DK960365
Clone id TST39A01NGRL0007_D14
Library
Length 609
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0007_D14. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
ATCAGTCTCCTCGTATTTAACGGAGATCTGTTTTATTATCTTCCAGCAAAATCTCTCTCT
CTCCCTCTCTCGGCCTTCAAACACTTGCTGCCTTGTCTTGTTTGGAAGGTCGAGCGACTC
GCGGGATGGATCGCTCAGATGCGTTTGCTGTTTCGGAATTTATGCTCACCGAGCTTGAAA
GGCGCTTTTGAATGAGGTTTTGGTTGATCCAAAGGCAAAACCAAACATGATCAAGCATAT
ACTGGGCCGGCTTCCTCGCAGCAGCAAGCCACCCAAGTCGGAGGTTTCAAATAATGAGGC
AGATGGGGGGGCCAATACAAGCACTGCTTCAGCCTCCTTGGTAATGCACAACAGGTTGGG
TGCAAAAGACGTCAGGTTAACCCCATTTCCTGTATGTAGCGGTGCAGACACATCCTTTGA
GCCCTTACCTTCATTTCGAGATGTGCCCAGCTCGGAGAGGCCGAACCTTTTCATCAGAAA
GCTCGACCTGTGCTGTGTAGTTTTTGATTTTTCAGATGCCAGCAAGAATGTCAAGGAGAA
GGAGATCAAGCGCCAGACCCTCGTGGAGCTTGTTGACTATGTCGGCTCCTGCACAAGTAA
GTTCTCTGA
■■Homology search results ■■ -
sp_hit_id Q8RW96
Definition sp|Q8RW96|2A5G_ARATH Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit B' gamma isoform OS=Arabidopsis thaliana
Align length 142
Score (bit) 119.0
E-value 2.0e-26
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960365|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_D14, 5'
(609 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8RW96|2A5G_ARATH Serine/threonine protein phosphatase 2A 59 ... 119 2e-26
sp|Q9LVE2|2A5Z_ARATH Serine/threonine protein phosphatase 2A 59 ... 117 6e-26
sp|Q8LF36|2A5T_ARATH Serine/threonine protein phosphatase 2A 57 ... 108 2e-23
sp|Q9LU89|2A5N_ARATH Serine/threonine protein phosphatase 2A 59 ... 99 2e-20
sp|O04376|2A5B_ARATH Serine/threonine protein phosphatase 2A 57 ... 95 3e-19
sp|Q93YV6|2A5I_ARATH Serine/threonine protein phosphatase 2A 57 ... 94 5e-19
sp|O04375|2A5A_ARATH Serine/threonine protein phosphatase 2A 57 ... 85 3e-16
sp|Q9ZQY6|2A5D_ARATH Serine/threonine protein phosphatase 2A 55 ... 79 2e-14
sp|Q28654|2A5E_RABIT Serine/threonine-protein phosphatase 2A 56 ... 75 2e-13
sp|Q16537|2A5E_HUMAN Serine/threonine-protein phosphatase 2A 56 ... 75 2e-13
sp|Q61151|2A5E_MOUSE Serine/threonine-protein phosphatase 2A 56 ... 74 4e-13
sp|Q15172|2A5A_HUMAN Serine/threonine-protein phosphatase 2A 56 ... 70 1e-11
sp|Q6PD03|2A5A_MOUSE Serine/threonine-protein phosphatase 2A 56 ... 69 2e-11
sp|P78759|2AD2_SCHPO Serine/threonine-protein phosphatase 2A 56 ... 67 7e-11
sp|Q9SV41|2A5E_ARATH Serine/threonine protein phosphatase 2A 57 ... 67 9e-11
sp|Q28653|2A5D_RABIT Serine/threonine-protein phosphatase 2A 56 ... 64 8e-10
sp|Q14738|2A5D_HUMAN Serine/threonine-protein phosphatase 2A 56 ... 62 2e-09
sp|Q10428|2AD1_SCHPO Serine/threonine-protein phosphatase 2A 56 ... 59 2e-08
sp|Q28647|2A5B_RABIT Serine/threonine-protein phosphatase 2A 56 ... 58 3e-08
sp|Q15173|2A5B_HUMAN Serine/threonine-protein phosphatase 2A 56 ... 58 4e-08
sp|P38903|2A5D_YEAST Serine/threonine-protein phosphatase 2A 56 ... 57 7e-08
sp|Q28651|2A5G_RABIT Serine/threonine-protein phosphatase 2A 56 ... 56 2e-07
sp|Q60996|2A5G_MOUSE Serine/threonine-protein phosphatase 2A 56 ... 56 2e-07
sp|Q13362|2A5G_HUMAN Serine/threonine-protein phosphatase 2A 56 ... 56 2e-07
sp|Q5I0E6|RPAP2_RAT RNA polymerase II-associated protein 2 OS=Ra... 35 0.39
sp|Q7JJ13|BRD2_MOUSE Bromodomain-containing protein 2 OS=Mus mus... 32 3.3
sp|Q8VC34|RPAP2_MOUSE RNA polymerase II-associated protein 2 OS=... 31 5.6
sp|Q9C091|GRB1L_HUMAN GREB1-like protein OS=Homo sapiens GN=KIAA... 31 5.7
sp|Q2JV13|SYL_SYNJA Leucyl-tRNA synthetase OS=Synechococcus sp. ... 30 7.4
sp|Q4I877|NDE1_GIBZE Nuclear distribution protein nudE homolog 1... 30 7.4

>sp|Q8RW96|2A5G_ARATH Serine/threonine protein phosphatase 2A 59 kDa
regulatory subunit B' gamma isoform OS=Arabidopsis
thaliana GN=B'GAMMA PE=1 SV=2
Length = 522

Score = 119 bits (297), Expect = 2e-26
Identities = 65/142 (45%), Positives = 83/142 (58%), Gaps = 15/142 (10%)
Frame = +2

Query: 227 MIKHILGRLPRSSKPPKSEVSNNEADGGANT-----------STASASLVMHNRLGAKDV 373
MIK I G+LPR SN +GG N+ S S+ N GA
Sbjct: 1 MIKQIFGKLPRKPSKSSHNDSNPNGEGGVNSYYIPNSGISSISKPSSKSSASNSNGANGT 60

Query: 374 RLTPFPVCSGADTS----FEPLPSFRDVPSSERPNLFIRKLDLCCVVFDFSDASKNVKEK 541
+ P S +E LPSFRDVP+SE+PNLFI+KL +CCVVFDF+D SKN++EK
Sbjct: 61 VIAPSSTSSNRTNQVNGVYEALPSFRDVPTSEKPNLFIKKLSMCCVVFDFNDPSKNLREK 120

Query: 542 EIKRQTLVELVDYVGSCTSKFS 607
EIKRQTL+ELVDY+ + ++K S
Sbjct: 121 EIKRQTLLELVDYIATVSTKLS 142


>sp|Q9LVE2|2A5Z_ARATH Serine/threonine protein phosphatase 2A 59 kDa
regulatory subunit B' zeta isoform OS=Arabidopsis
thaliana GN=B'ZETA PE=2 SV=2
Length = 546

Score = 117 bits (292), Expect = 6e-26
Identities = 76/168 (45%), Positives = 91/168 (54%), Gaps = 41/168 (24%)
Frame = +2

Query: 227 MIKHILGRLPRSSKPPKSEVSNNEADGGAN----------------------TSTASASL 340
MIK I G+LPR KP KS +++ +GG N +S+AS S
Sbjct: 1 MIKQIFGKLPR--KPSKSLQNDSNGEGGVNNSYYASNSSTTSISKPSSTSSKSSSASGSR 58

Query: 341 VMHNRL-------------------GAKDVRLTPFPVCSGADTSFEPLPSFRDVPSSERP 463
V + L G V+ PFP G +E LPSFRDVP SE+P
Sbjct: 59 VANGTLAPNSMSSNRNTNQGKKPLGGDAVVQAGPFPSSGGV---YEALPSFRDVPISEKP 115

Query: 464 NLFIRKLDLCCVVFDFSDASKNVKEKEIKRQTLVELVDYVGSCTSKFS 607
NLFI KL +CCVVFDFSD SKN+KEKEIKRQTL+ELVDYV S KF+
Sbjct: 116 NLFIGKLSMCCVVFDFSDPSKNLKEKEIKRQTLLELVDYVASVGFKFN 163


>sp|Q8LF36|2A5T_ARATH Serine/threonine protein phosphatase 2A 57 kDa
regulatory subunit B' theta isoform OS=Arabidopsis
thaliana GN=B'THETA PE=2 SV=2
Length = 492

Score = 108 bits (271), Expect = 2e-23
Identities = 66/136 (48%), Positives = 83/136 (61%), Gaps = 9/136 (6%)
Frame = +2

Query: 227 MIKHILGRLPR--------SSKPPKSEVSNNEADGGANTSTASASLVMHNR-LGAKDVRL 379
M K IL +LP+ SS S+ S+N A N+ T +A V + G K+ L
Sbjct: 1 MWKQILSKLPKKSSSKNHSSSSSSTSKSSDNGASKSGNSQTQNAPPVKPSADSGFKEGNL 60

Query: 380 TPFPVCSGADTSFEPLPSFRDVPSSERPNLFIRKLDLCCVVFDFSDASKNVKEKEIKRQT 559
T +E LP F+DVP++E+ NLF+RKL LCCVVFDFSD +KNVKEK+IKRQT
Sbjct: 61 KGN---GNGFTPYEALPGFKDVPNAEKQNLFVRKLSLCCVVFDFSDPTKNVKEKDIKRQT 117

Query: 560 LVELVDYVGSCTSKFS 607
L+ELVDYV S KFS
Sbjct: 118 LLELVDYVASPNGKFS 133


>sp|Q9LU89|2A5N_ARATH Serine/threonine protein phosphatase 2A 59 kDa
regulatory subunit B' eta isoform OS=Arabidopsis
thaliana GN=B'ETA PE=2 SV=1
Length = 510

Score = 98.6 bits (244), Expect = 2e-20
Identities = 46/70 (65%), Positives = 59/70 (84%)
Frame = +2

Query: 398 SGADTSFEPLPSFRDVPSSERPNLFIRKLDLCCVVFDFSDASKNVKEKEIKRQTLVELVD 577
+G T +E LPSF+DVP++E+ NLFI+KL+LC VVFDF+D +KN+KEK+IKRQTL+ELVD
Sbjct: 85 NGVFTPYEALPSFKDVPNTEKQNLFIKKLNLCRVVFDFTDPTKNIKEKDIKRQTLLELVD 144

Query: 578 YVGSCTSKFS 607
YV S KFS
Sbjct: 145 YVNSPNGKFS 154


>sp|O04376|2A5B_ARATH Serine/threonine protein phosphatase 2A 57 kDa
regulatory subunit B' beta isoform OS=Arabidopsis
thaliana GN=B'BETA PE=1 SV=1
Length = 499

Score = 94.7 bits (234), Expect = 3e-19
Identities = 57/124 (45%), Positives = 71/124 (57%), Gaps = 10/124 (8%)
Frame = +2

Query: 266 KPPKSEVS----------NNEADGGANTSTASASLVMHNRLGAKDVRLTPFPVCSGADTS 415
KP KSE + +N + G+N + AS V TP P G S
Sbjct: 12 KPSKSEANEPSSYGIGLPDNRSGPGSNVVVSHASRGALVNSSPSPVTATPPPPPLG---S 68

Query: 416 FEPLPSFRDVPSSERPNLFIRKLDLCCVVFDFSDASKNVKEKEIKRQTLVELVDYVGSCT 595
EPLP FRDVP SER LF+RKL CC +FDF+D KN ++KEIKRQTL+ELVD++ S +
Sbjct: 69 VEPLPLFRDVPVSERQTLFLRKLQNCCFLFDFTDTIKNARDKEIKRQTLLELVDFIQSGS 128

Query: 596 SKFS 607
SK S
Sbjct: 129 SKIS 132


>sp|Q93YV6|2A5I_ARATH Serine/threonine protein phosphatase 2A 57 kDa
regulatory subunit B' iota isoform OS=Arabidopsis
thaliana GN=B'IOTA PE=2 SV=1
Length = 500

Score = 94.0 bits (232), Expect = 5e-19
Identities = 56/134 (41%), Positives = 73/134 (54%), Gaps = 7/134 (5%)
Frame = +2

Query: 227 MIKHILGRLPRSSKPPKSEVSNNEADGGAN-------TSTASASLVMHNRLGAKDVRLTP 385
M K L +LPR S S N + G + TS + V N + P
Sbjct: 1 MFKQFLSKLPRKSSKSDSGELNRSSSGPVSSPVQRSGTSGGGSGPVRSNSGKRMSSAVFP 60

Query: 386 FPVCSGADTSFEPLPSFRDVPSSERPNLFIRKLDLCCVVFDFSDASKNVKEKEIKRQTLV 565
V +G EPL F+DVPSSE+ NLF+ K+ LCCV FDFSD KN EK++KRQTL+
Sbjct: 61 ASVVAG----IEPLVPFKDVPSSEKLNLFVSKVSLCCVTFDFSDPGKNSIEKDVKRQTLL 116

Query: 566 ELVDYVGSCTSKFS 607
EL+D+V S + KF+
Sbjct: 117 ELLDFVASGSVKFT 130


>sp|O04375|2A5A_ARATH Serine/threonine protein phosphatase 2A 57 kDa
regulatory subunit B' alpha isoform OS=Arabidopsis
thaliana GN=B'ALPHA PE=1 SV=1
Length = 495

Score = 85.1 bits (209), Expect = 3e-16
Identities = 40/65 (61%), Positives = 49/65 (75%)
Frame = +2

Query: 413 SFEPLPSFRDVPSSERPNLFIRKLDLCCVVFDFSDASKNVKEKEIKRQTLVELVDYVGSC 592
S EPLP FRDV SER +LF+RKL +CC FDF+D KN +EKEIKRQTL+ELVD++ S
Sbjct: 68 SVEPLPLFRDVSVSERQSLFLRKLQICCFQFDFTDTLKNAREKEIKRQTLLELVDFIQSG 127

Query: 593 TSKFS 607
K +
Sbjct: 128 AGKLT 132


>sp|Q9ZQY6|2A5D_ARATH Serine/threonine protein phosphatase 2A 55 kDa
regulatory subunit B' delta isoform OS=Arabidopsis
thaliana GN=B'DELTA PE=1 SV=1
Length = 477

Score = 79.0 bits (193), Expect = 2e-14
Identities = 55/126 (43%), Positives = 71/126 (56%), Gaps = 7/126 (5%)
Frame = +2

Query: 227 MIKHILGRLPRSSKPPKSEVSNNEADGGANTSTASASLVMHNRLGAKDVRLTPFPVCSGA 406
M K ILG+LP+ + S D G S +L +N G D L+ S
Sbjct: 1 MFKQILGKLPKKT-------SAKFWDNGE-----SQTLDNNNNQGGGDEVLSQ-RTSSNG 47

Query: 407 DTS------FEPLPSFRDVPSSERPNLFIRKLDLCCVVFDF-SDASKNVKEKEIKRQTLV 565
DTS F+ LP RDV SE+ LF++KL LCC+VFDF ++ +N KEKEIKRQTL+
Sbjct: 48 DTSLDCVSSFDVLPRLRDVSISEKQELFLKKLRLCCLVFDFVAEPQQNFKEKEIKRQTLL 107

Query: 566 ELVDYV 583
E+VDYV
Sbjct: 108 EVVDYV 113


>sp|Q28654|2A5E_RABIT Serine/threonine-protein phosphatase 2A 56 kDa
regulatory subunit epsilon isoform (Fragment)
OS=Oryctolagus cuniculus GN=PPP2R5E PE=2 SV=1
Length = 165

Score = 75.5 bits (184), Expect = 2e-13
Identities = 34/61 (55%), Positives = 42/61 (68%)
Frame = +2

Query: 401 GADTSFEPLPSFRDVPSSERPNLFIRKLDLCCVVFDFSDASKNVKEKEIKRQTLVELVDY 580
G PLP +DVPSSE+P LF++KL CCV+FDF D ++K KE KR TL ELVDY
Sbjct: 40 GKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDY 99

Query: 581 V 583
+
Sbjct: 100 I 100


>sp|Q16537|2A5E_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa
regulatory subunit epsilon isoform OS=Homo sapiens
GN=PPP2R5E PE=1 SV=1
Length = 467

Score = 75.5 bits (184), Expect = 2e-13
Identities = 34/61 (55%), Positives = 42/61 (68%)
Frame = +2

Query: 401 GADTSFEPLPSFRDVPSSERPNLFIRKLDLCCVVFDFSDASKNVKEKEIKRQTLVELVDY 580
G PLP +DVPSSE+P LF++KL CCV+FDF D ++K KE KR TL ELVDY
Sbjct: 40 GKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDY 99

Query: 581 V 583
+
Sbjct: 100 I 100


tr_hit_id Q0WNY8
Definition tr|Q0WNY8|Q0WNY8_ARATH Phosphatase like protein OS=Arabidopsis thaliana
Align length 142
Score (bit) 119.0
E-value 2.0e-25
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960365|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_D14, 5'
(609 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q0WNY8|Q0WNY8_ARATH Phosphatase like protein OS=Arabidopsis t... 119 2e-25
tr|Q01IF6|Q01IF6_ORYSA H0805A05.14 protein OS=Oryza sativa GN=H0... 118 2e-25
tr|Q7FAG9|Q7FAG9_ORYSJ Os04g0485100 protein OS=Oryza sativa subs... 117 7e-25
tr|A2XUT8|A2XUT8_ORYSI Putative uncharacterized protein OS=Oryza... 117 7e-25
tr|A7PLV2|A7PLV2_VITVI Chromosome chr14 scaffold_21, whole genom... 116 1e-24
tr|A5AQF8|A5AQF8_VITVI Putative uncharacterized protein (Chromos... 112 2e-23
tr|A9PGQ5|A9PGQ5_POPTR Putative uncharacterized protein OS=Popul... 111 3e-23
tr|Q0V836|Q0V836_ARATH At1g13460 OS=Arabidopsis thaliana PE=2 SV=1 108 2e-22
tr|B8BAE1|B8BAE1_ORYSI Putative uncharacterized protein OS=Oryza... 108 2e-22
tr|A7QBU1|A7QBU1_VITVI Chromosome chr1 scaffold_75, whole genome... 105 2e-21
tr|A3BP63|A3BP63_ORYSJ Putative uncharacterized protein OS=Oryza... 104 5e-21
tr|B7ZZN9|B7ZZN9_MAIZE Putative uncharacterized protein OS=Zea m... 103 6e-21
tr|A5BUF9|A5BUF9_VITVI Putative uncharacterized protein OS=Vitis... 103 1e-20
tr|Q8L6I5|Q8L6I5_ORYSA Putative uncharacterized protein B'teta O... 102 1e-20
tr|Q6YX33|Q6YX33_ORYSJ Os08g0122000 protein OS=Oryza sativa subs... 102 1e-20
tr|Q32SG1|Q32SG1_MAIZE Protein phosphatase 2A regulatory subunit... 100 7e-20
tr|B7ZXL7|B7ZXL7_MAIZE Putative uncharacterized protein OS=Zea m... 100 7e-20
tr|Q8L6I7|Q8L6I7_ORYSA Protein phosphatase 2A B'kappa subunit OS... 100 1e-19
tr|Q6I621|Q6I621_ORYSJ Protein phosphatase 2A B'kappa subunit (P... 100 1e-19
tr|A2Y7A2|A2Y7A2_ORYSI Putative uncharacterized protein OS=Oryza... 100 1e-19
tr|Q6YXJ6|Q6YXJ6_ORYSJ Os07g0274800 protein OS=Oryza sativa subs... 99 2e-19
tr|B8B516|B8B516_ORYSI Putative uncharacterized protein OS=Oryza... 99 2e-19
tr|A9SJF2|A9SJF2_PHYPA Predicted protein OS=Physcomitrella paten... 99 2e-19
tr|A3BIK5|A3BIK5_ORYSJ Putative uncharacterized protein OS=Oryza... 99 2e-19
tr|A3APN5|A3APN5_ORYSJ Putative uncharacterized protein OS=Oryza... 99 2e-19
tr|A9TVY5|A9TVY5_PHYPA Predicted protein OS=Physcomitrella paten... 97 6e-19
tr|Q8L6I6|Q8L6I6_ORYSA Putative uncharacterized protein B'zeta O... 97 9e-19
tr|Q75LC7|Q75LC7_ORYSJ Os03g0844500 protein OS=Oryza sativa subs... 97 9e-19
tr|Q0DG37|Q0DG37_ORYSJ Os05g0555100 protein (Fragment) OS=Oryza ... 97 9e-19
tr|B8AN84|B8AN84_ORYSI Putative uncharacterized protein OS=Oryza... 97 9e-19

>tr|Q0WNY8|Q0WNY8_ARATH Phosphatase like protein OS=Arabidopsis
thaliana GN=At4g15415 PE=2 SV=1
Length = 522

Score = 119 bits (297), Expect = 2e-25
Identities = 65/142 (45%), Positives = 83/142 (58%), Gaps = 15/142 (10%)
Frame = +2

Query: 227 MIKHILGRLPRSSKPPKSEVSNNEADGGANT-----------STASASLVMHNRLGAKDV 373
MIK I G+LPR SN +GG N+ S S+ N GA
Sbjct: 1 MIKQIFGKLPRKPSKSSHNDSNPNGEGGVNSYYIPNSGISSISKPSSKSSASNSNGANGT 60

Query: 374 RLTPFPVCSGADTS----FEPLPSFRDVPSSERPNLFIRKLDLCCVVFDFSDASKNVKEK 541
+ P S +E LPSFRDVP+SE+PNLFI+KL +CCVVFDF+D SKN++EK
Sbjct: 61 VIAPSSTSSNRTNQVNGVYEALPSFRDVPTSEKPNLFIKKLSMCCVVFDFNDPSKNLREK 120

Query: 542 EIKRQTLVELVDYVGSCTSKFS 607
EIKRQTL+ELVDY+ + ++K S
Sbjct: 121 EIKRQTLLELVDYIATVSTKLS 142


>tr|Q01IF6|Q01IF6_ORYSA H0805A05.14 protein OS=Oryza sativa
GN=H0805A05.14 PE=4 SV=1
Length = 509

Score = 118 bits (296), Expect = 2e-25
Identities = 69/138 (50%), Positives = 88/138 (63%), Gaps = 11/138 (7%)
Frame = +2

Query: 227 MIKHILGRLPRSSKPPKSEVSNNEADGGANTSTASASLVMHNRLGAK---------DVRL 379
MIK ILGRLPR KP K+ S + A N + S S+ G K L
Sbjct: 1 MIKQILGRLPR--KPGKAGDSRDAAGPNGNEPSNSYSVARSVEQGNKRSGNGDYVVPAGL 58

Query: 380 TPFPVCSGADT--SFEPLPSFRDVPSSERPNLFIRKLDLCCVVFDFSDASKNVKEKEIKR 553
TP P+ +G S EPLP+F+DVP+SE+ NLF++K++LCCVV+DF+D +KN+KEKE KR
Sbjct: 59 TPNPMMNGTVVYHSNEPLPAFKDVPASEKQNLFVKKVNLCCVVYDFADPTKNLKEKETKR 118

Query: 554 QTLVELVDYVGSCTSKFS 607
QTL+ELVDYV S KFS
Sbjct: 119 QTLMELVDYVTSANGKFS 136


>tr|Q7FAG9|Q7FAG9_ORYSJ Os04g0485100 protein OS=Oryza sativa subsp.
japonica GN=OJ000223_09.6 PE=2 SV=1
Length = 509

Score = 117 bits (292), Expect = 7e-25
Identities = 68/138 (49%), Positives = 87/138 (63%), Gaps = 11/138 (7%)
Frame = +2

Query: 227 MIKHILGRLPRSSKPPKSEVSNNEADGGANTSTASASLVMHNRLGAK---------DVRL 379
MIK ILGRLPR KP K+ S + A N + S S+ G K L
Sbjct: 1 MIKQILGRLPR--KPGKAGDSRDAAGPNGNEPSNSYSVARSVEQGNKRSGNGDYVVPAGL 58

Query: 380 TPFPVCSGADT--SFEPLPSFRDVPSSERPNLFIRKLDLCCVVFDFSDASKNVKEKEIKR 553
TP P+ +G S EPLP+F+DVP+SE+ NLF++K++LCC V+DF+D +KN+KEKE KR
Sbjct: 59 TPNPMMNGTVVYHSNEPLPAFKDVPASEKQNLFVKKVNLCCAVYDFADPTKNLKEKETKR 118

Query: 554 QTLVELVDYVGSCTSKFS 607
QTL+ELVDYV S KFS
Sbjct: 119 QTLMELVDYVTSANGKFS 136


>tr|A2XUT8|A2XUT8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_16375 PE=4 SV=1
Length = 509

Score = 117 bits (292), Expect = 7e-25
Identities = 68/138 (49%), Positives = 87/138 (63%), Gaps = 11/138 (7%)
Frame = +2

Query: 227 MIKHILGRLPRSSKPPKSEVSNNEADGGANTSTASASLVMHNRLGAK---------DVRL 379
MIK ILGRLPR KP K+ S + A N + S S+ G K L
Sbjct: 1 MIKQILGRLPR--KPGKAGDSRDAAGPNGNEPSNSYSVARSVEQGNKRSGNGDYVVPAGL 58

Query: 380 TPFPVCSGADT--SFEPLPSFRDVPSSERPNLFIRKLDLCCVVFDFSDASKNVKEKEIKR 553
TP P+ +G S EPLP+F+DVP+SE+ NLF++K++LCC V+DF+D +KN+KEKE KR
Sbjct: 59 TPNPMMNGTVVYHSNEPLPAFKDVPASEKQNLFVKKVNLCCAVYDFADPTKNLKEKETKR 118

Query: 554 QTLVELVDYVGSCTSKFS 607
QTL+ELVDYV S KFS
Sbjct: 119 QTLMELVDYVTSANGKFS 136


>tr|A7PLV2|A7PLV2_VITVI Chromosome chr14 scaffold_21, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00020577001
PE=4 SV=1
Length = 525

Score = 116 bits (290), Expect = 1e-24
Identities = 75/159 (47%), Positives = 95/159 (59%), Gaps = 32/159 (20%)
Frame = +2

Query: 227 MIKHILGRLPRSSKPPKSEVSNNEADGGANTSTASASL------VMHNRLG--------- 361
MIK+IL RLPR KP KS + N GGA+ S+++AS +++NR G
Sbjct: 1 MIKNILNRLPR--KPSKS--AENRDGGGASISSSNASTSSRSNDLVNNRFGNFNATSLSG 56

Query: 362 -----------------AKDVRLTPFPVCSGADTSFEPLPSFRDVPSSERPNLFIRKLDL 490
A +++L + A S+E LPSFRDVP+SE+ LFIRKL L
Sbjct: 57 ANPTSNSGPNYGNKIPQAVNMKLNG----NSAAASYEALPSFRDVPNSEKQTLFIRKLSL 112

Query: 491 CCVVFDFSDASKNVKEKEIKRQTLVELVDYVGSCTSKFS 607
CCVVFDF+D +KN+KEKEIKRQTLVELVDYV S KF+
Sbjct: 113 CCVVFDFTDPTKNLKEKEIKRQTLVELVDYVTSANGKFT 151


>tr|A5AQF8|A5AQF8_VITVI Putative uncharacterized protein (Chromosome
chr12 scaffold_36, whole genome shotgun sequence)
OS=Vitis vinifera GN=GSVIVT00025928001 PE=4 SV=1
Length = 548

Score = 112 bits (280), Expect = 2e-23
Identities = 73/169 (43%), Positives = 95/169 (56%), Gaps = 42/169 (24%)
Frame = +2

Query: 227 MIKHILGRLPRSSKPPKSEVSNNEAD---------------------------GGANTST 325
MIK +LG+LPR P S+ S+N+++ G A +S
Sbjct: 1 MIKQLLGKLPRK---PSSKSSHNDSNHDGAVAPVNSSQGPNSNSMGPGHKANSGSAKSSN 57

Query: 326 ASASLVMHNR--------------LGAKDVRL-TPFPVCSGADTSFEPLPSFRDVPSSER 460
+SAS N G K + T PV + A ++E LPSFRDVP+ E+
Sbjct: 58 SSASASRSNNGTLAPHSSNSGKTNHGKKSAAVATVGPVLASA--AYEALPSFRDVPNPEK 115

Query: 461 PNLFIRKLDLCCVVFDFSDASKNVKEKEIKRQTLVELVDYVGSCTSKFS 607
PNLFIRKL+LCCVVFDF+D SKN KEK+IKRQTL+ELVDY+ S +SKF+
Sbjct: 116 PNLFIRKLNLCCVVFDFNDPSKNPKEKDIKRQTLLELVDYISSVSSKFN 164


>tr|A9PGQ5|A9PGQ5_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 541

Score = 111 bits (278), Expect = 3e-23
Identities = 68/159 (42%), Positives = 91/159 (57%), Gaps = 32/159 (20%)
Frame = +2

Query: 227 MIKHILGRLPRSSKPPKSEVSNNEADGGANT-----STASASLVMHNRLGAKDVR-LTPF 388
MIK ILG+LPR P S SNN DGG + S+ S + +++L + + L P
Sbjct: 1 MIKQILGKLPRKPSKPSSNDSNN--DGGLHAYSSLNSSNGPSSINNSKLSSNSSKSLNPS 58

Query: 389 PVCSGADTS--------------------------FEPLPSFRDVPSSERPNLFIRKLDL 490
S + +E LPSFRDVP+SE+ NLF++KL++
Sbjct: 59 SGASRLNNGSLVPNSKGNQGKKSAPQLDPLMTSGVYEALPSFRDVPNSEKHNLFMKKLNM 118

Query: 491 CCVVFDFSDASKNVKEKEIKRQTLVELVDYVGSCTSKFS 607
CCVVFDFSD SKN+KEK+IKRQTL EL+DY+ + TSKF+
Sbjct: 119 CCVVFDFSDPSKNLKEKDIKRQTLHELLDYISTVTSKFN 157


>tr|Q0V836|Q0V836_ARATH At1g13460 OS=Arabidopsis thaliana PE=2 SV=1
Length = 492

Score = 108 bits (271), Expect = 2e-22
Identities = 66/136 (48%), Positives = 83/136 (61%), Gaps = 9/136 (6%)
Frame = +2

Query: 227 MIKHILGRLPR--------SSKPPKSEVSNNEADGGANTSTASASLVMHNR-LGAKDVRL 379
M K IL +LP+ SS S+ S+N A N+ T +A V + G K+ L
Sbjct: 1 MWKQILSKLPKKSSSKNHSSSSSSTSKSSDNGASKSGNSQTQNAPPVKPSADSGFKEGNL 60

Query: 380 TPFPVCSGADTSFEPLPSFRDVPSSERPNLFIRKLDLCCVVFDFSDASKNVKEKEIKRQT 559
T +E LP F+DVP++E+ NLF+RKL LCCVVFDFSD +KNVKEK+IKRQT
Sbjct: 61 KGN---GNGFTPYEALPGFKDVPNAEKQNLFVRKLSLCCVVFDFSDPTKNVKEKDIKRQT 117

Query: 560 LVELVDYVGSCTSKFS 607
L+ELVDYV S KFS
Sbjct: 118 LLELVDYVASPNGKFS 133


>tr|B8BAE1|B8BAE1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_27645 PE=4 SV=1
Length = 516

Score = 108 bits (270), Expect = 2e-22
Identities = 66/146 (45%), Positives = 85/146 (58%), Gaps = 20/146 (13%)
Frame = +2

Query: 227 MIKHILGRLPRSSKPPKSEVSNNEADGGANTSTASAS-LVMHNRLG-------------- 361
MIK ILGRLP+ KP KS + G + T + + L M +R+
Sbjct: 1 MIKQILGRLPKKEKPGKSGEKDLAGVGSSLPDTRTTTDLTMSSRIANPNNYTAAVTNPGQ 60

Query: 362 ---AKDVRLTPFPVCSG--ADTSFEPLPSFRDVPSSERPNLFIRKLDLCCVVFDFSDASK 526
K+ V +G A FE LPS RD P+ E+P+LF+RK+ +CCVVFDF+D +K
Sbjct: 61 NYTVKNAHHGGAGVSNGFLAPPVFEALPSLRDAPAPEKPSLFLRKVVMCCVVFDFTDPTK 120

Query: 527 NVKEKEIKRQTLVELVDYVGSCTSKF 604
+VKEKEIKRQTL+ELVDYV S T KF
Sbjct: 121 DVKEKEIKRQTLLELVDYVTSATGKF 146


>tr|A7QBU1|A7QBU1_VITVI Chromosome chr1 scaffold_75, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00035107001
PE=4 SV=1
Length = 515

Score = 105 bits (262), Expect = 2e-21
Identities = 67/151 (44%), Positives = 89/151 (58%), Gaps = 24/151 (15%)
Frame = +2

Query: 227 MIKHILGRLPR-----------------SSKPPKSEVSNNEADGGANTSTASASL----- 340
MIK I +LPR S+ +S S+ E++ AN + S +
Sbjct: 1 MIKQIFSKLPRKLSKAVENRELGGTTAFSNNSNRSRGSDVESNQFANLNVTSLAASNSTP 60

Query: 341 VMHNRLGAKDVRLTPFPVCSGADT--SFEPLPSFRDVPSSERPNLFIRKLDLCCVVFDFS 514
+ N LG+K + V T ++E LP+FRDVPSSE+ NLFI KL+LCCVVFDF+
Sbjct: 61 ITGNNLGSKIPQGGNSKVNGNYMTPNTYEALPAFRDVPSSEKQNLFIGKLNLCCVVFDFT 120

Query: 515 DASKNVKEKEIKRQTLVELVDYVGSCTSKFS 607
D +KN+KEKEIKRQTL+ELVDYV S + KF+
Sbjct: 121 DPTKNIKEKEIKRQTLLELVDYVTSASGKFT 151