DK960464
Clone id TST39A01NGRL0007_H22
Library
Length 687
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0007_H22. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
CAGGCCTCTCGTGTGTGCTCGCGGCTTGCTCCACCGAGCTGATGGCTCTGCTCGCTGGTC
CCAAGAAAATACCATTATCCTTGCGGCTGTTTATGGCCCCAAAGCTATCTCTGGGCGGAA
AGAAAATCCTGAGTGTGCTATTGTAGAGGTTATATGGAAGCCAAAGACAGGCATTGCAGG
CTCTAATGAGAGAGAAGCTGAGTTTATTGTAAAGAGGACTTTGGAGCACATAATCCTGAC
TGCAATGCACCCAAACACTGCCATATCTGTTATAATTCAGGTGGTAAATGATGATGGAGG
TGCTTTGGCTTGTGCTATGAATGCTGCTTGTGCTGCTCTTGTTGATGCAGGAGTTCCTTT
GAGCGGTTTGATTGCAGCAGTGACTTGCGCAGTTGATAAGGAGGGCATGGTCTTTTTAGA
TCCTATGAAGAAGGAAGAAAGAGATTTTCGCGGTCATGCGTGTCTTGTATTTCCTGGCCG
GCCCCTAGCTGCCACAAGTGCTGCTTCCTTGGCGATTGACAATGAGCCTATAGAGCATGG
CATAGTCAGTTCGGTGACGAAAGGTGCTTTGTCTGCTGATGACTATCTTAATTGCTTAGA
GCGAGGCAGAGCTGCCAGTGCAAAAATAGCAGAATTCGCAAGGTCAAGCCTTTGAAAGAG
CTCAGAAGAGGAGTCGAAATGGTCGTT
■■Homology search results ■■ -
sp_hit_id Q9CRA8
Definition sp|Q9CRA8|EXOS5_MOUSE Exosome complex exonuclease RRP46 OS=Mus musculus
Align length 214
Score (bit) 124.0
E-value 5.0e-28
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960464|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_H22, 5'
(687 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9CRA8|EXOS5_MOUSE Exosome complex exonuclease RRP46 OS=Mus m... 124 5e-28
sp|Q9NQT4|EXOS5_HUMAN Exosome complex exonuclease RRP46 OS=Homo ... 122 2e-27
sp|Q8TYC1|ECX1_METKA Probable exosome complex exonuclease 1 OS=M... 63 1e-09
sp|O29757|ECX1_ARCFU Probable exosome complex exonuclease 1 OS=A... 60 1e-08
sp|Q975G8|ECX1_SULTO Probable exosome complex exonuclease 1 OS=S... 60 1e-08
sp|Q5JIR6|ECX1_PYRKO Probable exosome complex exonuclease 1 OS=P... 59 2e-08
sp|Q9UXC2|ECX1_SULSO Probable exosome complex exonuclease 1 OS=S... 57 9e-08
sp|Q4JB27|ECX1_SULAC Probable exosome complex exonuclease 1 OS=S... 57 9e-08
sp|Q9V119|ECX1_PYRAB Probable exosome complex exonuclease 1 OS=P... 57 9e-08
sp|O59223|ECX1_PYRHO Probable exosome complex exonuclease 1 OS=P... 57 1e-07
sp|O42894|RRP46_SCHPO Exosome complex component rrp46 OS=Schizos... 56 2e-07
sp|Q8U0L9|ECX1_PYRFU Probable exosome complex exonuclease 1 OS=P... 55 3e-07
sp|Q17533|EXOS4_CAEEL Putative exosome complex exonuclease RRP41... 54 6e-07
sp|Q921I9|EXOS4_MOUSE Exosome complex exonuclease RRP41 OS=Mus m... 54 8e-07
sp|Q9NPD3|EXOS4_HUMAN Exosome complex exonuclease RRP41 OS=Homo ... 54 1e-06
sp|Q7YRA3|EXOS4_BOVIN Exosome complex exonuclease RRP41 OS=Bos t... 54 1e-06
sp|A8WQQ5|EXOS4_CAEBR Putative exosome complex exonuclease RRP41... 51 5e-06
sp|Q9YC03|ECX1_AERPE Probable exosome complex exonuclease 1 OS=A... 51 7e-06
sp|Q8PTT8|ECX1_METMA Probable exosome complex exonuclease 1 OS=M... 50 9e-06
sp|O26779|ECX1_METTH Probable exosome complex exonuclease 1 OS=M... 49 3e-05
sp|P53256|RRP46_YEAST Exosome complex component RRP46 OS=Sacchar... 46 2e-04
sp|Q97BZ5|ECX1_THEVO Probable exosome complex exonuclease 1 OS=T... 44 8e-04
sp|Q9HIP2|ECX1_THEAC Probable exosome complex exonuclease 1 OS=T... 44 0.001
sp|Q8ZVM9|ECX1_PYRAE Probable exosome complex exonuclease 1 OS=P... 41 0.005
sp|Q6P0I8|EXOS6_DANRE Exosome complex exonuclease MTR3 OS=Danio ... 39 0.026
sp|P46948|RRP41_YEAST Exosome complex component SKI6 OS=Saccharo... 32 4.1
sp|Q6FW70|PFA3_CANGA Palmitoyltransferase PFA3 OS=Candida glabra... 32 4.2
sp|Q5RKV6|EXOS6_HUMAN Exosome complex exonuclease MTR3 OS=Homo s... 31 5.4
sp|Q8BTW3|EXOS6_MOUSE Exosome complex exonuclease MTR3 OS=Mus mu... 31 7.1

>sp|Q9CRA8|EXOS5_MOUSE Exosome complex exonuclease RRP46 OS=Mus
musculus GN=Exosc5 PE=1 SV=1
Length = 235

Score = 124 bits (311), Expect = 5e-28
Identities = 78/214 (36%), Positives = 110/214 (51%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGRKENPECAIVEVIWKPKTGIAG 181
R C + LL R DGSA + Q +T +LA VYGP + KE A +EVI +PK G+ G
Sbjct: 29 RHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLPG 88

Query: 182 SNEREAEFIVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXXXXXXXGVPL 361
E+ E +V+ T E ++L A+HP T+I+V++QVV+D GVP+
Sbjct: 89 VAEKSRERLVRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVPM 148

Query: 362 SGLIAAVTCAVDKEGMVFLDPMKKEERDFRGHACLVFPGRPLAATSAASLAIDNEPIEHG 541
L VTCA+D +G + LDP K+E++ R A L F A+D+ E
Sbjct: 149 RALFCGVTCALDSDGNLVLDPTTKQEKEAR--AILTF-------------ALDS--AEQK 191

Query: 542 IVSSVTKGALSADDYLNCLERGRAASAKIAEFAR 643
++ S TKG S + CL +AAS I F R
Sbjct: 192 LLMSTTKGLYSDAELQQCLAAAQAASQHIFRFYR 225


>sp|Q9NQT4|EXOS5_HUMAN Exosome complex exonuclease RRP46 OS=Homo
sapiens GN=EXOSC5 PE=1 SV=1
Length = 235

Score = 122 bits (305), Expect = 2e-27
Identities = 74/214 (34%), Positives = 109/214 (50%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGRKENPECAIVEVIWKPKTGIAG 181
R C + LL R DGSA + Q +T +LA VYGP + KE A +EVI +PK G+ G
Sbjct: 29 RHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLPG 88

Query: 182 SNEREAEFIVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXXXXXXXGVPL 361
E+ E +++ T E ++L +HP T+I+V++QVV+D GVP+
Sbjct: 89 VAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVPM 148

Query: 362 SGLIAAVTCAVDKEGMVFLDPMKKEERDFRGHACLVFPGRPLAATSAASLAIDNEPIEHG 541
L V CA+D +G + LDP K+E++ R A L F A+D+ +E
Sbjct: 149 RALFCGVACALDSDGTLVLDPTSKQEKEAR--AVLTF-------------ALDS--VERK 191

Query: 542 IVSSVTKGALSADDYLNCLERGRAASAKIAEFAR 643
++ S TKG S + CL +AAS + F R
Sbjct: 192 LLMSSTKGLYSDTELQQCLAAAQAASQHVFRFYR 225


>sp|Q8TYC1|ECX1_METKA Probable exosome complex exonuclease 1
OS=Methanopyrus kandleri GN=MK0381 PE=3 SV=1
Length = 239

Score = 63.2 bits (152), Expect = 1e-09
Identities = 50/156 (32%), Positives = 69/156 (44%), Gaps = 10/156 (6%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGR-KENPECAIVEVIWKPKTGIA 178
RPL G+L RADGSA I+AAVYGP+ + R K+ P+ A+V +
Sbjct: 25 RPLKIQAGVLKRADGSAYLELGANKIVAAVYGPRELHPRHKQKPDRAVVRFRYNMAPFSV 84

Query: 179 GSNER--------EAEFIVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXX 334
+R E + K LE I T +P TAI + ++V+
Sbjct: 85 DERKRPGPDRRSIEISKLSKEALEPAIFTEYYPRTAIDIFVEVLQADAGTRCAGISAASV 144

Query: 335 XXXXXGVPLSGLIAAVTCAVDK-EGMVFLDPMKKEE 439
G+ + L+AA CA K EG V LDPM E+
Sbjct: 145 ALADAGIEMRDLVAA--CAAGKVEGKVVLDPMYYED 178


>sp|O29757|ECX1_ARCFU Probable exosome complex exonuclease 1
OS=Archaeoglobus fulgidus GN=AF_0493 PE=1 SV=1
Length = 258

Score = 60.1 bits (144), Expect = 1e-08
Identities = 58/224 (25%), Positives = 95/224 (42%), Gaps = 10/224 (4%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGRK-ENPECAIVEVIWK------ 160
RP+ +L RADGS ++AAV+GP+ + R ++P AI+ +
Sbjct: 27 RPIKIEASVLKRADGSCYLEMGKNKVIAAVFGPREVHPRHLQDPSKAIIRYRYNMAPFSV 86

Query: 161 PKTGIAGSNEREAEF--IVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXX 334
+ G + R E + K E +I+ + P +AI + ++V+
Sbjct: 87 EERKRPGPDRRSIEISKVSKEAFEAVIMKELFPRSAIDIFVEVLQADAGSRTACLNAASV 146

Query: 335 XXXXXGVPLSGLIAAVTCAVDK-EGMVFLDPMKKEERDFRGHACLVFPGRPLAATSAASL 511
GVP+ G+I +V AV K +G + LDPMK+E D G A + F +
Sbjct: 147 ALVDAGVPMKGMITSV--AVGKADGQLVLDPMKEE--DNFGEADMPF-----------AF 191

Query: 512 AIDNEPIEHGIVSSVTKGALSADDYLNCLERGRAASAKIAEFAR 643
I N IE I G ++ D+ +E + + +I E R
Sbjct: 192 LIRNGKIE-SIALLQMDGRMTRDEVKQAIELAKKGALQIYEMQR 234


>sp|Q975G8|ECX1_SULTO Probable exosome complex exonuclease 1
OS=Sulfolobus tokodaii GN=ST0443 PE=3 SV=1
Length = 247

Score = 59.7 bits (143), Expect = 1e-08
Identities = 47/156 (30%), Positives = 72/156 (46%), Gaps = 10/156 (6%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGRK-ENPECAIVEVIW------- 157
RP+ G+L ADGSA + NT ++AAVYGPK + R P+ A++ V +
Sbjct: 30 RPIKIELGVLKNADGSAIFEMGNTKVIAAVYGPKEMHPRHLALPDRAVLRVRYHMTPFST 89

Query: 158 -KPKTGIAGSNEREAEFIVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXX 334
+ K E E +++ LE IL + P T I V ++V+
Sbjct: 90 DERKNPAPSRREIELSKVIREALESTILVELFPRTVIDVFMEVLQADAGTRLVSLMAASM 149

Query: 335 XXXXXGVPLSGLIAAVTCAVDK-EGMVFLDPMKKEE 439
G+P+ LIA V AV K +G++ LD + E+
Sbjct: 150 ALADAGIPMRDLIAGV--AVGKADGVLVLDLNEPED 183


>sp|Q5JIR6|ECX1_PYRKO Probable exosome complex exonuclease 1
OS=Pyrococcus kodakaraensis GN=TK1634 PE=3 SV=1
Length = 249

Score = 58.9 bits (141), Expect = 2e-08
Identities = 55/209 (26%), Positives = 90/209 (43%), Gaps = 10/209 (4%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGRK-ENPECAIVEVIWK------ 160
RP+ G+L ADGSA +LAAVYGP+ I + + P+ AI+ V +
Sbjct: 27 RPIKMEVGVLKNADGSAYVEWGKNKVLAAVYGPREIHPKHLQRPDRAILRVRYNMAPFSV 86

Query: 161 PKTGIAGSNEREAEF--IVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXX 334
+ G + R E +++ LE +L M P TAI V I+++
Sbjct: 87 EERKKPGPDRRSVEISKVIRGALEPALLLHMFPRTAIDVFIEILQADAGTRVAGITAASL 146

Query: 335 XXXXXGVPLSGLIAAVTCAVDK-EGMVFLDPMKKEERDFRGHACLVFPGRPLAATSAASL 511
G+P+ L+AA CA K +G + LD + KEE ++ A +
Sbjct: 147 ALADAGIPMKDLVAA--CAAGKIDGEIVLD-LNKEEDNY----------------GEADV 187

Query: 512 AIDNEPIEHGIVSSVTKGALSADDYLNCL 598
+ P+++ I G L+ D++L +
Sbjct: 188 PVAIMPLKNDITLLQMDGYLTKDEFLEAV 216


>sp|Q9UXC2|ECX1_SULSO Probable exosome complex exonuclease 1
OS=Sulfolobus solfataricus GN=SSO0735 PE=1 SV=1
Length = 248

Score = 57.0 bits (136), Expect = 9e-08
Identities = 44/149 (29%), Positives = 69/149 (46%), Gaps = 10/149 (6%)
Frame = +2

Query: 23 GLLHRADGSARWSQENTIILAAVYGPKAISGRKEN-PECAIVEVIW--------KPKTGI 175
G+L ADGSA + NT +AAVYGPK + R + P+ A++ V + + K
Sbjct: 36 GVLKNADGSAIFEMGNTKAIAAVYGPKEMHPRHLSLPDRAVLRVRYHMTPFSTDERKNPA 95

Query: 176 AGSNEREAEFIVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXXXXXXXGV 355
E E +++ LE +L + P TAI V +++ G+
Sbjct: 96 PSRREIELSKVIREALESAVLVELFPRTAIDVFTEILQADAGSRLVSLMAASLALADAGI 155

Query: 356 PLSGLIAAVTCAVDK-EGMVFLDPMKKEE 439
P+ LIA V AV K +G++ LD + E+
Sbjct: 156 PMRDLIAGV--AVGKADGVIILDLNETED 182


>sp|Q4JB27|ECX1_SULAC Probable exosome complex exonuclease 1
OS=Sulfolobus acidocaldarius GN=Saci_0610 PE=3 SV=1
Length = 243

Score = 57.0 bits (136), Expect = 9e-08
Identities = 49/163 (30%), Positives = 72/163 (44%), Gaps = 10/163 (6%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGRK-ENPECAIVEVIW------- 157
RP+ G+L ADGSA + NT ++AAVYGPK + R P+ A + V +
Sbjct: 26 RPIKIELGVLKNADGSAIFEMGNTKVIAAVYGPKEMHPRHLALPDKASLRVRYHMTPFST 85

Query: 158 -KPKTGIAGSNEREAEFIVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXX 334
+ K E E +++ LE IL + P T I + ++V+
Sbjct: 86 DERKNPAPSRREIELSKVIREALESTILLNLFPRTVIDIFMEVLQADAGTRLVALMAASM 145

Query: 335 XXXXXGVPLSGLIAAVTCAVDK-EGMVFLDPMKKEERDFRGHA 460
G+P+ LIA V AV K +G + LD E+ D G A
Sbjct: 146 ALADAGIPMRDLIAGV--AVGKADGSLVLD--LNEQEDMWGEA 184


>sp|Q9V119|ECX1_PYRAB Probable exosome complex exonuclease 1
OS=Pyrococcus abyssi GN=PYRAB06100 PE=1 SV=1
Length = 249

Score = 57.0 bits (136), Expect = 9e-08
Identities = 47/156 (30%), Positives = 72/156 (46%), Gaps = 10/156 (6%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGRK-ENPECAIVEVIWK------ 160
RP+ G+L A+GSA I+AAVYGP+ + + + P+ AI+ V +
Sbjct: 27 RPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSV 86

Query: 161 PKTGIAGSNEREAEF--IVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXX 334
+ G + R E ++K LE ++ M P TAI V I+V+
Sbjct: 87 EERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASL 146

Query: 335 XXXXXGVPLSGLIAAVTCAVDK-EGMVFLDPMKKEE 439
G+P+ L+AA CA K EG + LD K+E+
Sbjct: 147 ALADAGIPMRDLVAA--CAAGKIEGEIVLDLNKEED 180


>sp|O59223|ECX1_PYRHO Probable exosome complex exonuclease 1
OS=Pyrococcus horikoshii GN=PH1549 PE=3 SV=1
Length = 249

Score = 56.6 bits (135), Expect = 1e-07
Identities = 47/156 (30%), Positives = 72/156 (46%), Gaps = 10/156 (6%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAI-SGRKENPECAIVEVIWK------ 160
RP+ G+L A+GSA I+AAVYGP+ + S + P+ AI+ V +
Sbjct: 27 RPIKMKVGVLKNANGSAYIEWGRNKIIAAVYGPRELHSKHLQRPDRAILRVRYNMAPFSV 86

Query: 161 PKTGIAGSNEREAEF--IVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXX 334
+ G + R E ++K LE ++ M P T+I V I+V+
Sbjct: 87 EERKKPGPDRRSIEISKVIKGALEPALILEMFPRTSIDVFIEVLQADAGTRVAGITAASL 146

Query: 335 XXXXXGVPLSGLIAAVTCAVDK-EGMVFLDPMKKEE 439
G+P+ L+AA CA K EG + LD K+E+
Sbjct: 147 ALADAGIPMRDLVAA--CAAGKIEGEIVLDLNKEED 180


tr_hit_id A9T9V1
Definition tr|A9T9V1|A9T9V1_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 214
Score (bit) 230.0
E-value 7.0e-59
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960464|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_H22, 5'
(687 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9T9V1|A9T9V1_PHYPA Predicted protein OS=Physcomitrella paten... 230 7e-59
tr|A7P578|A7P578_VITVI Chromosome chr4 scaffold_6, whole genome ... 200 8e-50
tr|Q2HRD9|Q2HRD9_MEDTR Peptidase S8 and S53, subtilisin, kexin, ... 196 1e-48
tr|Q9LX74|Q9LX74_ARATH Putative uncharacterized protein F12M12_1... 192 2e-47
tr|B8A1N7|B8A1N7_MAIZE Putative uncharacterized protein OS=Zea m... 187 7e-46
tr|B6THH8|B6THH8_MAIZE Exosome complex exonuclease RRP46 OS=Zea ... 185 2e-45
tr|Q84T68|Q84T68_ORYSJ Os03g0854200 protein OS=Oryza sativa subs... 178 3e-43
tr|B8ANR0|B8ANR0_ORYSI Putative uncharacterized protein OS=Oryza... 177 4e-43
tr|A3APW1|A3APW1_ORYSJ Putative uncharacterized protein OS=Oryza... 143 9e-33
tr|A8IUG4|A8IUG4_CHLRE Exosome complex exonuclease OS=Chlamydomo... 130 6e-29
tr|B2RZ47|B2RZ47_RAT Exosc5 protein (Fragment) OS=Rattus norvegi... 123 1e-26
tr|Q3U2K4|Q3U2K4_MOUSE Putative uncharacterized protein OS=Mus m... 122 2e-26
tr|A7RZV7|A7RZV7_NEMVE Predicted protein OS=Nematostella vectens... 122 2e-26
tr|B6MSQ3|B6MSQ3_BRAFL Putative uncharacterized protein OS=Branc... 121 4e-26
tr|B6MSQ7|B6MSQ7_BRAFL Putative uncharacterized protein OS=Branc... 120 6e-26
tr|B5FX94|B5FX94_TAEGU Putative exosome component 5 OS=Taeniopyg... 118 4e-25
tr|B2RC50|B2RC50_HUMAN cDNA, FLJ95853, highly similar to Homo sa... 115 2e-24
tr|Q4KLC7|Q4KLC7_XENLA LOC733302 protein (Fragment) OS=Xenopus l... 114 4e-24
tr|B3DM71|B3DM71_XENTR LOC100170617 protein (Fragment) OS=Xenopu... 114 4e-24
tr|Q1LVM3|Q1LVM3_DANRE Novel protein similar to mouse and human ... 114 8e-24
tr|Q0P3Y3|Q0P3Y3_DANRE Exosome component 5 OS=Danio rerio GN=exo... 112 3e-23
tr|Q54Q83|Q54Q83_DICDI Putative uncharacterized protein OS=Dicty... 106 1e-21
tr|B6RB44|B6RB44_HALDI Exosome component 5 OS=Haliotis discus di... 103 1e-20
tr|B0XFZ4|B0XFZ4_CULQU Exosome complex exonuclease RRP46 OS=Cule... 101 4e-20
tr|Q174Q5|Q174Q5_AEDAE Putative uncharacterized protein OS=Aedes... 97 1e-18
tr|Q29AM1|Q29AM1_DROPS GA17911 OS=Drosophila pseudoobscura pseud... 79 2e-13
tr|B4LWE8|B4LWE8_DROVI GJ23674 OS=Drosophila virilis GN=GJ23674 ... 79 3e-13
tr|B4N8W7|B4N8W7_DROWI GK11547 OS=Drosophila willistoni GN=GK115... 79 4e-13
tr|A4RU95|A4RU95_OSTLU Predicted protein OS=Ostreococcus lucimar... 77 8e-13
tr|B4G694|B4G694_DROPE GL23700 OS=Drosophila persimilis GN=GL237... 77 8e-13

>tr|A9T9V1|A9T9V1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192949 PE=4 SV=1
Length = 256

Score = 230 bits (586), Expect = 7e-59
Identities = 110/214 (51%), Positives = 154/214 (71%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGRKENPECAIVEVIWKPKTGIAG 181
RPL +RGLL RA GSA WSQENT +LAAVYGPK + +KEN E AI+EV+W+ K+G++G
Sbjct: 29 RPLSLSRGLLTRAHGSATWSQENTTVLAAVYGPKPAAMKKENAERAIIEVVWRAKSGLSG 88

Query: 182 SNEREAEFIVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXXXXXXXGVPL 361
S E++AE +V+R+LE+IILTA+HPNTAISVI+QV+ND G+PL
Sbjct: 89 SYEKDAEVVVRRSLEYIILTALHPNTAISVILQVINDDGSLLACAMNAACAALVDAGIPL 148

Query: 362 SGLIAAVTCAVDKEGMVFLDPMKKEERDFRGHACLVFPGRPLAATSAASLAIDNEPIEHG 541
+GL++AV+C V +G VFLDP K EE+ + + VFP R L+A +D EP+E+G
Sbjct: 149 NGLLSAVSCGVTHDGQVFLDPTKPEEQKCKAYVSFVFPSRRLSAVPELPADVDGEPVEYG 208

Query: 542 IVSSVTKGALSADDYLNCLERGRAASAKIAEFAR 643
I++SVT+GA+ ++Y +C+E RAA+AK++EF+R
Sbjct: 209 ILTSVTRGAMEVEEYFSCVENCRAAAAKVSEFSR 242


>tr|A7P578|A7P578_VITVI Chromosome chr4 scaffold_6, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00032429001
PE=4 SV=1
Length = 243

Score = 200 bits (508), Expect = 8e-50
Identities = 102/214 (47%), Positives = 136/214 (63%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGRKENPECAIVEVIWKPKTGIAG 181
RPL C+R +L+RA GSA WSQ +T +LAAVYGPKA + + ENPE A +EV+WKPKTG G
Sbjct: 15 RPLACSRNILNRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKACIEVVWKPKTGQIG 74

Query: 182 SNEREAEFIVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXXXXXXXGVPL 361
E+E E I+KRTL+ I L ++PNT S+IIQVV+D +PL
Sbjct: 75 KPEKEYEVILKRTLKSICLLNINPNTTTSIIIQVVSDDGALLPCAINAACAALVDAAIPL 134

Query: 362 SGLIAAVTCAVDKEGMVFLDPMKKEERDFRGHACLVFPGRPLAATSAASLAIDNEPIEHG 541
L A+ C + + G V LDP K EE+ + A LVFP ++ S ++ E +EHG
Sbjct: 135 KHLAVAICCCLTESGYVILDPTKVEEQKMKAFAYLVFPNSAISIIPEGSSHMEGELMEHG 194

Query: 542 IVSSVTKGALSADDYLNCLERGRAASAKIAEFAR 643
I++SVT G +S DDYL+CLERG+AAS K++ F R
Sbjct: 195 IITSVTHGVMSVDDYLHCLERGQAASTKMSAFLR 228


>tr|Q2HRD9|Q2HRD9_MEDTR Peptidase S8 and S53, subtilisin, kexin,
sedolisin; 3 exoribonuclease OS=Medicago truncatula
GN=MtrDRAFT_AC159144g20v2 PE=4 SV=2
Length = 241

Score = 196 bits (498), Expect = 1e-48
Identities = 100/214 (46%), Positives = 132/214 (61%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGRKENPECAIVEVIWKPKTGIAG 181
RPL C+ +LHRA GSA W+Q T +LAAVYGPKA + + ENPE A +EVIWKP TG G
Sbjct: 15 RPLACSHSVLHRAHGSATWAQGETKVLAAVYGPKAGTKKNENPEKASIEVIWKPNTGHVG 74

Query: 182 SNEREAEFIVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXXXXXXXGVPL 361
+RE E I+K+TLE I + ++PNT SVI VV+D G+PL
Sbjct: 75 QADREYEMILKKTLESICIRTIYPNTTTSVI--VVHDDGALLPCAINAACAALVDAGIPL 132

Query: 362 SGLIAAVTCAVDKEGMVFLDPMKKEERDFRGHACLVFPGRPLAATSAASLAIDNEPIEHG 541
L A+ C+V + LDP KKEE + A LVFP ++ S + N+P+ HG
Sbjct: 133 RHLAVAICCSVTDNNSIILDPSKKEEEKSKAFAYLVFPNTTVSVVPEKSSQVGNDPMAHG 192

Query: 542 IVSSVTKGALSADDYLNCLERGRAASAKIAEFAR 643
I++SVT GA+S DDYL+CLERGRA + +++EF R
Sbjct: 193 IITSVTHGAMSVDDYLHCLERGRATTQRLSEFLR 226


>tr|Q9LX74|Q9LX74_ARATH Putative uncharacterized protein F12M12_180
(Putative uncharacterized protein At3g46210) (At3g46210)
OS=Arabidopsis thaliana GN=F12M12_180 PE=2 SV=1
Length = 239

Score = 192 bits (488), Expect = 2e-47
Identities = 97/214 (45%), Positives = 130/214 (60%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGRKENPECAIVEVIWKPKTGIAG 181
RPL C+R +LHR GSA WSQ +T +LAAVYGPKA + + EN E A EVIWKPK+G G
Sbjct: 15 RPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKKNENAEKACFEVIWKPKSGQIG 74

Query: 182 SNEREAEFIVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXXXXXXXGVPL 361
E+E E I+KRT++ I + ++PNT SVIIQVV+D G+P+
Sbjct: 75 KVEKEYEMILKRTIQSICVLTVNPNTTTSVIIQVVHDDGSLLPCAINAACAALVDAGIPM 134

Query: 362 SGLIAAVTCAVDKEGMVFLDPMKKEERDFRGHACLVFPGRPLAATSAASLAIDNEPIEHG 541
L A+ C + + G + LDP K EE+ A LVFP L+ S + EP+EHG
Sbjct: 135 KHLAVAICCCLAENGYLVLDPNKLEEKKMTAFAYLVFPNTTLSVLPEGSSVAEGEPVEHG 194

Query: 542 IVSSVTKGALSADDYLNCLERGRAASAKIAEFAR 643
I++S+T G +S DDY C+E GRAA+A ++ F R
Sbjct: 195 IITSITHGVMSVDDYFLCVENGRAATASLSAFFR 228


>tr|B8A1N7|B8A1N7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 240

Score = 187 bits (474), Expect = 7e-46
Identities = 96/214 (44%), Positives = 129/214 (60%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGRKENPECAIVEVIWKPKTGIAG 181
RP C LHRA GSARW+Q +T++LAAVYGPK+ + + ENPE A +EV+WKPKTG G
Sbjct: 17 RPFTCTGNPLHRAHGSARWAQGDTVVLAAVYGPKSGTRKGENPEKASIEVVWKPKTGQIG 76

Query: 182 SNEREAEFIVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXXXXXXXGVPL 361
ERE E +KRTL+ I L +HPNT SV++QVV D G+P+
Sbjct: 77 RQEREYEMTLKRTLQSICLLTVHPNTTTSVVLQVVGDDGSLMSCAINASCAALAFAGIPM 136

Query: 362 SGLIAAVTCAVDKEGMVFLDPMKKEERDFRGHACLVFPGRPLAATSAASLAIDNEPIEHG 541
L A++C V G+V LD + EE+ R A LVFP + S + D E E G
Sbjct: 137 KHLAVAISCGVMDNGVVILDTSRAEEQQARSFAHLVFPNSRKSVESKDTTQRDEES-ERG 195

Query: 542 IVSSVTKGALSADDYLNCLERGRAASAKIAEFAR 643
+++ +T GA+S DDY NC+ERG AS++I++F R
Sbjct: 196 LITCITHGAMSEDDYFNCIERGVMASSRISDFMR 229


>tr|B6THH8|B6THH8_MAIZE Exosome complex exonuclease RRP46 OS=Zea
mays PE=2 SV=1
Length = 240

Score = 185 bits (470), Expect = 2e-45
Identities = 96/214 (44%), Positives = 127/214 (59%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGRKENPECAIVEVIWKPKTGIAG 181
RP C LHRA GSARW+Q +T++LAAVYGPK + + ENPE A +EV+WKPKTG G
Sbjct: 17 RPFTCTGNPLHRAHGSARWAQGDTVVLAAVYGPKPGTRKGENPEKASIEVVWKPKTGQIG 76

Query: 182 SNEREAEFIVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXXXXXXXGVPL 361
ERE E +KRTL+ I L +HPNT SV++QVV D G+P+
Sbjct: 77 RQEREYEMTLKRTLQSICLLTVHPNTTTSVVLQVVGDDGSLMSCAINASCAALAFAGIPM 136

Query: 362 SGLIAAVTCAVDKEGMVFLDPMKKEERDFRGHACLVFPGRPLAATSAASLAIDNEPIEHG 541
L A++C V G+V LD + EE+ R A LVFP + S D E E G
Sbjct: 137 KHLAVAISCGVMDNGVVILDTSRAEEQQARSFAHLVFPNSRKSVESKDPTQRDEES-ERG 195

Query: 542 IVSSVTKGALSADDYLNCLERGRAASAKIAEFAR 643
+++ +T GA+S DDY NC+ERG AS++I++F R
Sbjct: 196 LITCITHGAMSEDDYFNCIERGVMASSRISDFMR 229


>tr|Q84T68|Q84T68_ORYSJ Os03g0854200 protein OS=Oryza sativa subsp.
japonica GN=Os03g0854200 PE=2 SV=2
Length = 238

Score = 178 bits (452), Expect = 3e-43
Identities = 95/214 (44%), Positives = 128/214 (59%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGRKENPECAIVEVIWKPKTGIAG 181
RP C R L RA GSARW+Q +TI+LAAVYGPK + + ENPE A +EV+WKP TG G
Sbjct: 15 RPFSCTRNPLDRAHGSARWAQGDTIVLAAVYGPKPGTRKGENPEKASIEVVWKPMTGQIG 74

Query: 182 SNEREAEFIVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXXXXXXXGVPL 361
E+E E +KRTL+ I L +HPNT SVI+QVV + G+PL
Sbjct: 75 KQEKEYEMTLKRTLQSICLLTVHPNTTTSVILQVVGNDGSLLPCAINACCAALVFAGIPL 134

Query: 362 SGLIAAVTCAVDKEGMVFLDPMKKEERDFRGHACLVFPGRPLAATSAASLAIDNEPIEHG 541
L A+ C V ++G V LD K EE+ + A LVFP +A+S E E G
Sbjct: 135 KHLAVAIGCGVLEDGEVILDTNKAEEQQLKSFAHLVFPNSRKSASSKEPNQ-KEEDSERG 193

Query: 542 IVSSVTKGALSADDYLNCLERGRAASAKIAEFAR 643
+++S+T G +S +DY +C+ERG AAS++I++F R
Sbjct: 194 LITSITHGVMSEEDYFSCIERGLAASSRISDFMR 227


>tr|B8ANR0|B8ANR0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_14380 PE=4 SV=1
Length = 238

Score = 177 bits (450), Expect = 4e-43
Identities = 95/214 (44%), Positives = 127/214 (59%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGRKENPECAIVEVIWKPKTGIAG 181
RP C R L RA GSARW+Q +TI+LAAVYGPK + + ENPE A +EV+WKP TG G
Sbjct: 15 RPFSCTRNPLDRAHGSARWAQGDTIVLAAVYGPKPGTRKGENPEKASIEVVWKPMTGQIG 74

Query: 182 SNEREAEFIVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXXXXXXXGVPL 361
E+E E +KRTL+ I L +HPNT SVI+QVV + G+PL
Sbjct: 75 KQEKEYEMTLKRTLQSICLLTVHPNTTTSVILQVVGNDGSLLPCAINACCAALVFAGIPL 134

Query: 362 SGLIAAVTCAVDKEGMVFLDPMKKEERDFRGHACLVFPGRPLAATSAASLAIDNEPIEHG 541
L A+ C V ++G V LD K EE+ + A LVFP +A+S E E G
Sbjct: 135 KHLAVAIGCGVLEDGEVILDTNKAEEQQLKSFAHLVFPNSRKSASSKEPNQ-KEEDSERG 193

Query: 542 IVSSVTKGALSADDYLNCLERGRAASAKIAEFAR 643
+++S+T G +S +DY +C+ERG AAS++I+ F R
Sbjct: 194 LITSITHGVMSEEDYFSCIERGLAASSRISHFMR 227


>tr|A3APW1|A3APW1_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_012833 PE=4 SV=1
Length = 290

Score = 143 bits (361), Expect = 9e-33
Identities = 84/201 (41%), Positives = 109/201 (54%), Gaps = 10/201 (4%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGRKENPECAIVEVIWKPKTGIAG 181
RP C R L RA GSARW+Q +TI+LAAVYGPK + + ENPE A +EV+WKP TG G
Sbjct: 15 RPFSCTRNPLDRAHGSARWAQGDTIVLAAVYGPKPGTRKGENPEKASIEVVWKPMTGQIG 74

Query: 182 SNEREAEFIVKRTLEHIILTAMHPNTAISVIIQVV----------NDXXXXXXXXXXXXX 331
E+E E +KRTL+ I L +HPNT SVI+QVV N
Sbjct: 75 KQEKEYEMTLKRTLQSICLLTVHPNTTTSVILQVVGNDGSVSFCRNVLLSIVSGCLLDYE 134

Query: 332 XXXXXXGVPLSGLIAAVTCAVDKEGMVFLDPMKKEERDFRGHACLVFPGRPLAATSAASL 511
G+PL L A+ C V ++G V LD K EE+ + A LVFP +A+S
Sbjct: 135 HSLVFAGIPLKHLAVAIGCGVLEDGEVILDTNKAEEQQLKSFAHLVFPNSRKSASSKEPN 194

Query: 512 AIDNEPIEHGIVSSVTKGALS 574
E E G+++S+T G +S
Sbjct: 195 Q-KEEDSERGLITSITHGVMS 214


>tr|A8IUG4|A8IUG4_CHLRE Exosome complex exonuclease OS=Chlamydomonas
reinhardtii GN=RRP46 PE=4 SV=1
Length = 242

Score = 130 bits (328), Expect = 6e-29
Identities = 77/227 (33%), Positives = 117/227 (51%), Gaps = 13/227 (5%)
Frame = +2

Query: 2 RPLVCARGLLHRADGSARWSQENTIILAAVYGPKAISGRKENPECAIVEVIWKPKTGIAG 181
R LVC R +L RADGSA+W+QE + +LAAVYGP+ +KE+ E A+VEV++KP+ G+ G
Sbjct: 3 RTLVCERAVLDRADGSAKWTQEGSSVLAAVYGPRQAKLQKEDAERAVVEVVFKPRAGLQG 62

Query: 182 SNEREAEFIVKRTLEHIILTAMHPNTAISVIIQVVNDXXXXXXXXXXXXXXXXXXXGVPL 361
+R E ++ LE +I M P T++ V++QV+ D GVPL
Sbjct: 63 HEDRSLELEIRGILEGVIPLGMFPRTSVMVVLQVLQDDGGALSCALNAAAAALVDAGVPL 122

Query: 362 SGLIAAVTCAVDKEGMVFLDPMKKEERDFRGHACLVFPGR-------PLAATSA--ASLA 514
+ + ++V+C + + + LDP EE+ C +P P AAT A AS
Sbjct: 123 NSMFSSVSCVLTSDRRLVLDPDALEEQAAAARFCFTYPHHFDLTTAVPAAATGATTASPG 182

Query: 515 IDNEP----IEHGIVSSVTKGALSADDYLNCLERGRAASAKIAEFAR 643
D+ + ++ S GA S D+ L+ R ++A FAR
Sbjct: 183 ADDASATAVVGESVLGSRCVGAFSGDELLDAAALCRRGCERVATFAR 229