g0323500 protein OS=Oryza sativa subs... 145 2e-33
tr|A3C3I4|A3C3I4_ORYSJ Putative uncharacterized protein OS=Oryza... 145 2e-33
tr|B8AB96|B8AB96_ORYSI Putative uncharacterized protein OS=Oryza... 144 3e-33
tr|A7P134|A7P134_VITVI Chromosome chr19 scaffold_4, whole genome... 144 3e-33
tr|A9NVG8|A9NVG8_PICSI Putative uncharacterized protein OS=Picea... 144 4e-33
tr|Q0J0G3|Q0J0G3_ORYSJ Os09g0511600 protein OS=Oryza sativa subs... 143 7e-33
tr|B7F8N7|B7F8N7_ORYSJ cDNA, clone: J065127F19, full insert sequ... 143 7e-33
tr|A7P2I4|A7P2I4_VITVI Chromosome chr1 scaffold_5, whole genome ... 140 6e-32
tr|A9T5X2|A9T5X2_PHYPA Predicted protein OS=Physcomitrella paten... 140 7e-32
tr|A3AFF2|A3AFF2_ORYSJ Putative uncharacterized protein OS=Oryza... 140 7e-32
tr|Q84YK7|Q84YK7_ORYSJ Os08g0509200 protein OS=Oryza sativa subs... 139 1e-31
tr|Q7EXZ5|Q7EXZ5_ORYSJ Putative beta-glucosidase isozyme 2 OS=Or... 139 1e-31
tr|B8BCB0|B8BCB0_ORYSI Putative uncharacterized protein OS=Oryza... 139 1e-31

>tr|Q9FZE0|Q9FZE0_ARATH T1K7.7 protein (Putative beta-glucosidase)
OS=Arabidopsis thaliana GN=At1g26560 PE=2 SV=1
Length = 510

Score = 154 bits (390), Expect = 3e-36
Identities = 79/155 (50%), Positives = 100/155 (64%), Gaps = 2/155 (1%)
Frame = +3

Query: 138 IDRSFFPSDFVFGALTLAVKHEGS--AAGKVDSIWDTYALVDGVVLDGTIPGNTGDQYSR 311
I R FP FVFG + A +HEG+ A G+ +IWDT++ G + D + DQY R
Sbjct: 32 ISRGSFPKGFVFGTASSAFQHEGAVKAEGRGPTIWDTFSHTFGKITDFSNADVAVDQYHR 91

Query: 312 YAEDIEDMATMGMDAFRFSIAWTRIFPNSSETPNAEAIDHYNAMIDKLIEKGIEPHVTLW 491
Y ED++ M MGMDA+RFSI+WTRIFPN N IDHYN +I+ L+ KGIEP+VTL+
Sbjct: 92 YEEDVQLMKNMGMDAYRFSISWTRIFPNGVGHINEAGIDHYNKLINALLAKGIEPYVTLY 151

Query: 492 AEDHPQALEDAYGGLLSPLFIDDFVAFANVCFAEF 596
D PQAL D Y G L+P I+DF A+A VCF F
Sbjct: 152 HWDLPQALHDRYLGWLNPQIINDFAAYAEVCFQRF 186


>tr|Q8LF56|Q8LF56_ARATH Beta-glucosidase, putative OS=Arabidopsis
thaliana PE=2 SV=1
Length = 498

Score = 154 bits (390), Expect = 3e-36
Identities = 79/155 (50%), Positives = 100/155 (64%), Gaps = 2/155 (1%)
Frame = +3

Query: 138 IDRSFFPSDFVFGALTLAVKHEGS--AAGKVDSIWDTYALVDGVVLDGTIPGNTGDQYSR 311
I R FP FVFG + A +HEG+ A G+ +IWDT++ G + D + DQY R
Sbjct: 20 ISRGSFPKGFVFGTASSAFQHEGAVKAEGRGPTIWDTFSHTFGKITDFSNADVAVDQYHR 79

Query: 312 YAEDIEDMATMGMDAFRFSIAWTRIFPNSSETPNAEAIDHYNAMIDKLIEKGIEPHVTLW 491
Y ED++ M MGMDA+RFSI+WTRIFPN N IDHYN +I+ L+ KGIEP+VTL+
Sbjct: 80 YEEDVQLMKNMGMDAYRFSISWTRIFPNGVGHINEAGIDHYNKLINALLAKGIEPYVTLY 139

Query: 492 AEDHPQALEDAYGGLLSPLFIDDFVAFANVCFAEF 596
D PQAL D Y G L+P I+DF A+A VCF F
Sbjct: 140 HWDLPQALHDRYLGWLNPQIINDFAAYAEVCFQRF 174


>tr|Q8L7J2|Q8L7J2_ORYSJ Os03g0212800 protein OS=Oryza sativa subsp.
japonica GN=Os03g0212800 PE=2 SV=1
Length = 521

Score = 152 bits (385), Expect = 1e-35
Identities = 77/155 (49%), Positives = 99/155 (63%), Gaps = 2/155 (1%)
Frame = +3

Query: 138 IDRSFFPSDFVFGALTLAVKHEGSAA--GKVDSIWDTYALVDGVVLDGTIPGNTGDQYSR 311
+ R FP FVFG + A ++EG+ G+ +IWDT+A G + D + DQY R
Sbjct: 45 LTRGSFPEGFVFGTASAAYQYEGAVKEDGRGQTIWDTFAHTFGKITDFSNADVAVDQYHR 104

Query: 312 YAEDIEDMATMGMDAFRFSIAWTRIFPNSSETPNAEAIDHYNAMIDKLIEKGIEPHVTLW 491
+ EDI+ MA MGMDA+RFSIAW+RI+PN N IDHYN +ID L+ KGI+P+VTL+
Sbjct: 105 FEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPYVTLY 164

Query: 492 AEDHPQALEDAYGGLLSPLFIDDFVAFANVCFAEF 596
D PQALED Y G L +DDF A+A CF EF
Sbjct: 165 HWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREF 199


>tr|B8AQS4|B8AQS4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10506 PE=4 SV=1
Length = 521

Score = 152 bits (385), Expect = 1e-35
Identities = 77/155 (49%), Positives = 99/155 (63%), Gaps = 2/155 (1%)
Frame = +3

Query: 138 IDRSFFPSDFVFGALTLAVKHEGSAA--GKVDSIWDTYALVDGVVLDGTIPGNTGDQYSR 311
+ R FP FVFG + A ++EG+ G+ +IWDT+A G + D + DQY R
Sbjct: 45 LTRGSFPEGFVFGTASAAYQYEGAVKEDGRGQTIWDTFAHTFGKITDFSNADVAVDQYHR 104

Query: 312 YAEDIEDMATMGMDAFRFSIAWTRIFPNSSETPNAEAIDHYNAMIDKLIEKGIEPHVTLW 491
+ EDI+ MA MGMDA+RFSIAW+RI+PN N IDHYN +ID L+ KGI+P+VTL+
Sbjct: 105 FEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPYVTLY 164

Query: 492 AEDHPQALEDAYGGLLSPLFIDDFVAFANVCFAEF 596
D PQALED Y G L +DDF A+A CF EF
Sbjct: 165 HWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREF 199


>tr|Q9AXL6|Q9AXL6_MUSAC Beta-glucosidase (Fragment) OS=Musa
acuminata PE=2 SV=1
Length = 551

Score = 150 bits (378), Expect = 7e-35
Identities = 76/155 (49%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
Frame = +3

Query: 138 IDRSFFPSDFVFGALTLAVKHEGSAA--GKVDSIWDTYALVDGVVLDGTIPGNTGDQYSR 311
+ R FP+ F+FGA T A + EG+AA G+ SIWDT+ G D + DQY +
Sbjct: 30 LSRDDFPAGFIFGAGTSAYQVEGAAAEGGRTPSIWDTFTHA-GRTFDQSTGDVAADQYHK 88

Query: 312 YAEDIEDMATMGMDAFRFSIAWTRIFPNSSETPNAEAIDHYNAMIDKLIEKGIEPHVTLW 491
Y ED++ M MG DA+RFSI+W+R+ PN N + + +YN +ID+L GIEPHVTL+
Sbjct: 89 YKEDVKLMHEMGFDAYRFSISWSRVIPNGRGPVNPQGLRYYNNLIDELKRYGIEPHVTLY 148

Query: 492 AEDHPQALEDAYGGLLSPLFIDDFVAFANVCFAEF 596
D PQALED Y G LSP ++DF A+ANVCF+EF
Sbjct: 149 HFDLPQALEDEYAGQLSPKIVEDFTAYANVCFSEF 183


>tr|Q0DA21|Q0DA21_ORYSJ Os06g0683300 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os06g0683300 PE=3 SV=1
Length = 314

Score = 149 bits (376), Expect = 1e-34
Identities = 75/155 (48%), Positives = 102/155 (65%), Gaps = 2/155 (1%)
Frame = +3

Query: 138 IDRSFFPSDFVFGALTLAVKHEGSA--AGKVDSIWDTYALVDGVVLDGTIPGNTGDQYSR 311
I R+ FP F+FG + A ++EG+ + +IWDT G V+D + D Y R
Sbjct: 22 ISRADFPPGFIFGTASSAYQYEGAVNEGQRGPTIWDTLTKRPGRVIDFSNADVAVDHYHR 81

Query: 312 YAEDIEDMATMGMDAFRFSIAWTRIFPNSSETPNAEAIDHYNAMIDKLIEKGIEPHVTLW 491
Y ED+E M +GMDA+RFSI+W+RIFPN + PN E + +YN++ID L++KGIEP+VTL+
Sbjct: 82 YKEDVELMNDIGMDAYRFSISWSRIFPNGTGEPNEEGLSYYNSLIDALLDKGIEPYVTLF 141

Query: 492 AEDHPQALEDAYGGLLSPLFIDDFVAFANVCFAEF 596
D PQALED YGG L+ I+DFV +A CF EF
Sbjct: 142 HWDLPQALEDRYGGWLNSEIIEDFVQYAFTCFKEF 176


>tr|Q0J0G2|Q0J0G2_ORYSJ Os09g0511700 protein OS=Oryza sativa subsp.
japonica GN=Os09g0511700 PE=2 SV=1
Length = 274

Score = 148 bits (374), Expect = 2e-34
Identities = 76/155 (49%), Positives = 102/155 (65%), Gaps = 2/155 (1%)
Frame = +3

Query: 138 IDRSFFPSDFVFGALTLAVKHEGSAA--GKVDSIWDTYALVDGVVLDGTIPGNTGDQYSR 311
+ R FP FVFGA T A + EG+AA G+ SIWDT+ G G I + DQY
Sbjct: 31 LTRHDFPEGFVFGAGTSAFQVEGAAAEDGRKPSIWDTFTH-QGYSPGGAIADVSADQYHH 89

Query: 312 YAEDIEDMATMGMDAFRFSIAWTRIFPNSSETPNAEAIDHYNAMIDKLIEKGIEPHVTLW 491
Y ED++ M MG+DA+RFSIAW R+ P+ N + +++YN +ID+LI GI+PHVT++
Sbjct: 90 YKEDVKLMYDMGLDAYRFSIAWPRLIPDGRGEINPKGLEYYNNLIDELIMHGIQPHVTIY 149

Query: 492 AEDHPQALEDAYGGLLSPLFIDDFVAFANVCFAEF 596
D PQAL+D YGG+LSP FI+D+ A+A VCF F
Sbjct: 150 HFDLPQALQDEYGGILSPRFIEDYTAYAEVCFKNF 184


>tr|Q0J0G1|Q0J0G1_ORYSJ Os09g0511900 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os09g0511900 PE=3 SV=1
Length = 507

Score = 148 bits (374), Expect = 2e-34
Identities = 75/155 (48%), Positives = 105/155 (67%), Gaps = 2/155 (1%)
Frame = +3

Query: 138 IDRSFFPSDFVFGALTLAVKHEGSAA--GKVDSIWDTYALVDGVVLDGTIPGNTGDQYSR 311
+ R FP FVFGA + A + EG+AA G+ SIWDT+ + G + DG+ + DQY
Sbjct: 35 LTRHDFPEGFVFGAGSSAFQVEGAAAEDGRKPSIWDTF-INQGYMPDGSNADVSADQYHH 93

Query: 312 YAEDIEDMATMGMDAFRFSIAWTRIFPNSSETPNAEAIDHYNAMIDKLIEKGIEPHVTLW 491
Y ED++ M MG+DA+RFSIAW R+ P+ N + +++YN +ID+LI GI+PHVT++
Sbjct: 94 YKEDVKLMYDMGLDAYRFSIAWPRLIPDGRGEINPKGLEYYNNLIDELIMHGIQPHVTIY 153

Query: 492 AEDHPQALEDAYGGLLSPLFIDDFVAFANVCFAEF 596
D PQAL+D YGG+LSP FI+D+ A+A VCF F
Sbjct: 154 HFDLPQALQDEYGGILSPRFIEDYSAYAEVCFKNF 188


>tr|B7EC24|B7EC24_ORYSJ cDNA clone:J013063O11, full insert sequence
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 503

Score = 148 bits (374), Expect = 2e-34
Identities = 75/155 (48%), Positives = 105/155 (67%), Gaps = 2/155 (1%)
Frame = +3

Query: 138 IDRSFFPSDFVFGALTLAVKHEGSAA--GKVDSIWDTYALVDGVVLDGTIPGNTGDQYSR 311
+ R FP FVFGA + A + EG+AA G+ SIWDT+ + G + DG+ + DQY
Sbjct: 31 LTRHDFPEGFVFGAGSSAFQVEGAAAEDGRKPSIWDTF-INQGYMPDGSNADVSADQYHH 89

Query: 312 YAEDIEDMATMGMDAFRFSIAWTRIFPNSSETPNAEAIDHYNAMIDKLIEKGIEPHVTLW 491
Y ED++ M MG+DA+RFSIAW R+ P+ N + +++YN +ID+LI GI+PHVT++
Sbjct: 90 YKEDVKLMYDMGLDAYRFSIAWPRLIPDGRGEINPKGLEYYNNLIDELIMHGIQPHVTIY 149

Query: 492 AEDHPQALEDAYGGLLSPLFIDDFVAFANVCFAEF 596
D PQAL+D YGG+LSP FI+D+ A+A VCF F
Sbjct: 150 HFDLPQALQDEYGGILSPRFIEDYSAYAEVCFKNF 184


>tr|A3C0K2|A3C0K2_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_028824 PE=3 SV=1
Length = 494

Score = 148 bits (374), Expect = 2e-34
Identities = 75/155 (48%), Positives = 105/155 (67%), Gaps = 2/155 (1%)
Frame = +3

Query: 138 IDRSFFPSDFVFGALTLAVKHEGSAA--GKVDSIWDTYALVDGVVLDGTIPGNTGDQYSR 311
+ R FP FVFGA + A + EG+AA G+ SIWDT+ + G + DG+ + DQY
Sbjct: 31 LTRHDFPEGFVFGAGSSAFQVEGAAAEDGRKPSIWDTF-INQGYMPDGSNADVSADQYHH 89

Query: 312 YAEDIEDMATMGMDAFRFSIAWTRIFPNSSETPNAEAIDHYNAMIDKLIEKGIEPHVTLW 491
Y ED++ M MG+DA+RFSIAW R+ P+ N + +++YN +ID+LI GI+PHVT++
Sbjct: 90 YKEDVKLMYDMGLDAYRFSIAWPRLIPDGRGEINPKGLEYYNNLIDELIMHGIQPHVTIY 149

Query: 492 AEDHPQALEDAYGGLLSPLFIDDFVAFANVCFAEF 596
D PQAL+D YGG+LSP FI+D+ A+A VCF F
Sbjct: 150 HFDLPQALQDEYGGILSPRFIEDYSAYAEVCFKNF 184