DK960325
Clone id TST39A01NGRL0007_B20
Library
Length 653
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0007_B20. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
AGCTCGCCAAAGGAAGCGTAGCTGAAGCCTGAAGCACAGGTTTTTGTAGGTTTCCTGCTT
CGTTCAAACATGAGCGCCCTCCCTGCGGGTAAGCGCCCTCTTTCCGACATCGCTAGAGAA
GCAGAAGCTAATGGACGAGCCAGCAAGAGGAGAACACCTCAGAAAAGAGCTGCTTCTCCT
CCCTCTTCTTCGCCACTATCCCCTCTCAAGCGAGGAGAAACTGTGTACAGAATCCTATGC
CCAGCTTCCAAAACCGGCAGCATCATCGGCAAGGCTGGGAGCATCATCAAGTCTATCCGG
CAAGACACGGGGGCAATGATCAGGATTGAAGATGCTGTCTATGGATGTGATGAAAGGGTG
GTCACAGTGTCTGCCAAGGAAGAGGGTTTCCGACCACAAAAGTTTCGTGGCCCAGGCAAT
TATCAAAAATCTGGGGATGGGGATGAAGATAAGGACGACCTTATGTCTGATACAGATGAA
GAAGAGGAGCAACCGGCTGAAGCTATAGGACAGGCCTCAGAGGAGAAAACAGAAGGGACT
ACAGGGTTGGTCGAGGAGAAGTTAGATGAAGAAAAGCTACTGCAGGCGGAATCAGATAAG
GAGAAGCTCAAAGAAGCAGAATCAGATAAGGAACAACTTCCAGAGGCAGATTC
■■Homology search results ■■ -
sp_hit_id P58223
Definition sp|P58223|Y4837_ARATH KH domain-containing protein At4g18375 OS=Arabidopsis thaliana
Align length 56
Score (bit) 38.1
E-value 0.041
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960325|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_B20, 5'
(653 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P58223|Y4837_ARATH KH domain-containing protein At4g18375 OS=... 38 0.041
sp|Q09103|DGK2_DROME Eye-specific diacylglycerol kinase OS=Droso... 38 0.041
sp|O94909|K0819_HUMAN Uncharacterized protein KIAA0819 OS=Homo s... 38 0.053
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE... 37 0.069
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing pr... 37 0.069
sp|Q00PI9|HNRL2_MOUSE Heterogeneous nuclear ribonucleoprotein U-... 37 0.12
sp|Q9BXP5|ARS2_HUMAN Arsenite-resistance protein 2 OS=Homo sapie... 36 0.15
sp|B0Z503|YCF2_OENBI Protein ycf2 OS=Oenothera biennis GN=ycf2-A... 35 0.26
sp|O74515|ASF1_SCHPO Histone chaperone cia1 OS=Schizosaccharomyc... 35 0.26
sp|B0Z587|YCF2_OENGL Protein ycf2 OS=Oenothera glazioviana GN=yc... 35 0.34
sp|P09405|NUCL_MOUSE Nucleolin OS=Mus musculus GN=Ncl PE=1 SV=2 35 0.45
sp|Q54LY8|Y6915_DICDI Uncharacterized protein DDB_G0286299 OS=Di... 34 0.59
sp|P54696|MYOH_DICDI Myosin IH heavy chain OS=Dictyostelium disc... 34 0.59
sp|Q01042|IE68_SHV21 Immediate-early protein OS=Saimiriine herpe... 34 0.59
sp|Q4IR09|RNA14_GIBZE mRNA 3'-end-processing protein RNA14 OS=Gi... 34 0.77
sp|Q6CGB2|IWS1_YARLI Transcription factor IWS1 OS=Yarrowia lipol... 34 0.77
sp|P07918|DPOL_HHV21 DNA polymerase OS=Human herpesvirus 2 (stra... 34 0.77
sp|Q555V7|VID27_DICDI VID27-like protein OS=Dictyostelium discoi... 33 1.0
sp|P82179|TRDN_CANFA Triadin OS=Canis familiaris GN=TRDN PE=1 SV=2 33 1.0
sp|A2VD23|STM_DANRE Protein starmaker OS=Danio rerio GN=stm PE=2... 33 1.0
sp|Q149C2|MIPT3_MOUSE TRAF3-interacting protein 1 OS=Mus musculu... 33 1.0
sp|Q1KMD3|HNRL2_HUMAN Heterogeneous nuclear ribonucleoprotein U-... 33 1.0
sp|Q756V1|FKBP3_ASHGO FK506-binding protein 3 OS=Ashbya gossypii... 33 1.0
sp|Q2U0Q9|EIF3C_ASPOR Eukaryotic translation initiation factor 3... 33 1.0
sp|P52193|CALR_BOVIN Calreticulin OS=Bos taurus GN=CALR PE=1 SV=2 33 1.0
sp|A4IFB1|ARS2_BOVIN Arsenite-resistance protein 2 OS=Bos taurus... 33 1.0
sp|P79780|SIAL_CHICK Bone sialoprotein 2 OS=Gallus gallus GN=IBS... 33 1.3
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 33 1.3
sp|P38439|LEO1_YEAST RNA polymerase-associated protein LEO1 OS=S... 33 1.3
sp|Q3UGQ8|K0819_MOUSE Uncharacterized protein KIAA0819 OS=Mus mu... 33 1.3

>sp|P58223|Y4837_ARATH KH domain-containing protein At4g18375
OS=Arabidopsis thaliana GN=At4g18375 PE=2 SV=1
Length = 606

Score = 38.1 bits (87), Expect = 0.041
Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 2/56 (3%)
Frame = +1

Query: 223 VYRILCPAXXXXXXXXXXXXXXXXXRQDTGAMIRIEDAVYGCDERVVTV--SAKEE 384
VYRILCP R +T A I++ D ++GC +RV+T+ S KE+
Sbjct: 37 VYRILCPIDVVGGVIGKSGKVINAIRHNTKAKIKVFDQLHGCSQRVITIYCSVKEK 92


>sp|Q09103|DGK2_DROME Eye-specific diacylglycerol kinase
OS=Drosophila melanogaster GN=rdgA PE=2 SV=2
Length = 1457

Score = 38.1 bits (87), Expect = 0.041
Identities = 23/74 (31%), Positives = 35/74 (47%)
Frame = +1

Query: 430 SGDGDEDKDDLMSDTDEEEEQPAEAIGQASEEKTEGTTGXXXXXXXXXXXXQAESDKEKL 609
S + ED+D++ EEEE+ + AI A EE TE T E+D++
Sbjct: 211 SSEASEDEDEVEGHNAEEEEEGSAAIEDAEEETTEAAT--------------EEADEDPR 256

Query: 610 KEAESDKEQLPEAD 651
E ES+ + P+ D
Sbjct: 257 TEVESEHDHDPDDD 270


>sp|O94909|K0819_HUMAN Uncharacterized protein KIAA0819 OS=Homo
sapiens GN=KIAA0819 PE=1 SV=2
Length = 1142

Score = 37.7 bits (86), Expect = 0.053
Identities = 25/93 (26%), Positives = 40/93 (43%), Gaps = 18/93 (19%)
Frame = +1

Query: 379 EEGFRPQKFRGPGNYQKSGDGDEDKDDLMSDTDEEEE------------------QPAEA 504
EE K GPGN ++ + +E +++ D DEEEE +PAE
Sbjct: 164 EEELEASKSFGPGNEEEEEEEEEYEEEEEEDYDEEEEESSEAPLDENDLEEDVDSEPAEI 223

Query: 505 IGQASEEKTEGTTGXXXXXXXXXXXXQAESDKE 603
G+A+E+ G TG +++D+E
Sbjct: 224 EGEAAEDGDPGDTGAELDDDQHWSDSPSDADRE 256


>sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1
SV=2
Length = 714

Score = 37.4 bits (85), Expect = 0.069
Identities = 23/98 (23%), Positives = 39/98 (39%)
Frame = +1

Query: 358 VVTVSAKEEGFRPQKFRGPGNYQKSGDGDEDKDDLMSDTDEEEEQPAEAIGQASEEKTEG 537
+V K+ P K G K D DED+DD + D +E++ E + +G
Sbjct: 117 LVATPGKKGAVTPAKGAKNGKNAKKEDSDEDEDDDDDEDDSDEDEEDEEEDEFEPPVVKG 176

Query: 538 TTGXXXXXXXXXXXXQAESDKEKLKEAESDKEQLPEAD 651
G E D+E+ +E E +++ E +
Sbjct: 177 KQGKVAAAAPASEDEDEEEDEEEEEEDEEEEDDSEEEE 214


>sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein
mask OS=Drosophila melanogaster GN=mask PE=1 SV=2
Length = 4001

Score = 37.4 bits (85), Expect = 0.069
Identities = 26/56 (46%), Positives = 31/56 (55%), Gaps = 2/56 (3%)
Frame = +1

Query: 376 KEEGFRPQKFRGPGNYQKSGDGDE--DKDDLMSDTDEEEEQPAEAIGQASEEKTEG 537
KEE R Q+ GPG GD D+ DKDD SD D+E+E+ A A A EE G
Sbjct: 2722 KEEKRRQQQGNGPGGDDMQGDDDDASDKDD-DSDKDDEDEEAAPA--AAREEGDSG 2774


>sp|Q00PI9|HNRL2_MOUSE Heterogeneous nuclear ribonucleoprotein
U-like protein 2 OS=Mus musculus GN=Hnrnpul2 PE=1 SV=1
Length = 745

Score = 36.6 bits (83), Expect = 0.12
Identities = 19/44 (43%), Positives = 29/44 (65%), Gaps = 2/44 (4%)
Frame = +1

Query: 409 GPGNYQKSGDGDEDKDD--LMSDTDEEEEQPAEAIGQASEEKTE 534
GPG ++ D DE++D+ L+ D DEE PA+A+GQA++ E
Sbjct: 70 GPGGDEEEEDDDEEEDEEALLEDEDEEPP-PAQALGQAAQPPPE 112


>sp|Q9BXP5|ARS2_HUMAN Arsenite-resistance protein 2 OS=Homo sapiens
GN=ARS2 PE=1 SV=1
Length = 876

Score = 36.2 bits (82), Expect = 0.15
Identities = 21/92 (22%), Positives = 42/92 (45%)
Frame = +1

Query: 376 KEEGFRPQKFRGPGNYQKSGDGDEDKDDLMSDTDEEEEQPAEAIGQASEEKTEGTTGXXX 555
KE+G + + + K +GD DK++ D+++E ++ ++ + G
Sbjct: 309 KEDGKQAENDSSNDDKTKKSEGDGDKEEKKEDSEKEAKKSSKKRNRKHSGDDSFDEGSVS 368

Query: 556 XXXXXXXXXQAESDKEKLKEAESDKEQLPEAD 651
QAE +KE+ +EA +KE+ E +
Sbjct: 369 ESESESESGQAEEEKEEAEEALKEKEKPKEEE 400


>sp|B0Z503|YCF2_OENBI Protein ycf2 OS=Oenothera biennis GN=ycf2-A PE=3
SV=1
Length = 2325

Score = 35.4 bits (80), Expect = 0.26
Identities = 27/111 (24%), Positives = 50/111 (45%), Gaps = 3/111 (2%)
Frame = +1

Query: 328 EDAVYGCDERVVTVSAKEEGFRPQKFRGPGNYQKSGDGDEDKDDLMSDTDEEEEQPAEAI 507
E+ V G +E V + EG ++ G ++ +G ED++ T+EE E +
Sbjct: 1876 EEEVEGTEEEVEGTEEEVEGTEDEEVEGT---EEEVEGTEDEEG--EGTEEEVEGTEDEE 1930

Query: 508 GQASEEKTEGT---TGXXXXXXXXXXXXQAESDKEKLKEAESDKEQLPEAD 651
G+ +EE+ EGT G + E +E+++ E ++ + E D
Sbjct: 1931 GEGTEEEVEGTEDEEGEGTEEEVEGTEEEVEGTEEEVEGTEDEEGEGTEKD 1981


>sp|O74515|ASF1_SCHPO Histone chaperone cia1 OS=Schizosaccharomyces
pombe GN=cia1 PE=1 SV=1
Length = 262

Score = 35.4 bits (80), Expect = 0.26
Identities = 17/42 (40%), Positives = 25/42 (59%)
Frame = +1

Query: 409 GPGNYQKSGDGDEDKDDLMSDTDEEEEQPAEAIGQASEEKTE 534
G G + G G E++++ D +EEEE+ A A A+EEK E
Sbjct: 214 GDGEGENDGKGSEEEEEEEIDIEEEEEESALANASAAEEKPE 255


>sp|B0Z587|YCF2_OENGL Protein ycf2 OS=Oenothera glazioviana GN=ycf2-A
PE=3 SV=1
Length = 2376

Score = 35.0 bits (79), Expect = 0.34
Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 5/76 (6%)
Frame = +1

Query: 328 EDAVYGCDERVVTVSAKEEGFRPQKFRGP-----GNYQKSGDGDEDKDDLMSDTDEEEEQ 492
E+ V G +E V + EG ++ G G + G+G E++ + T+EE E
Sbjct: 1896 EEEVEGTEEEVEGTEEEVEGTEDEEVEGTEEEVEGTEDEEGEGTEEE---VEGTEEEVEG 1952

Query: 493 PAEAIGQASEEKTEGT 540
+ G+ +EE+ EGT
Sbjct: 1953 TEDEEGEGTEEEVEGT 1968



Score = 30.8 bits (68), Expect = 6.5
Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 9/80 (11%)
Frame = +1

Query: 328 EDAVYGCDERVVTVSAKEEGFRPQKFRGPGNY----QKSGDGDEDK-----DDLMSDTDE 480
E+ V G +E V + EG ++ G ++ +G E++ D+ + T+E
Sbjct: 1867 EEEVEGTEEEVEGTEEEVEGTEDEEVEGTEEEVEGTEEEVEGTEEEVEGTEDEEVEGTEE 1926

Query: 481 EEEQPAEAIGQASEEKTEGT 540
E E + G+ +EE+ EGT
Sbjct: 1927 EVEGTEDEEGEGTEEEVEGT 1946


tr_hit_id A7NUF5
Definition tr|A7NUF5|A7NUF5_VITVI Chromosome chr18 scaffold_1, whole genome shotgun sequence OS=Vitis vinifera
Align length 104
Score (bit) 55.1
E-value 4.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960325|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_B20, 5'
(653 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7NUF5|A7NUF5_VITVI Chromosome chr18 scaffold_1, whole genome... 55 4e-06
tr|A5AYY7|A5AYY7_VITVI Putative uncharacterized protein OS=Vitis... 55 4e-06
tr|B6U784|B6U784_MAIZE Nucleic acid binding protein OS=Zea mays ... 54 8e-06
tr|A7Q480|A7Q480_VITVI Chromosome chr9 scaffold_49, whole genome... 54 8e-06
tr|A5C3R7|A5C3R7_VITVI Putative uncharacterized protein OS=Vitis... 54 8e-06
tr|A5AVR0|A5AVR0_VITVI Putative uncharacterized protein OS=Vitis... 54 8e-06
tr|B8AB32|B8AB32_ORYSI Putative uncharacterized protein OS=Oryza... 53 1e-05
tr|A2ZR31|A2ZR31_ORYSJ Putative uncharacterized protein OS=Oryza... 53 1e-05
tr|A9RYT2|A9RYT2_PHYPA Predicted protein (Fragment) OS=Physcomit... 48 6e-04
tr|B8LPZ5|B8LPZ5_PICSI Putative uncharacterized protein OS=Picea... 46 0.002
tr|B8LK75|B8LK75_PICSI Putative uncharacterized protein OS=Picea... 46 0.002
tr|Q8S7G1|Q8S7G1_ORYSA Putative nucleic acid binding protein OS=... 45 0.005
tr|Q10KN9|Q10KN9_ORYSJ Os03g0376800 protein OS=Oryza sativa subs... 45 0.005
tr|A2XHA9|A2XHA9_ORYSI Putative uncharacterized protein OS=Oryza... 45 0.005
tr|Q9LXF5|Q9LXF5_ARATH Putative uncharacterized protein F8M21_16... 44 0.009
tr|Q0WNX3|Q0WNX3_ARATH Putative uncharacterized protein At5g1527... 44 0.009
tr|B6UDK8|B6UDK8_MAIZE Nucleic acid binding protein OS=Zea mays ... 42 0.043
tr|B4LDW4|B4LDW4_DROVI GJ12366 OS=Drosophila virilis GN=GJ12366 ... 42 0.043
tr|A7QEB2|A7QEB2_VITVI Chromosome chr1 scaffold_84, whole genome... 41 0.056
tr|A7PMY5|A7PMY5_VITVI Chromosome chr14 scaffold_21, whole genom... 41 0.056
tr|A5C0V3|A5C0V3_VITVI Putative uncharacterized protein OS=Vitis... 41 0.056
tr|Q60D29|Q60D29_SOLDE KH domain containing protein OS=Solanum d... 41 0.073
tr|Q5NRN6|Q5NRN6_SOLDE KH domain containing protein, putative OS... 41 0.073
tr|Q9YTL7|Q9YTL7_ATHV3 Orf 48 OS=Ateline herpesvirus 3 PE=4 SV=1 40 0.095
tr|Q9XI71|Q9XI71_ARATH F7A19.25 protein OS=Arabidopsis thaliana ... 40 0.12
tr|Q84MA6|Q84MA6_ARATH At1g14170 (Putative uncharacterized prote... 40 0.12
tr|Q2V4N3|Q2V4N3_ARATH Uncharacterized protein At1g14170.2 OS=Ar... 40 0.12
tr|A7PAQ3|A7PAQ3_VITVI Chromosome chr14 scaffold_9, whole genome... 40 0.12
tr|A5BVB2|A5BVB2_VITVI Putative uncharacterized protein (Fragmen... 40 0.12
tr|Q8LNT9|Q8LNT9_ORYSJ Os10g0495000 protein OS=Oryza sativa subs... 40 0.16

>tr|A7NUF5|A7NUF5_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015027001
PE=4 SV=1
Length = 667

Score = 55.1 bits (131), Expect = 4e-06
Identities = 30/104 (28%), Positives = 50/104 (48%), Gaps = 12/104 (11%)
Frame = +1

Query: 214 GETVYRILCPAXXXXXXXXXXXXXXXXXRQDTGAMIRIEDAVYGCDERVVTVS------- 372
G V+R+LCPA RQ+TG +R+E+ V GCDERVV ++
Sbjct: 43 GTVVFRVLCPASKTGSVIGKGGTIISQIRQETGVKVRVEETVSGCDERVVLITGSDKDTE 102

Query: 373 -----AKEEGFRPQKFRGPGNYQKSGDGDEDKDDLMSDTDEEEE 489
+KE+G + + ++ G+ DEDK+ + + + E+
Sbjct: 103 ADNEQSKEDGEDTKAAEEVSDTKEPGENDEDKESVPVEDSQVEK 146


>tr|A5AYY7|A5AYY7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_026793 PE=4 SV=1
Length = 709

Score = 55.1 bits (131), Expect = 4e-06
Identities = 30/104 (28%), Positives = 50/104 (48%), Gaps = 12/104 (11%)
Frame = +1

Query: 214 GETVYRILCPAXXXXXXXXXXXXXXXXXRQDTGAMIRIEDAVYGCDERVVTVS------- 372
G V+R+LCPA RQ+TG +R+E+ V GCDERVV ++
Sbjct: 43 GTVVFRVLCPASKTGSVIGKGGTIISQIRQETGVKVRVEETVSGCDERVVLITGSDKDTE 102

Query: 373 -----AKEEGFRPQKFRGPGNYQKSGDGDEDKDDLMSDTDEEEE 489
+KE+G + + ++ G+ DEDK+ + + + E+
Sbjct: 103 ADNEQSKEDGEDTKAAEEVSDTKEPGENDEDKESVPVEDSQVEK 146


>tr|B6U784|B6U784_MAIZE Nucleic acid binding protein OS=Zea mays
PE=2 SV=1
Length = 705

Score = 53.9 bits (128), Expect = 8e-06
Identities = 40/181 (22%), Positives = 70/181 (38%), Gaps = 3/181 (1%)
Frame = +1

Query: 73 SALPAGKRPLSDIAREAEANGRASKRRTPQKRAAXXXXXXXXXXXKRGETVYRILCPAXX 252
S + KRP + + + G+ K + P + + G ++RILCPA
Sbjct: 3 SRMTPSKRPFQRRSSDYDGRGKWQKTKHPSPHKSQFKI-------EPGVPIFRILCPASK 55

Query: 253 XXXXXXXXXXXXXXXRQDTGAMIRIEDAVYGCDERVVTVSA---KEEGFRPQKFRGPGNY 423
RQ+T IR++ A GCDERV+ ++A EE Q G
Sbjct: 56 SGNVIGKGGAIIAKIRQETRMRIRVDRAAPGCDERVIFITAANKDEEAGSEQGGENDGGA 115

Query: 424 QKSGDGDEDKDDLMSDTDEEEEQPAEAIGQASEEKTEGTTGXXXXXXXXXXXXQAESDKE 603
S GD +KD + ++ + + +++ +G+ + ++D E
Sbjct: 116 AASTGGDHEKDKDNNSKEQNVDPEENNCNEQNDDSEKGSGKEEIDGFEKDHGTEEKNDSE 175

Query: 604 K 606
K
Sbjct: 176 K 176


>tr|A7Q480|A7Q480_VITVI Chromosome chr9 scaffold_49, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00029576001
PE=4 SV=1
Length = 675

Score = 53.9 bits (128), Expect = 8e-06
Identities = 43/153 (28%), Positives = 68/153 (44%), Gaps = 10/153 (6%)
Frame = +1

Query: 73 SALPAGKRPLSDIAREAEANGRASKRRTPQKRAAXXXXXXXXXXX-----KRGETVYRIL 237
S+LP KR +D + A A A +R P +A + + ++RIL
Sbjct: 4 SSLP--KRLPADSSTAASAEPTAKRRNQPTATSAASAATSSPPTVVAAGAAKPQVLFRIL 61

Query: 238 CPAXXXXXXXXXXXXXXXXXRQDTGAMIRIEDAVYGCDERVVTVSAKEEGFRPQKFRGPG 417
CPA R+DTGA IRI+D+V GCDERV+ + A + + ++
Sbjct: 62 CPATKTGGVIGKGGAIIRQFREDTGAKIRIDDSVLGCDERVILIVA--DAVKSKREASAI 119

Query: 418 NYQKSGDGDEDKDDLMSD-----TDEEEEQPAE 501
++ DG+E + S D++E PA+
Sbjct: 120 CGAEANDGEESANLSNSSPNPVAVDDDESSPAQ 152



Score = 35.8 bits (81), Expect = 2.3
Identities = 19/55 (34%), Positives = 27/55 (49%)
Frame = +1

Query: 217 ETVYRILCPAXXXXXXXXXXXXXXXXXRQDTGAMIRIEDAVYGCDERVVTVSAKE 381
E V+++LC + +TGA I+I DA DERVV +SA+E
Sbjct: 297 EVVFKLLCHFEKVGSLIGKGGSIIRFLQSETGASIKIADAAPDSDERVVVISARE 351


>tr|A5C3R7|A5C3R7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_030085 PE=4 SV=1
Length = 288

Score = 53.9 bits (128), Expect = 8e-06
Identities = 43/153 (28%), Positives = 68/153 (44%), Gaps = 10/153 (6%)
Frame = +1

Query: 73 SALPAGKRPLSDIAREAEANGRASKRRTPQKRAAXXXXXXXXXXX-----KRGETVYRIL 237
S+LP KR +D + A A A +R P +A + + ++RIL
Sbjct: 48 SSLP--KRLPADSSTAASAEPTAKRRNQPTATSAASAATSSPPTVVAAGAAKPQVLFRIL 105

Query: 238 CPAXXXXXXXXXXXXXXXXXRQDTGAMIRIEDAVYGCDERVVTVSAKEEGFRPQKFRGPG 417
CPA R+DTGA IRI+D+V GCDERV+ + A + + ++
Sbjct: 106 CPATKTGGVIGKGGAIIRQFREDTGAKIRIDDSVLGCDERVILIVA--DAVKSKREASAI 163

Query: 418 NYQKSGDGDEDKDDLMSD-----TDEEEEQPAE 501
++ DG+E + S D++E PA+
Sbjct: 164 CGAEANDGEESANLRNSSPNPVAVDDDESSPAQ 196


>tr|A5AVR0|A5AVR0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_006585 PE=4 SV=1
Length = 807

Score = 53.9 bits (128), Expect = 8e-06
Identities = 43/153 (28%), Positives = 68/153 (44%), Gaps = 10/153 (6%)
Frame = +1

Query: 73 SALPAGKRPLSDIAREAEANGRASKRRTPQKRAAXXXXXXXXXXX-----KRGETVYRIL 237
S+LP KR +D + A A A +R P +A + + ++RIL
Sbjct: 4 SSLP--KRLPADSSTAASAEPTAKRRNQPTATSAASAATSSPPTVVAAXAAKPQVLFRIL 61

Query: 238 CPAXXXXXXXXXXXXXXXXXRQDTGAMIRIEDAVYGCDERVVTVSAKEEGFRPQKFRGPG 417
CPA R+DTGA IRI+D+V GCDERV+ + A + + ++
Sbjct: 62 CPATKTGGVIGKGGAIIRQFREDTGAKIRIDDSVLGCDERVILIVA--DAVKSKREASAI 119

Query: 418 NYQKSGDGDEDKDDLMSD-----TDEEEEQPAE 501
++ DG+E + S D++E PA+
Sbjct: 120 CGAEANDGEESANLSNSSPNPVAVDDDESSPAQ 152



Score = 35.8 bits (81), Expect = 2.3
Identities = 20/55 (36%), Positives = 28/55 (50%)
Frame = +1

Query: 217 ETVYRILCPAXXXXXXXXXXXXXXXXXRQDTGAMIRIEDAVYGCDERVVTVSAKE 381
E V+++LC + +TGA I+I DA DERVV +SA+E
Sbjct: 423 EVVFKLLCHFEKVGSLIGKGGSIIRXLQSETGASIKIADAAPDSDERVVVISARE 477


>tr|B8AB32|B8AB32_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_01061 PE=4 SV=1
Length = 722

Score = 53.1 bits (126), Expect = 1e-05
Identities = 51/193 (26%), Positives = 72/193 (37%), Gaps = 6/193 (3%)
Frame = +1

Query: 91 KRPLSDIAREAEANGRASKRRTPQKRAAXXXXXXXXXXXKRGETVYRILCPAXXXXXXXX 270
KRP +E NGR ++T + G ++RILCP
Sbjct: 52 KRPFQK--NSSEQNGRGKWQKTKHNSLQQPQLIV-----QPGVPIFRILCPTSKSGNVIG 104

Query: 271 XXXXXXXXXRQDTGAMIRIEDAVYGCDERVVTVSA---KEEGFRPQKFRGPGNYQKSGDG 441
RQ+TG IR+++ V GCDERV+ ++A E Q G S DG
Sbjct: 105 KGGGIIAKIRQETGVKIRVDEVVPGCDERVIVITAIDKDREVSHVQTKENDGGVACSVDG 164

Query: 442 DE--DKDDLMSDTDE-EEEQPAEAIGQASEEKTEGTTGXXXXXXXXXXXXQAESDKEKLK 612
+ +KD + DE +E G EEK + E D +K
Sbjct: 165 NHGMEKDHTKEEKDESNKEMDDSEKGLGKEEKDD-----------------LEKDHDKED 207

Query: 613 EAESDKEQLPEAD 651
ES K+ +AD
Sbjct: 208 RDESGKDNDKKAD 220


>tr|A2ZR31|A2ZR31_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_001003 PE=4 SV=1
Length = 861

Score = 53.1 bits (126), Expect = 1e-05
Identities = 51/193 (26%), Positives = 72/193 (37%), Gaps = 6/193 (3%)
Frame = +1

Query: 91 KRPLSDIAREAEANGRASKRRTPQKRAAXXXXXXXXXXXKRGETVYRILCPAXXXXXXXX 270
KRP +E NGR ++T + G ++RILCP
Sbjct: 52 KRPFQK--NSSEQNGRGKWQKTKHNSLQQPQLIV-----QPGVPIFRILCPTSKSGNVIG 104

Query: 271 XXXXXXXXXRQDTGAMIRIEDAVYGCDERVVTVSA---KEEGFRPQKFRGPGNYQKSGDG 441
RQ+TG IR+++ V GCDERV+ ++A E Q G S DG
Sbjct: 105 KGGGIIAKIRQETGVKIRVDEVVPGCDERVIVITAIDKDREVSHVQTKENDGGVACSVDG 164

Query: 442 DE--DKDDLMSDTDE-EEEQPAEAIGQASEEKTEGTTGXXXXXXXXXXXXQAESDKEKLK 612
+ +KD + DE +E G EEK + E D +K
Sbjct: 165 NHGMEKDHTKEEKDESNKEMDDSEKGLGKEEKDD-----------------LEKDHDKED 207

Query: 613 EAESDKEQLPEAD 651
ES K+ +AD
Sbjct: 208 RDESGKDNDKKAD 220


>tr|A9RYT2|A9RYT2_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_31719 PE=4 SV=1
Length = 427

Score = 47.8 bits (112), Expect = 6e-04
Identities = 33/114 (28%), Positives = 52/114 (45%), Gaps = 17/114 (14%)
Frame = +1

Query: 217 ETVYRILCPAXXXXXXXXXXXXXXXXXRQDTGAMIRIEDAVYGCDERVVTVSAKEEGFRP 396
+ V+RILCPA RQ++GA I+I DA+ G DERV+ +S+ + G
Sbjct: 2 DVVFRILCPAPKIGSVIGKGGSIIKTLRQESGAKIKIADAIPGVDERVILISSTDRG--- 58

Query: 397 QKFRGPGNYQKSGDGDE-----------------DKDDLMSDTDEEEEQPAEAI 507
RG G K G+ +E D + D ++EE+P++ +
Sbjct: 59 -NDRGRG---KDGNSEELTPAQEALFKVHARIIADVETSGIDGSDQEEEPSQQV 108



Score = 45.1 bits (105), Expect = 0.004
Identities = 24/55 (43%), Positives = 31/55 (56%)
Frame = +1

Query: 217 ETVYRILCPAXXXXXXXXXXXXXXXXXRQDTGAMIRIEDAVYGCDERVVTVSAKE 381
E V+R+LCP+ R+DTGA I+I +AV G DERV+ VSA E
Sbjct: 259 ELVFRLLCPSDKIGSVIGKGGSIIHNLRKDTGARIKIANAVPGSDERVIIVSALE 313


>tr|B8LPZ5|B8LPZ5_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 435

Score = 46.2 bits (108), Expect = 0.002
Identities = 42/144 (29%), Positives = 58/144 (40%)
Frame = +1

Query: 70 MSALPAGKRPLSDIAREAEANGRASKRRTPQKRAAXXXXXXXXXXXKRGETVYRILCPAX 249
M+ L +GKR ++ AE N R +R + R TVYRILCP+
Sbjct: 1 MAGLYSGKRTRTEHDL-AENNDRNKRRNSGTGREQTMPGAD--------STVYRILCPSN 51

Query: 250 XXXXXXXXXXXXXXXXRQDTGAMIRIEDAVYGCDERVVTVSAKEEGFRPQKFRGPGNYQK 429
RQ+T + IR+ DAV G DERV+ + F P + K
Sbjct: 52 VIGSVIGKGGKVIKSMRQETRSKIRVADAVPGVDERVIVI-----------FSSPLSKDK 100

Query: 430 SGDGDEDKDDLMSDTDEEEEQPAE 501
D D+D D + E PA+
Sbjct: 101 EKDDDDD------DNENEPVCPAQ 118



Score = 40.4 bits (93), Expect = 0.095
Identities = 22/51 (43%), Positives = 25/51 (49%)
Frame = +1

Query: 229 RILCPAXXXXXXXXXXXXXXXXXRQDTGAMIRIEDAVYGCDERVVTVSAKE 381
R+LCP R DTGA IR+EDA DERV+ VSA E
Sbjct: 319 RVLCPNDKIGGVIGKGGNTIKSMRNDTGASIRVEDAQTESDERVIVVSATE 369