DK960405
Clone id TST39A01NGRL0007_F07
Library
Length 542
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0007_F07. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
TGCAAGTGAAGAAGGATGGATTGTGGTGGACTGTGAAGCCTATTCCAGGTGCTCTTATTG
TGAATATGGGTGATATGATGCAGCTAGTGAGCAATGGAAGGTTTACAAGCATGGAGCACC
GGGCTGTCGTAAGGAGCGATACTGAAAGGATATCTATTGTGGTCTTTTATGCACCCACAG
TAAGTGCATTTTTGGGTCCAATAGCTCCCAAGGGAACTCAGCAAAATACTGCAATTTACA
AGCCAATCAAATATGGAGACTATTTAGCAACCTACATGAACAAGGAATTACAGGGTAAAG
ACAGAATAAATTCACTTCTTATCTAGTGGATGATCGAGGCACGCACGTGATTTCCAATGT
ACAATAACAAGGTTGTTATTATCCAATTTTTTTCGGGAGGGAATGAGAGCCTGCTTGTTT
GTTGTAATAATAGCTGACTTGTATTGCTACAGTGCTGGAAATTCTAGCTATAGTTAAGGG
TNAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGAAAAAGAAAAAAAAAAAA
AA
■■Homology search results ■■ -
sp_hit_id A2A1A0
Definition sp|A2A1A0|NCS1_COPJA S-norcoclaurine synthase 1 OS=Coptis japonica
Align length 104
Score (bit) 92.4
E-value 9.0e-19
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960405|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_F07, 5'
(482 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A2A1A0|NCS1_COPJA S-norcoclaurine synthase 1 OS=Coptis japoni... 92 9e-19
sp|Q39224|SRG1_ARATH Protein SRG1 OS=Arabidopsis thaliana GN=SRG... 85 2e-16
sp|Q9XHG2|FLS_MALDO Flavonol synthase/flavanone 3-hydroxylase OS... 82 1e-15
sp|Q07512|FLS_PETHY Flavonol synthase/flavanone 3-hydroxylase OS... 78 2e-14
sp|Q9M547|FLS_EUSGR Flavonol synthase/flavanone 3-hydroxylase OS... 77 4e-14
sp|Q9FR99|ACCO_MUSAC 1-aminocyclopropane-1-carboxylate oxidase O... 77 5e-14
sp|P54847|ACCO3_CUCME 1-aminocyclopropane-1-carboxylate oxidase ... 76 9e-14
sp|Q05964|FL3H_DIACA Naringenin,2-oxoglutarate 3-dioxygenase OS=... 75 1e-13
sp|Q9MB94|ACCO_PRUMU 1-aminocyclopropane-1-carboxylate oxidase O... 74 3e-13
sp|O48882|ACCO2_MALDO 1-aminocyclopropane-1-carboxylate oxidase ... 74 3e-13
sp|P07920|ACCO2_SOLLC 1-aminocyclopropane-1-carboxylate oxidase ... 74 3e-13
sp|Q08506|ACCO1_PETHY 1-aminocyclopropane-1-carboxylate oxidase ... 74 3e-13
sp|A2Z1W9|ACCO1_ORYSI 1-aminocyclopropane-1-carboxylate oxidase ... 73 6e-13
sp|Q0J1C1|ACCO1_ORYSJ 1-aminocyclopropane-1-carboxylate oxidase ... 73 8e-13
sp|Q08508|ACCO4_PETHY 1-aminocyclopropane-1-carboxylate oxidase ... 72 1e-12
sp|Q41452|FLS_SOLTU Flavonol synthase/flavanone 3-hydroxylase OS... 72 2e-12
sp|Q00985|ACCO1_MALDO 1-aminocyclopropane-1-carboxylate oxidase ... 72 2e-12
sp|P31238|ACCO1_DORSP 1-aminocyclopropane-1-carboxylate oxidase ... 72 2e-12
sp|P31239|ACCO_PEA 1-aminocyclopropane-1-carboxylate oxidase OS=... 71 2e-12
sp|P31237|ACCO_ACTDE 1-aminocyclopropane-1-carboxylate oxidase O... 71 2e-12
sp|P05116|ACCO1_SOLLC 1-aminocyclopropane-1-carboxylate oxidase ... 71 2e-12
sp|P19464|ACCO_PERAE 1-aminocyclopropane-1-carboxylate oxidase O... 71 3e-12
sp|Q9ZWQ9|FLS_CITUN Flavonol synthase/flavanone 3-hydroxylase OS... 70 5e-12
sp|Q08507|ACCO3_PETHY 1-aminocyclopropane-1-carboxylate oxidase ... 70 5e-12
sp|Q8H1S4|ACCH3_ARATH 1-aminocyclopropane-1-carboxylate oxidase ... 70 5e-12
sp|Q84MB3|ACCH1_ARATH 1-aminocyclopropane-1-carboxylate oxidase ... 70 5e-12
sp|P24157|ACCO4_SOLLC 1-aminocyclopropane-1-carboxylate oxidase ... 70 7e-12
sp|Q06942|FL3H_MALDO Naringenin,2-oxoglutarate 3-dioxygenase OS=... 69 9e-12
sp|Q09052|ACCO1_BRAJU 1-aminocyclopropane-1-carboxylate oxidase ... 69 9e-12
sp|Q39103|G3OX1_ARATH Gibberellin 3-beta-dioxygenase 1 OS=Arabid... 69 1e-11

>sp|A2A1A0|NCS1_COPJA S-norcoclaurine synthase 1 OS=Coptis japonica
GN=NCS1 PE=1 SV=1
Length = 352

Score = 92.4 bits (228), Expect = 9e-19
Identities = 44/104 (42%), Positives = 67/104 (64%)
Frame = +3

Query: 6 VKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTVS 185
+KKD W +KPI GA +VN+GD+++++SNG + S+EHRAV+ +D ER+SI F+ P
Sbjct: 248 IKKDEKWVPIKPILGAFVVNIGDVIEIMSNGIYKSIEHRAVINTDKERLSIAAFHDPEYG 307

Query: 186 AFLGPIAPKGTQQNTAIYKPIKYGDYLATYMNKELQGKDRINSL 317
+GP+ P ++N YK I Y DYL N +L GK ++ +
Sbjct: 308 TKIGPL-PDLVKENGVKYKTIDYEDYLIRSSNIKLDGKSLLDQM 350


>sp|Q39224|SRG1_ARATH Protein SRG1 OS=Arabidopsis thaliana GN=SRG1
PE=2 SV=1
Length = 358

Score = 84.7 bits (208), Expect = 2e-16
Identities = 41/107 (38%), Positives = 66/107 (61%)
Frame = +3

Query: 3 QVKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTV 182
Q+KKDG W VKP+P A IVN+GD++++++NG + S+EHR VV S+ ER+SI F+ +
Sbjct: 252 QIKKDGKWVPVKPLPNAFIVNIGDVLEIITNGTYRSIEHRGVVNSEKERLSIATFHNVGM 311

Query: 183 SAFLGPIAPKGTQQNTAIYKPIKYGDYLATYMNKELQGKDRINSLLI 323
+GP +Q A +K + +Y ++ L GK +++L I
Sbjct: 312 YKEVGPAKSLVERQKVARFKRLTMKEYNDGLFSRTLDGKAYLDALRI 358


>sp|Q9XHG2|FLS_MALDO Flavonol synthase/flavanone 3-hydroxylase
OS=Malus domestica GN=FLS PE=2 SV=1
Length = 337

Score = 82.0 bits (201), Expect = 1e-15
Identities = 41/94 (43%), Positives = 55/94 (58%)
Frame = +3

Query: 3 QVKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTV 182
Q KDG W+ VK IP AL++++GD M+++SNG++TS+ HR V D RIS VF P
Sbjct: 241 QACKDGRWYDVKYIPNALVIHIGDQMEIMSNGKYTSVLHRTTVNKDKTRISWPVFLEPPA 300

Query: 183 SAFLGPIAPKGTQQNTAIYKPIKYGDYLATYMNK 284
+GP N YK KYGDY+ +NK
Sbjct: 301 DHVVGPHPQLVNAVNQPKYKTKKYGDYVYCKINK 334


>sp|Q07512|FLS_PETHY Flavonol synthase/flavanone 3-hydroxylase
OS=Petunia hybrida GN=FL PE=2 SV=1
Length = 348

Score = 77.8 bits (190), Expect = 2e-14
Identities = 40/94 (42%), Positives = 57/94 (60%)
Frame = +3

Query: 3 QVKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTV 182
QV KDG W+ VK IP ALIV++GD ++++SNG++ S+ HR V D R+S VF P
Sbjct: 252 QVFKDGHWYDVKYIPNALIVHIGDQVEILSNGKYKSVYHRTTVNKDKTRMSWPVFLEPPS 311

Query: 183 SAFLGPIAPKGTQQNTAIYKPIKYGDYLATYMNK 284
+GPI ++ N +K KY DY+ +NK
Sbjct: 312 EHEVGPIPKLLSEANPPKFKTKKYKDYVYCKLNK 345


>sp|Q9M547|FLS_EUSGR Flavonol synthase/flavanone 3-hydroxylase
OS=Eustoma grandiflorum GN=FLS PE=2 SV=1
Length = 334

Score = 77.0 bits (188), Expect = 4e-14
Identities = 39/94 (41%), Positives = 56/94 (59%)
Frame = +3

Query: 3 QVKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTV 182
QV KDG W+ K IP ALIV++GD ++++SNG++ S+ HR V + R+S VF P
Sbjct: 238 QVYKDGHWYDCKYIPNALIVHIGDQVEIMSNGKYKSVYHRTTVNKEKTRMSWPVFLEPPP 297

Query: 183 SAFLGPIAPKGTQQNTAIYKPIKYGDYLATYMNK 284
+GPI ++N A +K KY DY +NK
Sbjct: 298 DHEVGPIPKLVNEENPAKFKTKKYKDYAYCKLNK 331


>sp|Q9FR99|ACCO_MUSAC 1-aminocyclopropane-1-carboxylate oxidase
OS=Musa acuminata GN=MAO1B PE=3 SV=1
Length = 306

Score = 76.6 bits (187), Expect = 5e-14
Identities = 36/102 (35%), Positives = 60/102 (58%), Gaps = 2/102 (1%)
Frame = +3

Query: 3 QVKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTV 182
Q+ KDG W V+P+ A+++N GD ++++SNGR+ S HR + S R SI FY P++
Sbjct: 196 QMLKDGRWIDVQPLADAIVINTGDQIEVLSNGRYKSAWHRVLATSHGNRRSIASFYNPSL 255

Query: 183 SAFLGPIAPKGTQQNT--AIYKPIKYGDYLATYMNKELQGKD 302
A + P A T++ A+Y +GDY+ Y ++ + K+
Sbjct: 256 KATIAPAAGAATEEAAPPALYPKFLFGDYMDVYAKQKYEPKE 297


>sp|P54847|ACCO3_CUCME 1-aminocyclopropane-1-carboxylate oxidase 3
OS=Cucumis melo GN=ACO3 PE=2 SV=1
Length = 320

Score = 75.9 bits (185), Expect = 9e-14
Identities = 33/101 (32%), Positives = 59/101 (58%), Gaps = 2/101 (1%)
Frame = +3

Query: 6 VKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTVS 185
V KDG W V P+ ++++N+GD +++++NG++ S+ HR + + D R+SI FY P
Sbjct: 198 VLKDGKWVDVPPMHHSIVINLGDQLEVITNGKYKSVMHRVIAQEDGNRMSIASFYNPGND 257

Query: 186 AFL--GPIAPKGTQQNTAIYKPIKYGDYLATYMNKELQGKD 302
A + P +G Q+ T +Y + DY+ Y+ + Q K+
Sbjct: 258 AVIYPAPALVEGEQEKTKLYPKFVFDDYMKLYVGLKFQAKE 298


>sp|Q05964|FL3H_DIACA Naringenin,2-oxoglutarate 3-dioxygenase
OS=Dianthus caryophyllus GN=FHT PE=2 SV=1
Length = 365

Score = 75.5 bits (184), Expect = 1e-13
Identities = 39/99 (39%), Positives = 61/99 (61%), Gaps = 2/99 (2%)
Frame = +3

Query: 3 QVKKDG--LWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAP 176
Q +DG W TV+P+PGA +VN+GD +SNGRF + +H+AVV S+ R+SI F P
Sbjct: 236 QATRDGGKTWITVQPVPGAFVVNLGDHGHFLSNGRFKNADHQAVVNSECSRLSIATFQNP 295

Query: 177 TVSAFLGPIAPKGTQQNTAIYKPIKYGDYLATYMNKELQ 293
+ A + P+A + +N+ + +PI + D M K+L+
Sbjct: 296 SPDATVYPLAIR-EGENSIMEEPITFADLYRRKMAKDLE 333


>sp|Q9MB94|ACCO_PRUMU 1-aminocyclopropane-1-carboxylate oxidase
OS=Prunus mume GN=ACO1 PE=2 SV=1
Length = 319

Score = 74.3 bits (181), Expect = 3e-13
Identities = 32/103 (31%), Positives = 60/103 (58%), Gaps = 3/103 (2%)
Frame = +3

Query: 3 QVKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTV 182
Q+ KDG W V P+ ++++N+GD +++++NG++ S+EHR + ++D R+SI FY P
Sbjct: 196 QLLKDGQWIDVPPMRHSIVINLGDQLEVITNGKYRSVEHRVIAQTDGTRMSIASFYNPGS 255

Query: 183 SAFLGP---IAPKGTQQNTAIYKPIKYGDYLATYMNKELQGKD 302
A + P + K ++ +Y + DY+ Y + Q K+
Sbjct: 256 DAVIYPAPTLVEKEAEEKNQVYPKFVFEDYMKLYAGLKFQPKE 298


>sp|O48882|ACCO2_MALDO 1-aminocyclopropane-1-carboxylate oxidase 2
OS=Malus domestica GN=ACO2 PE=2 SV=1
Length = 330

Score = 74.3 bits (181), Expect = 3e-13
Identities = 34/103 (33%), Positives = 61/103 (59%), Gaps = 3/103 (2%)
Frame = +3

Query: 3 QVKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTV 182
Q+ KDG W V P+ ++++N+GD +++++NG++ S+ HR + +SD R+SI FY P
Sbjct: 196 QLLKDGEWMDVPPVHHSIVINLGDQIEVITNGKYKSIMHRVIAQSDGTRMSIASFYNPGD 255

Query: 183 SAFLGPIAPKGTQQNTAI---YKPIKYGDYLATYMNKELQGKD 302
AF+ P AP ++ + + Y + DY+ Y + Q K+
Sbjct: 256 DAFISP-APALLEEKSEVSPTYPKFLFDDYMKLYSGLKFQAKE 297


tr_hit_id A7PCF4
Definition tr|A7PCF4|A7PCF4_VITVI Chromosome chr2 scaffold_11, whole genome shotgun sequence OS=Vitis vinifera
Align length 105
Score (bit) 107.0
E-value 2.0e-22
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960405|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_F07, 5'
(482 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PCF4|A7PCF4_VITVI Chromosome chr2 scaffold_11, whole genome... 107 2e-22
tr|A9NRM2|A9NRM2_PICSI Putative uncharacterized protein OS=Picea... 104 2e-21
tr|A9P1C4|A9P1C4_PICSI Putative uncharacterized protein OS=Picea... 103 4e-21
tr|A7PCF3|A7PCF3_VITVI Chromosome chr2 scaffold_11, whole genome... 103 6e-21
tr|A7Q513|A7Q513_VITVI Chromosome undetermined scaffold_51, whol... 101 2e-20
tr|A9P2I3|A9P2I3_PICSI Putative uncharacterized protein OS=Picea... 100 4e-20
tr|A7PCF8|A7PCF8_VITVI Chromosome chr2 scaffold_11, whole genome... 100 5e-20
tr|A7PCF6|A7PCF6_VITVI Chromosome chr2 scaffold_11, whole genome... 100 5e-20
tr|A5ARU7|A5ARU7_VITVI Putative uncharacterized protein OS=Vitis... 100 6e-20
tr|A9NRI6|A9NRI6_PICSI Putative uncharacterized protein OS=Picea... 99 1e-19
tr|A7QV95|A7QV95_VITVI Chromosome undetermined scaffold_186, who... 97 4e-19
tr|A7PK52|A7PK52_VITVI Chromosome chr15 scaffold_19, whole genom... 97 4e-19
tr|A9NUW5|A9NUW5_PICSI Putative uncharacterized protein OS=Picea... 97 5e-19
tr|A9NUJ7|A9NUJ7_PICSI Putative uncharacterized protein OS=Picea... 97 5e-19
tr|A9NQK0|A9NQK0_PICSI Putative uncharacterized protein OS=Picea... 97 5e-19
tr|A7Q515|A7Q515_VITVI Chromosome undetermined scaffold_51, whol... 97 5e-19
tr|A5AUL5|A5AUL5_VITVI Putative uncharacterized protein OS=Vitis... 97 5e-19
tr|A5BJI3|A5BJI3_VITVI Putative uncharacterized protein OS=Vitis... 96 1e-18
tr|Q8S208|Q8S208_ORYSJ cDNA clone:J033046K19, full insert sequen... 95 2e-18
tr|A7PCF7|A7PCF7_VITVI Chromosome chr2 scaffold_11, whole genome... 95 2e-18
tr|A2WPQ4|A2WPQ4_ORYSI Putative uncharacterized protein OS=Oryza... 95 2e-18
tr|A7PCG3|A7PCG3_VITVI Chromosome chr2 scaffold_11, whole genome... 95 2e-18
tr|Q8SB89|Q8SB89_ORYSA Putative ethylene-forming enzyme OS=Oryza... 94 3e-18
tr|Q8LCL0|Q8LCL0_ARATH Putative anthocyanidin synthase OS=Arabid... 94 3e-18
tr|Q7XC81|Q7XC81_ORYSJ cDNA clone:J013156L02, full insert sequen... 94 3e-18
tr|Q0IVR1|Q0IVR1_ORYSJ Os10g0558900 protein (Fragment) OS=Oryza ... 94 3e-18
tr|O80449|O80449_ARATH Putative anthocyanidin synthase OS=Arabid... 94 3e-18
tr|A7QV79|A7QV79_VITVI Chromosome undetermined scaffold_186, who... 94 3e-18
tr|A3C793|A3C793_ORYSJ Putative uncharacterized protein OS=Oryza... 94 3e-18
tr|A2ZA63|A2ZA63_ORYSI Putative uncharacterized protein OS=Oryza... 94 3e-18

>tr|A7PCF4|A7PCF4_VITVI Chromosome chr2 scaffold_11, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015840001
PE=4 SV=1
Length = 131

Score = 107 bits (268), Expect = 2e-22
Identities = 45/105 (42%), Positives = 74/105 (70%)
Frame = +3

Query: 3 QVKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTV 182
Q+K++G W ++P+PGA IVN+GD+++++SNG + S+EHRAV+ +TER+SI F +P+V
Sbjct: 23 QIKRNGKWIPIRPVPGAFIVNIGDILEIMSNGEYKSIEHRAVMNPETERLSIATFCSPSV 82

Query: 183 SAFLGPIAPKGTQQNTAIYKPIKYGDYLATYMNKELQGKDRINSL 317
+GP+ + N AIYK + + +YL +++EL GK IN +
Sbjct: 83 ETIIGPLPELTKENNGAIYKSVDWDEYLKFALSRELDGKSAINHM 127


>tr|A9NRM2|A9NRM2_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 364

Score = 104 bits (260), Expect = 2e-21
Identities = 49/107 (45%), Positives = 73/107 (68%)
Frame = +3

Query: 3 QVKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTV 182
QV+KD W TV P+PGALI+N+GDM+Q++SNG++ S EHRAVV ++ R+SIV+F +P
Sbjct: 257 QVRKDEDWLTVPPVPGALIINIGDMLQIISNGKYKSAEHRAVVNTNQNRMSIVMFLSPQD 316

Query: 183 SAFLGPIAPKGTQQNTAIYKPIKYGDYLATYMNKELQGKDRINSLLI 323
+ + + ++YK +K G Y YM+K+L+GK +N LLI
Sbjct: 317 DVLIDAAPELIDEGHPSLYKAVKAGVYGTVYMSKDLRGKGAVNDLLI 363


>tr|A9P1C4|A9P1C4_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 363

Score = 103 bits (257), Expect = 4e-21
Identities = 47/99 (47%), Positives = 67/99 (67%)
Frame = +3

Query: 3 QVKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTV 182
QV ++G W V+PIP A +VNMGD +Q+VSNGRF S+EHRAV + T RISI FY P+
Sbjct: 249 QVLRNGKWVAVEPIPNAFVVNMGDQLQVVSNGRFRSVEHRAVTNTSTARISIPTFYGPSE 308

Query: 183 SAFLGPIAPKGTQQNTAIYKPIKYGDYLATYMNKELQGK 299
AF+ P +Q+ A+YK K+G+++ + +EL+ K
Sbjct: 309 EAFIAPAESLVDEQHPALYKGFKFGEFMKIFWGQELKNK 347


>tr|A7PCF3|A7PCF3_VITVI Chromosome chr2 scaffold_11, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015839001
PE=3 SV=1
Length = 353

Score = 103 bits (256), Expect = 6e-21
Identities = 45/105 (42%), Positives = 75/105 (71%)
Frame = +3

Query: 3 QVKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTV 182
Q+KK+G W ++P+PGA IVN+GD+++++SNG + S+EHRAVV +TER+SI F++P+V
Sbjct: 246 QIKKNGKWIPIRPVPGAFIVNIGDILEIMSNGEYKSIEHRAVVNPETERLSIAAFHSPSV 305

Query: 183 SAFLGPIAPKGTQQNTAIYKPIKYGDYLATYMNKELQGKDRINSL 317
+GP+ P+ ++N AIYK + +Y +++L GK I+ +
Sbjct: 306 ETIIGPL-PELVKENGAIYKSVSREEYYKFAFSRKLDGKSIISHM 349


>tr|A7Q513|A7Q513_VITVI Chromosome undetermined scaffold_51, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00029935001 PE=3 SV=1
Length = 357

Score = 101 bits (251), Expect = 2e-20
Identities = 48/107 (44%), Positives = 71/107 (66%)
Frame = +3

Query: 3 QVKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTV 182
Q+KKDG+W V +P AL+VN+GD++++VSNG +TS+EHRA V S ERISI +F++P
Sbjct: 249 QIKKDGVWIPVNVLPDALVVNVGDILEIVSNGMYTSIEHRATVNSTKERISIAMFFSPKF 308

Query: 183 SAFLGPIAPKGTQQNTAIYKPIKYGDYLATYMNKELQGKDRINSLLI 323
SA +GP A T QN ++K I Y + +++L GK + + I
Sbjct: 309 SAEIGPAAGLITPQNLPVFKRIGMEKYYEDFFSRKLDGKSYLEHMKI 355


>tr|A9P2I3|A9P2I3_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 371

Score = 100 bits (249), Expect = 4e-20
Identities = 46/107 (42%), Positives = 74/107 (69%)
Frame = +3

Query: 3 QVKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTV 182
QV+KD W+TV P+PG+LI+N+GD++Q+VSNG++ S EHRAV ++ R+SIV+F +P
Sbjct: 257 QVRKDEQWFTVVPVPGSLIINIGDLLQIVSNGKYKSAEHRAVANTNENRMSIVMFLSPQD 316

Query: 183 SAFLGPIAPKGTQQNTAIYKPIKYGDYLATYMNKELQGKDRINSLLI 323
+G + + ++YK IK +Y YM++++QGK + +LLI
Sbjct: 317 DVLIGAAPDLIDEAHPSLYKAIKAEEYGTVYMSQDVQGKGPLAALLI 363


>tr|A7PCF8|A7PCF8_VITVI Chromosome chr2 scaffold_11, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015846001
PE=3 SV=1
Length = 353

Score = 100 bits (248), Expect = 5e-20
Identities = 44/103 (42%), Positives = 73/103 (70%)
Frame = +3

Query: 3 QVKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTV 182
Q+K++G W ++P+PGA IVN+GD+++++SNG + S+EHRAVV + ER+SI F +P
Sbjct: 246 QIKRNGKWIPIRPVPGAFIVNIGDVIEIMSNGEYKSIEHRAVVDPEKERLSIATFCSPGA 305

Query: 183 SAFLGPIAPKGTQQNTAIYKPIKYGDYLATYMNKELQGKDRIN 311
A +GP+ P+ T++ AIYK + +Y+ ++++L GK IN
Sbjct: 306 GAIIGPL-PELTKEKGAIYKSVSREEYIKFVLSRKLDGKSTIN 347


>tr|A7PCF6|A7PCF6_VITVI Chromosome chr2 scaffold_11, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015842001
PE=3 SV=1
Length = 344

Score = 100 bits (248), Expect = 5e-20
Identities = 44/105 (41%), Positives = 72/105 (68%)
Frame = +3

Query: 3 QVKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTV 182
Q+K++G W ++P+PGA IVN+GD ++++SNG + S+EHRAVV + ER+SI F +P
Sbjct: 237 QIKRNGKWIPIRPVPGAFIVNIGDAIEIMSNGEYKSIEHRAVVDPEKERLSIATFCSPNA 296

Query: 183 SAFLGPIAPKGTQQNTAIYKPIKYGDYLATYMNKELQGKDRINSL 317
A +GP+ P+ T++ AIYK + +Y+ + ++L GK IN +
Sbjct: 297 GAIIGPL-PELTKEKGAIYKSVSREEYIKFVLGRKLDGKSTINHM 340


>tr|A5ARU7|A5ARU7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_016336 PE=3 SV=1
Length = 344

Score = 99.8 bits (247), Expect = 6e-20
Identities = 44/105 (41%), Positives = 72/105 (68%)
Frame = +3

Query: 3 QVKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTV 182
Q+K++G W ++P+PGA IVN+GD ++++SNG + S+EHRAVV + ER+SI F +P
Sbjct: 237 QIKRNGKWIPIRPVPGAFIVNIGDAIEIMSNGXYKSIEHRAVVDPEKERLSIATFCSPNA 296

Query: 183 SAFLGPIAPKGTQQNTAIYKPIKYGDYLATYMNKELQGKDRINSL 317
A +GP+ P+ T++ AIYK + +Y+ + ++L GK IN +
Sbjct: 297 GAIIGPL-PELTKEKGAIYKSVSREEYIKFVLGRKLDGKSTINHM 340


>tr|A9NRI6|A9NRI6_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 268

Score = 99.0 bits (245), Expect = 1e-19
Identities = 46/107 (42%), Positives = 68/107 (63%)
Frame = +3

Query: 3 QVKKDGLWWTVKPIPGALIVNMGDMMQLVSNGRFTSMEHRAVVRSDTERISIVVFYAPTV 182
QV K+G W V PI A ++N+GD +Q+VSNGRF S+EHRAV + T RISI FY P+
Sbjct: 154 QVLKNGKWLAVNPIANAFVINLGDQLQVVSNGRFRSVEHRAVTNASTARISISTFYGPSK 213

Query: 183 SAFLGPIAPKGTQQNTAIYKPIKYGDYLATYMNKELQGKDRINSLLI 323
AF+ P A Q+ A+Y+ ++GD++ + +EL+ K ++ I
Sbjct: 214 DAFIAPAASIVDGQHPALYRGYQFGDFMRVFWGQELKRKRALDQFKI 260