DK960469
Clone id TST39A01NGRL0007_I04
Library
Length 633
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0007_I04. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
GAGAATGTAAATGAAGAGAGCGCGCTCTCCCTAGTAGACAGAGGAACGATGGCATCGGAG
GAGCATGGTAATCAATAATAGCCAAAATGCGTAGCGCAACATAGGGTTTTGCTCTACCAG
AAGCGTCCACTTTGTTGCAGATGACTTAGGGTTGATACATACATGCCCACCATCATGGTA
ATGGCTACAGAGAGCATAGCAGTTGCCCCTTTGGATGGAAGAAGGTACCCAAGCCCAGTT
GTGAAGCAGGATCTTGCCAAGCTTGGCAAAGATGCAGAGAGCCGGCGAGCCGCTCTTGGT
TCTCTCCGTGCTGTTGTCGAGGAGCACCTTCATGGACCTGCTTTGTCACGATTCATGCAC
CAGCTCGAGGATTCTGCAGAGGGGCGCCGCCATGCCGCAGCCATAATTTCTGATCTAGCC
CGTGCTCATGGTGATCGCCTTTCGCCTTACATCCCCCGCCTTCTCCAGATCTTGGCCCAC
ACCCTCCTTGCCAGTGCGTCGTGTCCTGCCCTTCAATCGGATTGTGCGAAGGCTGTTGCT
GCTATTGGAAAACACTCTGTAGCCTCTTCACCCTCCTCTGCTGAGCTTGTCCTTAAACGC
CTGTGCTTGCCTCTCATCGCGCTCCTCCCCCAC
■■Homology search results ■■ -
sp_hit_id A4WDW4
Definition sp|A4WDW4|NANE_ENT38 Putative N-acetylmannosamine-6-phosphate 2-epimerase OS=Enterobacter sp. (strain 638)
Align length 115
Score (bit) 35.0
E-value 0.32
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960469|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_I04, 5'
(633 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A4WDW4|NANE_ENT38 Putative N-acetylmannosamine-6-phosphate 2-... 35 0.32
sp|Q86Y56|HEAT2_HUMAN HEAT repeat-containing protein 2 OS=Homo s... 34 0.55
sp|Q9Y4G6|TLN2_HUMAN Talin-2 OS=Homo sapiens GN=TLN2 PE=1 SV=3 34 0.72
sp|P97607|JAG2_RAT Protein jagged-2 (Fragment) OS=Rattus norvegi... 33 1.2
sp|Q8JG33|WFDC1_CHICK WAP four-disulfide core domain protein 1 O... 32 2.1
sp|Q03376|BAR3_CHITE Balbiani ring protein 3 OS=Chironomus tenta... 32 2.7
sp|Q71LX4|TLN2_MOUSE Talin-2 OS=Mus musculus GN=Tln2 PE=1 SV=2 32 2.7
sp|A7RL75|TTC36_NEMVE Tetratricopeptide repeat protein 36 homolo... 31 4.7
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonu... 31 6.1
sp|Q5SLN5|MNMA_THET8 tRNA-specific 2-thiouridylase mnmA OS=Therm... 30 7.9
sp|Q72GX1|MNMA_THET2 tRNA-specific 2-thiouridylase mnmA OS=Therm... 30 7.9
sp|Q9FM91|FBD23_ARATH Putative FBD-associated F-box protein At5g... 30 8.0

>sp|A4WDW4|NANE_ENT38 Putative N-acetylmannosamine-6-phosphate
2-epimerase OS=Enterobacter sp. (strain 638) GN=nanE
PE=3 SV=1
Length = 235

Score = 35.0 bits (79), Expect = 0.32
Identities = 36/115 (31%), Positives = 53/115 (46%), Gaps = 2/115 (1%)
Frame = +1

Query: 223 RYPSPVVKQDLAKLGKDAESRRAALGSLRAVVEEHLHGPALSRFMHQL-EDSAEGRRHAA 399
RYPS ++ D+A L + E++ ALG V L+G H L E+ E R
Sbjct: 122 RYPSVLLMADIATLAEAKEAQ--ALGF--DCVGTTLYGYTAETQGHSLPENDCEFLRDVV 177

Query: 400 AIISDLARAHGDRLSPY-IPRLLQILAHTLLASASCPALQSDCAKAVAAIGKHSV 561
A +S A G+ +P R L + AHT++ + Q + VAAI HS+
Sbjct: 178 AAVSIPVVAEGNVDTPERAARCLALGAHTVVVGGAITRPQQITTRFVAAIEAHSI 232


>sp|Q86Y56|HEAT2_HUMAN HEAT repeat-containing protein 2 OS=Homo
sapiens GN=HEATR2 PE=1 SV=2
Length = 855

Score = 34.3 bits (77), Expect = 0.55
Identities = 33/91 (36%), Positives = 40/91 (43%), Gaps = 17/91 (18%)
Frame = +1

Query: 265 GKDAES---RRAALGSLRAVVEEHLHGPA--------------LSRFMHQLEDSAEGRRH 393
G +A+S RR AL +LR +EE GPA L R + L D AEG R
Sbjct: 37 GLEADSKPGRRRALEALRRALEEP--GPAADPTAFQGPWARLLLPRLLRCLSDPAEGCRA 94

Query: 394 AAAIISDLARAHGDRLSPYIPRLLQILAHTL 486
A + DL R +PRLL LA L
Sbjct: 95 LAVHLLDLGLRRAARPRDALPRLLPALAARL 125


>sp|Q9Y4G6|TLN2_HUMAN Talin-2 OS=Homo sapiens GN=TLN2 PE=1 SV=3
Length = 2542

Score = 33.9 bits (76), Expect = 0.72
Identities = 30/111 (27%), Positives = 44/111 (39%), Gaps = 7/111 (6%)
Frame = +1

Query: 118 QKRPLCCR*LRVDTYMPTIMVMATE--SIAVAPLDGRRYPSP-----VVKQDLAKLGKDA 276
QK C + +D+ + T+ + E +A ++ + P P QDL K
Sbjct: 1041 QKAHEACGPMEIDSALNTVQTLKNELQDAKMAAVESQLKPLPGETLEKCAQDLGSTSKAV 1100

Query: 277 ESRRAALGSLRAVVEEHLHGPALSRFMHQLEDSAEGRRHAAAIISDLARAH 429
S A L + A EH G A L+ A+ R AA +D A AH
Sbjct: 1101 GSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGVAASTTDPAAAH 1151


>sp|P97607|JAG2_RAT Protein jagged-2 (Fragment) OS=Rattus norvegicus
GN=Jag2 PE=2 SV=1
Length = 1202

Score = 33.1 bits (74), Expect = 1.2
Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 3/48 (6%)
Frame = +3

Query: 180 NGYREHSSCPFGWKKV---PKPSCEAGSCQAWQRCREPASRSWFSPCC 314
+G+R+ S GWK P+PS + C Q+CRE A P C
Sbjct: 851 DGHRDCSKVWCGWKPCLLSPQPSALSAQCPPGQQCREKAMGQCLQPPC 898


>sp|Q8JG33|WFDC1_CHICK WAP four-disulfide core domain protein 1
OS=Gallus gallus GN=WFDC1 PE=2 SV=1
Length = 222

Score = 32.3 bits (72), Expect = 2.1
Identities = 15/65 (23%), Positives = 26/65 (40%)
Frame = +3

Query: 168 HHHGNGYREHSSCPFGWKKVPKPSCEAGSCQAWQRCREPASRSWFSPCCCRGAPSWTCFV 347
H H Y+++ CP + +P +CE SC++ C CC + C
Sbjct: 56 HSHSAHYQKNDRCPPPPQTLPDRACEVPSCRSDSECERHKR-------CCYNGCIYACLE 108

Query: 348 TIHAP 362
++ P
Sbjct: 109 SVQPP 113


>sp|Q03376|BAR3_CHITE Balbiani ring protein 3 OS=Chironomus tentans
GN=BR3 PE=2 SV=1
Length = 1700

Score = 32.0 bits (71), Expect = 2.7
Identities = 30/122 (24%), Positives = 41/122 (33%), Gaps = 10/122 (8%)
Frame = +3

Query: 225 VPKPSCEAGSCQAWQR-------CREPASRSWFSPCCCRGAPSW---TCFVTIHAPARGF 374
V KP C G C+ + C PA ++ P C SW +C + ++
Sbjct: 1273 VCKPGCPEGGCKGVMKWNANTCSCECPADKA--KPASCGDKKSWNDDSC--SCQCKSKMP 1328

Query: 375 CRGAPPCRSHNFXXXXXXXXXXFALHXXXXXXXXXXXXCQCVVSCPSIGLCEGCCCYWKT 554
C G PP + N A CQC SCP+ G C G +
Sbjct: 1329 CGGCPPNQQWN---EKDCECKCSATGNCPAGQTWNSQTCQC--SCPATGKCTGAQVWCSK 1383

Query: 555 LC 560
C
Sbjct: 1384 AC 1385


>sp|Q71LX4|TLN2_MOUSE Talin-2 OS=Mus musculus GN=Tln2 PE=1 SV=2
Length = 2375

Score = 32.0 bits (71), Expect = 2.7
Identities = 29/111 (26%), Positives = 43/111 (38%), Gaps = 7/111 (6%)
Frame = +1

Query: 118 QKRPLCCR*LRVDTYMPTIMVMATE----SIAVAPLDGRRYPSPVVK---QDLAKLGKDA 276
QK C + +D+ + T+ + E +A A + P ++ QDL K
Sbjct: 1042 QKAHEACGPMEIDSALNTVQTLKNELQDAKMAAAESQLKPLPGETLEKCAQDLGSTSKGV 1101

Query: 277 ESRRAALGSLRAVVEEHLHGPALSRFMHQLEDSAEGRRHAAAIISDLARAH 429
S A L + A EH G A L+ A+ R AA +D AH
Sbjct: 1102 GSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGVAASTNDPEAAH 1152


>sp|A7RL75|TTC36_NEMVE Tetratricopeptide repeat protein 36 homolog
OS=Nematostella vectensis GN=ttc36 PE=3 SV=1
Length = 181

Score = 31.2 bits (69), Expect = 4.7
Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 10/109 (9%)
Frame = +1

Query: 190 ESIAVAPLDGRRYPSPVVKQDLAKLGKDAESRRAALGSLRAVVEEHLHGPALSR------ 351
++I VAPL Y + + L++L D +S L +A+ H HG A ++
Sbjct: 71 KAIDVAPLRASGYNN---RAQLSRLRGDNQSAMEDLN--KAIELSHEHGAAAAQAYTQRG 125

Query: 352 FMHQLEDSAEGR----RHAAAIISDLARAHGDRLSPYIPRLLQILAHTL 486
+H+LE + E +H A + + A+A +L+PY ++LA +
Sbjct: 126 LLHRLEGNDEAASEDFQHGATLGNAFAKAMTVQLNPYAAMCNKMLAEAI 174


>sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum
GN=HTS1 PE=1 SV=2
Length = 5218

Score = 30.8 bits (68), Expect = 6.1
Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 2/63 (3%)
Frame = +1

Query: 235 PVVKQDLAKLGKDAESRRAALGSLRAVVEEHLHGPALSRFMHQLE--DSAEGRRHAAAII 408
P++ QDL L D+ +++ +R + EH A+ F+ Q E ++ G+ HA +++
Sbjct: 5058 PLMDQDLVTLELDSVAKKITAELMRVMPHEHSGLSAIREFIPQAEGTTTSSGKFHAGSVL 5117

Query: 409 SDL 417
L
Sbjct: 5118 GRL 5120


>sp|Q5SLN5|MNMA_THET8 tRNA-specific 2-thiouridylase mnmA OS=Thermus
thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=mnmA
PE=3 SV=1
Length = 367

Score = 30.4 bits (67), Expect = 7.9
Identities = 11/23 (47%), Positives = 14/23 (60%)
Frame = +3

Query: 216 WKKVPKPSCEAGSCQAWQRCREP 284
W +P PS EAG +AW+ C P
Sbjct: 36 WPDLPPPSLEAGKPRAWESCCTP 58


tr_hit_id A9T440
Definition tr|A9T440|A9T440_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 143
Score (bit) 95.5
E-value 2.0e-18
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960469|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_I04, 5'
(633 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9T440|A9T440_PHYPA Predicted protein OS=Physcomitrella paten... 96 2e-18
tr|A9T920|A9T920_PHYPA Predicted protein OS=Physcomitrella paten... 88 4e-16
tr|A9RX32|A9RX32_PHYPA Predicted protein OS=Physcomitrella paten... 84 7e-15
tr|A9TIQ1|A9TIQ1_PHYPA Predicted protein OS=Physcomitrella paten... 82 2e-14
tr|A9SRS8|A9SRS8_PHYPA Predicted protein OS=Physcomitrella paten... 81 5e-14
tr|Q9SLJ5|Q9SLJ5_ARATH F20D21.21 protein OS=Arabidopsis thaliana... 70 8e-11
tr|Q5XVI1|Q5XVI1_ARATH Putative uncharacterized protein OS=Arabi... 70 8e-11
tr|Q1KS90|Q1KS90_ARATH Putative uncharacterized protein OS=Arabi... 70 8e-11
tr|Q9SQR5|Q9SQR5_ARATH T11I18.8 protein (At3g03970) (Putative un... 69 2e-10
tr|B6SKX0|B6SKX0_MAIZE Putative uncharacterized protein OS=Zea m... 68 5e-10
tr|A7PW59|A7PW59_VITVI Chromosome chr8 scaffold_34, whole genome... 65 3e-09
tr|A5AUH6|A5AUH6_VITVI Putative uncharacterized protein OS=Vitis... 65 4e-09
tr|Q2R240|Q2R240_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 63 2e-08
tr|A2ZFN7|A2ZFN7_ORYSI Putative uncharacterized protein OS=Oryza... 63 2e-08
tr|A9T2W1|A9T2W1_PHYPA Predicted protein OS=Physcomitrella paten... 60 1e-07
tr|A3CCM3|A3CCM3_ORYSJ Putative uncharacterized protein OS=Oryza... 46 0.002
tr|A9RTA5|A9RTA5_PHYPA Predicted protein OS=Physcomitrella paten... 42 0.041
tr|A7PD93|A7PD93_VITVI Chromosome chr17 scaffold_12, whole genom... 42 0.041
tr|A7FC53|A7FC53_YERP3 Bacterial shufflon protein, N-terminal co... 41 0.052
tr|A7FN53|A7FN53_YERP3 Bacterial shufflon protein OS=Yersinia ps... 39 0.26
tr|Q6EVV9|Q6EVV9_YERPS Secondary type IV prepilin OS=Yersinia ps... 39 0.26
tr|Q9LFX1|Q9LFX1_ARATH T7N9.27 OS=Arabidopsis thaliana PE=4 SV=1 39 0.26
tr|Q9FZL2|Q9FZL2_ARATH F17L21.1 OS=Arabidopsis thaliana PE=4 SV=1 39 0.26
tr|Q93ZH1|Q93ZH1_ARATH At1g27210/T7N9_27 (At1g27210) (Expressed ... 39 0.26
tr|A3JAC3|A3JAC3_9ALTE ATP synthase subunit alpha OS=Marinobacte... 37 0.76
tr|A1JQ36|A1JQ36_YERE8 Shufflon protein b' (Putative type iv pil... 37 0.99
tr|B8B6P1|B8B6P1_ORYSI Putative uncharacterized protein OS=Oryza... 37 1.00
tr|B8JH80|B8JH80_9DELT ATP-dependent nuclease subunit B-like pro... 37 1.3
tr|Q8H513|Q8H513_ORYSJ cDNA, clone: J065124A13, full insert sequ... 37 1.3
tr|Q0D607|Q0D607_ORYSJ Os07g0520400 protein OS=Oryza sativa subs... 37 1.3

>tr|A9T440|A9T440_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_87819 PE=4 SV=1
Length = 1020

Score = 95.5 bits (236), Expect = 2e-18
Identities = 57/143 (39%), Positives = 85/143 (59%), Gaps = 5/143 (3%)
Frame = +1

Query: 214 DGRRYPSPVVKQDLAKLGKDAESRRAALGSLRAVVEEHLHGPALSRFMHQLEDSAEG--- 384
D RY SP+VKQDLAKL D ++RR A+ SL+ VE+ L L RF+ Q+ +S E
Sbjct: 5 DSSRYLSPLVKQDLAKLDTDGDTRRLAVKSLKLFVEQ-LDASTLPRFISQIAESREPGAT 63

Query: 385 RRHAAAIISDLARAHGDRLSPYIPRLLQILAHTLLASASCPALQSDCAKAVAAIGKHSVA 564
R +A ++ ++AR HG + P+IPR++ + + AS S P LQ A+ AA+ +H +
Sbjct: 64 RSYAISLFEEVARVHGKLVVPHIPRIMGSIVRSSSASGSFPQLQVASARVTAALARHCID 123

Query: 565 SSPSSA--ELVLKRLCLPLIALL 627
SS S A E +++ +C LI L
Sbjct: 124 SSTSQADSEEIVREICSSLIDCL 146


>tr|A9T920|A9T920_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_89677 PE=4 SV=1
Length = 961

Score = 88.2 bits (217), Expect = 4e-16
Identities = 52/139 (37%), Positives = 85/139 (61%), Gaps = 5/139 (3%)
Frame = +1

Query: 226 YPSPVVKQDLAKLGKDAESRRAALGSLRAVVEEHLHGPALSRFMHQLEDSAE---GRRHA 396
Y SP+V+QDLA+L KD +SRR AL +L+ VE +L ++ RF+ Q+ +S + R +A
Sbjct: 10 YMSPLVRQDLARLDKDGDSRRVALFALKQYVE-NLDPGSVPRFLAQVSESKDTGGSRSYA 68

Query: 397 AAIISDLARAHGDRLSPYIPRLLQILAHTLLASASCPALQSDCAKAVAAIGKHSV--ASS 570
++ ++AR HG + P +++ L +L AS S P L CAK AA+ ++++ +S
Sbjct: 69 ISLYEEVARVHGKLIIPQFGKVMTTLTRSLSASGSSPQLHQACAKVAAALIRYTIDPDTS 128

Query: 571 PSSAELVLKRLCLPLIALL 627
+ AE +LK + PL+ LL
Sbjct: 129 EAEAEEILKEVSRPLVDLL 147


>tr|A9RX32|A9RX32_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_71676 PE=4 SV=1
Length = 1081

Score = 84.0 bits (206), Expect = 7e-15
Identities = 51/136 (37%), Positives = 77/136 (56%), Gaps = 5/136 (3%)
Frame = +1

Query: 223 RYPSPVVKQDLAKLGKDAESRRAALGSLRAVVEEHLHGPALSRFMHQLEDSAEG---RRH 393
R S VKQDLAKL D ++R AL SL+ VE+ L+ L RF+ Q+ +S E R +
Sbjct: 8 RQSSSTVKQDLAKLNTDGDTRSIALKSLKLFVEQ-LNASTLPRFISQIAESREPAGTRSY 66

Query: 394 AAAIISDLARAHGDRLSPYIPRLLQILAHTLLASASCPALQSDCAKAVAAIGKHSVASS- 570
++ ++AR HG + P+I +++ L AS S P LQ CA+ AAI ++S+ S
Sbjct: 67 TISLYEEVARVHGKLVIPHISKIMSALVKFSSASGSFPQLQLACARVTAAIARYSIDSDT 126

Query: 571 -PSSAELVLKRLCLPL 615
AE +++ +C PL
Sbjct: 127 FQEDAEKIIQEICGPL 142


>tr|A9TIQ1|A9TIQ1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_93274 PE=4 SV=1
Length = 972

Score = 82.4 bits (202), Expect = 2e-14
Identities = 52/139 (37%), Positives = 81/139 (58%), Gaps = 5/139 (3%)
Frame = +1

Query: 226 YPSPVVKQDLAKLGKDAESRRAALGSLRAVVEEHLHGPALSRFMHQLEDSAE---GRRHA 396
Y SP+VKQDLAK GKD ESRR +L VE+ L ++ +F+ Q+ +S + R +A
Sbjct: 10 YMSPLVKQDLAKTGKDGESRRVPSHALSQEVEK-LELGSIPQFLAQVSESIDTEGSRLNA 68

Query: 397 AAIISDLARAHGDRLSPYIPRLLQILAHTLLASASCPALQSDCAKAVAAIGKHSVASSPS 576
+ ++AR HG + P+I +L+ + +L +S + P L CAKA A ++SV + S
Sbjct: 69 LVLYEEVARVHGKLIIPHIGQLMATVTRSLSSSGNSPDLHQACAKAATAWVRYSVDADTS 128

Query: 577 SAEL--VLKRLCLPLIALL 627
A+ +LK + PL+ LL
Sbjct: 129 VADAGEILKEVSRPLVDLL 147


>tr|A9SRS8|A9SRS8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_230639 PE=4 SV=1
Length = 921

Score = 81.3 bits (199), Expect = 5e-14
Identities = 49/143 (34%), Positives = 80/143 (55%), Gaps = 5/143 (3%)
Frame = +1

Query: 214 DGRRYPSPVVKQDLAKLGKDAESRRAALGSLRAVVEEHLHGPALSRFMHQLEDSAEG--- 384
D R+ SP+VKQDL L +A++RR A+ SL+ +V++ L L RF+ Q+ +S E
Sbjct: 5 DRYRHLSPLVKQDLNLLDANADTRRLAVKSLKLMVKQ-LDAHTLPRFIFQISESHEPAAT 63

Query: 385 RRHAAAIISDLARAHGDRLSPYIPRLLQILAHTLLASASCPALQSDCAKAVAAIGKHSVA 564
R + + ++ R HG + +IPR++ + + A SC LQ CAK A++ +
Sbjct: 64 RSYVIYVFEEIGRVHGKLIVTHIPRIMGFIVRSSSAIGSCHVLQEACAKVTASLALCGID 123

Query: 565 SSPS--SAELVLKRLCLPLIALL 627
S+ S AE +++ +C PLI L
Sbjct: 124 SNTSQEDAEEIMREICTPLIDAL 146


>tr|Q9SLJ5|Q9SLJ5_ARATH F20D21.21 protein OS=Arabidopsis thaliana
GN=F20D21.21 PE=4 SV=1
Length = 873

Score = 70.5 bits (171), Expect = 8e-11
Identities = 39/134 (29%), Positives = 75/134 (55%), Gaps = 6/134 (4%)
Frame = +1

Query: 232 SPVVKQDLAKLGKDAESRRAALGSLRAVVEEHLHGPALSRFMHQLEDSAEGR----RHAA 399
+P+++Q+LA L KD ESR++A+ +L++ V++ L A+ F+ Q+ ++ E +
Sbjct: 6 NPILRQELANLDKDTESRKSAMKALKSYVKD-LDSKAIPGFLAQVFETKETNSLSGEYTI 64

Query: 400 AIISDLARAHGDRLSPYIPRLLQILAHTLLASASCPALQSDCAKAVAAIGKHSV--ASSP 573
++ LAR HG + P I ++ + TL +SA LQ C+K + AI ++ + ++
Sbjct: 65 SLYEILARVHGPNIVPQIDTIMSTIVKTLASSAGSFPLQQACSKVIPAIARYGIDPTTTE 124

Query: 574 SSAELVLKRLCLPL 615
+++ LC PL
Sbjct: 125 DKKRVIIHSLCKPL 138


>tr|Q5XVI1|Q5XVI1_ARATH Putative uncharacterized protein
OS=Arabidopsis thaliana PE=2 SV=1
Length = 560

Score = 70.5 bits (171), Expect = 8e-11
Identities = 39/134 (29%), Positives = 75/134 (55%), Gaps = 6/134 (4%)
Frame = +1

Query: 232 SPVVKQDLAKLGKDAESRRAALGSLRAVVEEHLHGPALSRFMHQLEDSAEGR----RHAA 399
+P+++Q+LA L KD ESR++A+ +L++ V++ L A+ F+ Q+ ++ E +
Sbjct: 6 NPILRQELANLDKDTESRKSAMKALKSYVKD-LDSKAIPGFLAQVFETKETNSLSGEYTI 64

Query: 400 AIISDLARAHGDRLSPYIPRLLQILAHTLLASASCPALQSDCAKAVAAIGKHSV--ASSP 573
++ LAR HG + P I ++ + TL +SA LQ C+K + AI ++ + ++
Sbjct: 65 SLYEILARVHGPNIVPQIDTIMSTIVKTLASSAGSFPLQQACSKVIPAIARYGIDPTTTE 124

Query: 574 SSAELVLKRLCLPL 615
+++ LC PL
Sbjct: 125 DKKRVIIHSLCKPL 138


>tr|Q1KS90|Q1KS90_ARATH Putative uncharacterized protein
OS=Arabidopsis thaliana GN=At1g54385 PE=2 SV=1
Length = 560

Score = 70.5 bits (171), Expect = 8e-11
Identities = 39/134 (29%), Positives = 75/134 (55%), Gaps = 6/134 (4%)
Frame = +1

Query: 232 SPVVKQDLAKLGKDAESRRAALGSLRAVVEEHLHGPALSRFMHQLEDSAEGR----RHAA 399
+P+++Q+LA L KD ESR++A+ +L++ V++ L A+ F+ Q+ ++ E +
Sbjct: 6 NPILRQELANLDKDTESRKSAMKALKSYVKD-LDSKAIPGFLAQVFETKETNSLSGEYTI 64

Query: 400 AIISDLARAHGDRLSPYIPRLLQILAHTLLASASCPALQSDCAKAVAAIGKHSV--ASSP 573
++ LAR HG + P I ++ + TL +SA LQ C+K + AI ++ + ++
Sbjct: 65 SLYEILARVHGPNIVPQIDTIMSTIVKTLASSAGSFPLQQACSKVIPAIARYGIDPTTTE 124

Query: 574 SSAELVLKRLCLPL 615
+++ LC PL
Sbjct: 125 DKKRVIIHSLCKPL 138


>tr|Q9SQR5|Q9SQR5_ARATH T11I18.8 protein (At3g03970) (Putative
uncharacterized protein At3g03970/T11I18_8)
OS=Arabidopsis thaliana GN=At3g03970/T11I18_8 PE=2 SV=1
Length = 554

Score = 69.3 bits (168), Expect = 2e-10
Identities = 41/130 (31%), Positives = 75/130 (57%), Gaps = 6/130 (4%)
Frame = +1

Query: 244 KQDLAKLGKDAESRRAALGSLRAVVEEHLHGPALSRFMHQLED----SAEGRRHAAAIIS 411
+Q+LA L KD +S + A+ +LR++V++ L + F+ QL D E + ++
Sbjct: 10 RQELANLDKDPDSHKTAMSNLRSIVKD-LDAKVVHVFVAQLSDVKEIGLESGGYTVSLFE 68

Query: 412 DLARAHGDRLSPYIPRLLQILAHTLLASASCPALQSDCAKAVAAIGKHSV-ASSPSSAEL 588
DLARAHG +++P+I ++ + TL +S +Q C++AVAA+ ++ + ++P +
Sbjct: 69 DLARAHGVKIAPHIDIIMPAIIRTLSSSEGSLRVQQACSRAVAAMARYGIDPTTPEDKKT 128

Query: 589 -VLKRLCLPL 615
V+ LC PL
Sbjct: 129 NVIHSLCKPL 138


>tr|B6SKX0|B6SKX0_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 637

Score = 67.8 bits (164), Expect = 5e-10
Identities = 43/145 (29%), Positives = 71/145 (48%), Gaps = 13/145 (8%)
Frame = +1

Query: 232 SPVVKQDLAKLGKDAESRRAALGSLRAVVEEHLHGPALSRFMHQLEDSAE---------- 381
SP+++Q+L L KDA+SRRAA+ +L++ HL ++ F+ ++ D+
Sbjct: 6 SPLLRQELDNLDKDADSRRAAMKALKSYAR-HLDSKSIPHFLAEVSDTTAAGAGAGSGMP 64

Query: 382 -GRRHAAAIISDLARAHGDRLSPYIPRLLQILAHTLLASASCPALQSDCAKAVAAIGKHS 558
G ++ LAR HG + P I ++ + TL +S L C+K V AI +H
Sbjct: 65 TGGEFTISLYEVLARVHGRNIVPQIGNIMATIMCTLSSSGGSFPLHQACSKVVPAIARHG 124

Query: 559 VASSPSSAEL--VLKRLCLPLIALL 627
+ S E ++ LC PL + L
Sbjct: 125 IDPSAPDGEKAGIIASLCRPLCSAL 149