DK960494
Clone id TST39A01NGRL0007_J05
Library
Length 640
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0007_J05. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
CAAATATGCACACACAAGCTTCCTTCTGCAGAAAACCCACCATTTCCCTTTTGACAATCT
GTACAATTAAGCTTCTCCTTCTGTGATTTTGCGCACACACACACACAGCTCTTTACTCTG
CATAGAACCCCATCATCTTCTCCCTCATCACTCTGCACTCTCCAGCTTGGCATGTATGAT
TTGCAGCTCCATACCCGCAGACTCCTCCAGGAGACTGCTGCCTCCTCCCCTTTTAGCCCC
AACGCAGAGGATGACAACCAAGATGTCAATGCCTTCGATGTCAATGCCCGCTTCAGCCCC
TCCATGGCCATCATCCTCGTCATCCTCCTCACCGCCTTCTTCTTCATGGCCTTCTTCTCC
ATCTACGTCAAGCGCTGCTCCTCTCGCCAGACCGACGCCACCCGCACCCCCGCTGCTCTG
CCGCATCCTTCTGATATTCCCTCACAGGGTGTCGACTCTGCCTTCCTCGAAACCCTCCCG
CTTGTCGCCTACTCATCCTCCAAGAAGAAGGGCTCCAACATCGAGTGCGTGGTCTGCCTC
ACAGACTTCGAAGAGAGTGAGCCCCTCTGTCAATTACCTCGATGCAAACATGTGTTCCAC
AAGGACTGCATAGACATGTGGCTCTTCTCTCACACCACCT
■■Homology search results ■■ -
sp_hit_id Q84W40
Definition sp|Q84W40|ATL1N_ARATH RING-H2 finger protein ATL1N OS=Arabidopsis thaliana
Align length 131
Score (bit) 103.0
E-value 1.0e-21
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960494|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_J05, 5'
(640 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q84W40|ATL1N_ARATH RING-H2 finger protein ATL1N OS=Arabidopsi... 103 1e-21
sp|Q8RXX9|ATL3B_ARATH RING-H2 finger protein ATL3B OS=Arabidopsi... 102 1e-21
sp|Q8LGA5|ATL5H_ARATH RING-H2 finger protein ATL5H OS=Arabidopsi... 100 5e-21
sp|Q8W571|ATL4O_ARATH RING-H2 finger protein ATL4O OS=Arabidopsi... 98 3e-20
sp|Q9SK92|ATL1C_ARATH RING-H2 finger protein ATL1C OS=Arabidopsi... 90 9e-18
sp|Q940Q4|ATL4K_ARATH RING-H2 finger protein ATL4K OS=Arabidopsi... 90 1e-17
sp|Q9SJJ7|ATL2E_ARATH RING-H2 finger protein ATL2E OS=Arabidopsi... 90 1e-17
sp|O64763|ATL2G_ARATH RING-H2 finger protein ATL2G OS=Arabidopsi... 82 2e-15
sp|Q9ZV53|ATL2C_ARATH Putative RING-H2 finger protein ATL2C OS=A... 82 3e-15
sp|Q8GW38|ATL1D_ARATH RING-H2 finger protein ATL1D OS=Arabidopsi... 80 9e-15
sp|Q5EAE9|ATL5C_ARATH RING-H2 finger protein ATL5C OS=Arabidopsi... 78 4e-14
sp|Q8L9T5|ATL3F_ARATH RING-H2 finger protein ATL3F OS=Arabidopsi... 78 4e-14
sp|Q5XF85|ATL4J_ARATH RING-H2 finger protein ATL4J OS=Arabidopsi... 77 1e-13
sp|O49691|ATL4I_ARATH Putative RING-H2 finger protein ATL4I OS=A... 76 2e-13
sp|Q9SRQ8|ATL3A_ARATH RING-H2 finger protein ATL3A OS=Arabidopsi... 74 6e-13
sp|Q8LC69|ATL1R_ARATH RING-H2 finger protein ATL1R OS=Arabidopsi... 74 6e-13
sp|Q9M0R7|ATL4A_ARATH RING-H2 finger protein ATL4A OS=Arabidopsi... 73 1e-12
sp|Q570X5|ATL1G_ARATH RING-H2 finger protein ATL1G OS=Arabidopsi... 73 1e-12
sp|Q9LF64|ATL5G_ARATH Probable RING-H2 finger protein ATL5G OS=A... 72 3e-12
sp|Q9FIR0|ATL5L_ARATH Putative RING-H2 finger protein ATL5L OS=A... 71 5e-12
sp|Q94BY6|ATL1I_ARATH RING-H2 finger protein ATL1I OS=Arabidopsi... 70 9e-12
sp|P93823|ATL1A_ARATH RING-H2 finger protein ATL1A OS=Arabidopsi... 70 1e-11
sp|O64762|ATL2F_ARATH RING-H2 finger protein ATL2F OS=Arabidopsi... 69 2e-11
sp|Q9SLC3|ATL2L_ARATH RING-H2 finger protein ATL2L OS=Arabidopsi... 69 3e-11
sp|Q9SL78|ATL2D_ARATH Putative RING-H2 finger protein ATL2D OS=A... 69 3e-11
sp|Q9SN27|ATL4F_ARATH RING-H2 finger protein ATL4F OS=Arabidopsi... 68 4e-11
sp|Q6NKR1|ATL2H_ARATH RING-H2 finger protein ATL2H OS=Arabidopsi... 68 4e-11
sp|Q9FL42|ATL5E_ARATH Putative RING-H2 finger protein ATL5E OS=A... 68 5e-11
sp|Q9LY41|ATL3J_ARATH RING-H2 finger protein ATL3J OS=Arabidopsi... 68 5e-11
sp|Q9FHG8|ATL5N_ARATH Putative RING-H2 finger protein ATL5N OS=A... 67 6e-11

>sp|Q84W40|ATL1N_ARATH RING-H2 finger protein ATL1N OS=Arabidopsis
thaliana GN=ATL1N PE=2 SV=2
Length = 404

Score = 103 bits (256), Expect = 1e-21
Identities = 52/131 (39%), Positives = 80/131 (61%), Gaps = 12/131 (9%)
Frame = +1

Query: 283 NARFSPSMAIILVILLTAFFFMAFFSIYVKRCSSRQTDATRTPAALPHPSDI-------- 438
++RF P+MAI++++L++ FFF+ FFS+Y++RC R +P+D
Sbjct: 56 SSRFDPTMAILMIVLVSVFFFLGFFSVYIRRCLERVMGMD-----YGNPNDAGNWLATNR 110

Query: 439 -PSQGVDSAFLETLPLVAYSSSK--KKGSN-IECVVCLTDFEESEPLCQLPRCKHVFHKD 606
++G+D++ +ET P YS+ K + G +EC VCL +FE+ E L +P+C HVFH
Sbjct: 111 QQARGLDASIIETFPTFQYSTVKTLRIGKEALECSVCLNEFEDDETLRLIPKCCHVFHPG 170

Query: 607 CIDMWLFSHTT 639
CID WL SHTT
Sbjct: 171 CIDAWLRSHTT 181


>sp|Q8RXX9|ATL3B_ARATH RING-H2 finger protein ATL3B OS=Arabidopsis
thaliana GN=ATL3B PE=1 SV=2
Length = 398

Score = 102 bits (255), Expect = 1e-21
Identities = 54/123 (43%), Positives = 73/123 (59%), Gaps = 6/123 (4%)
Frame = +1

Query: 289 RFSPSMAIILVILLTAFFFMAFFSIYVKRCSSRQTDATRTPAALPHPS---DIPSQGVDS 459
R SP+MA+I+VIL+ A FFM FFSIY + CS DA +PA + ++G+D
Sbjct: 44 RLSPAMAVIVVILIAALFFMGFFSIYFRHCSG-VPDAGVSPAGGARSRATVNAAARGLDV 102

Query: 460 AFLETLPLVAYSSSKKKG---SNIECVVCLTDFEESEPLCQLPRCKHVFHKDCIDMWLFS 630
+ +ET P YS K + +EC +CL +FE+ E L LP+C HVFH CID WL +
Sbjct: 103 SVVETFPTFLYSDVKTQKLGKGELECAICLNEFEDDETLRLLPKCDHVFHPHCIDAWLEA 162

Query: 631 HTT 639
H T
Sbjct: 163 HVT 165


>sp|Q8LGA5|ATL5H_ARATH RING-H2 finger protein ATL5H OS=Arabidopsis
thaliana GN=ATL5H PE=2 SV=2
Length = 368

Score = 100 bits (250), Expect = 5e-21
Identities = 54/153 (35%), Positives = 84/153 (54%), Gaps = 7/153 (4%)
Frame = +1

Query: 202 LLQETAASSPFSPNAEDDNQDVNAFDVNARFSPSMAIILVILLTAFFFMAFFSIYVKRCS 381
LL +A P +P+ D + + SP+MA+++V+++ A FFM FF++Y++ C+
Sbjct: 16 LLLSVSAGQPGTPDQRHD-----PYAYSGSLSPAMAVVVVVVIAALFFMGFFTVYIRHCT 70

Query: 382 SRQTDATRTPAALPH---PSDIPSQGVDSAFLETLPLVAYSSSKK----KGSNIECVVCL 540
D + TPA + ++G+D+ +ET P YS K KG+ +EC +CL
Sbjct: 71 GA-VDGSVTPAGGARRRVTNATVARGLDAETIETFPTFVYSEVKTQKIGKGA-LECAICL 128

Query: 541 TDFEESEPLCQLPRCKHVFHKDCIDMWLFSHTT 639
+FE+ E L LP+C HVFH CI WL H T
Sbjct: 129 NEFEDDETLRLLPKCDHVFHPHCIGAWLQGHVT 161


>sp|Q8W571|ATL4O_ARATH RING-H2 finger protein ATL4O OS=Arabidopsis
thaliana GN=ATL4O PE=2 SV=2
Length = 322

Score = 98.2 bits (243), Expect = 3e-20
Identities = 51/155 (32%), Positives = 80/155 (51%), Gaps = 4/155 (2%)
Frame = +1

Query: 187 LHTRRLLQETAASSPFSPNAEDDNQDVNAFDVNARFSPSMAIILVILLTAFFFMAFFSIY 366
LH ++Q A + FSP+ D + +PS + +L+T FF S+Y
Sbjct: 15 LHVAIIIQSKANAQSFSPSPPD---------LQTGHTPSKTTVFAVLVTLFFLTGLLSVY 65

Query: 367 VKRCSSRQTDA-TRTPAALPHPSDIPSQGVDSAFLETLPLVAYSSSKKK---GSNIECVV 534
++ C+ D+ TR + G+D+A +E+ P+ AYSS K+ ++EC +
Sbjct: 66 IRHCARSNPDSSTRYFRNRANDGSSRRGGLDNAVVESFPVFAYSSVKESKIGSKDLECAI 125

Query: 535 CLTDFEESEPLCQLPRCKHVFHKDCIDMWLFSHTT 639
CL + E+ E + LP C H+FH DCID WL+SH T
Sbjct: 126 CLNELEDHETVRLLPICNHLFHIDCIDTWLYSHAT 160


>sp|Q9SK92|ATL1C_ARATH RING-H2 finger protein ATL1C OS=Arabidopsis
thaliana GN=ATL1C PE=2 SV=1
Length = 381

Score = 90.1 bits (222), Expect = 9e-18
Identities = 50/129 (38%), Positives = 73/129 (56%), Gaps = 7/129 (5%)
Frame = +1

Query: 274 FDVNAR--FSPSMAIILVILLTAFFFMAFFSIYVKRCSSRQT--DATRTPAALPHPSDIP 441
FD R FSP+ AII+++L++ FF + S+Y++RC D+ P +
Sbjct: 27 FDDEGRTSFSPTTAIIMIVLVSVFFALGCISVYMRRCLQHALGMDSGGGPGNWLNVRQTT 86

Query: 442 SQGVDSAFLETLPLVAYSSSK--KKGSN-IECVVCLTDFEESEPLCQLPRCKHVFHKDCI 612
G+D++ +ET P YS+ K + G +EC VCL +FE+ E L +P+C HVFH CI
Sbjct: 87 EPGLDASVIETFPTFPYSTVKTLRIGKEALECPVCLNEFEDDETLRLIPQCCHVFHPGCI 146

Query: 613 DMWLFSHTT 639
D WL S TT
Sbjct: 147 DAWLRSQTT 155


>sp|Q940Q4|ATL4K_ARATH RING-H2 finger protein ATL4K OS=Arabidopsis
thaliana GN=ATL4K PE=2 SV=2
Length = 472

Score = 89.7 bits (221), Expect = 1e-17
Identities = 49/131 (37%), Positives = 69/131 (52%), Gaps = 9/131 (6%)
Frame = +1

Query: 274 FDVNARFSPSMAIILVILLTAFFFMAFFSIYVKRC---SSRQTD-----ATRTPAALPHP 429
FD+N++ SPS+ +I++IL FF + V+ SSR + T L
Sbjct: 41 FDLNSKISPSILLIIIILSIIFFISGLLHLLVRFLLTPSSRDREDYFDNVTALQGQLQQL 100

Query: 430 SDIPSQGVDSAFLETLPLVAYSSS-KKKGSNIECVVCLTDFEESEPLCQLPRCKHVFHKD 606
+ GVD +F++TLP+ Y S K +C VCL +FE + L LP+C H FH D
Sbjct: 101 FHLHDSGVDQSFIDTLPVFHYKSIIGLKNYPFDCAVCLCEFETEDKLRLLPKCSHAFHMD 160

Query: 607 CIDMWLFSHTT 639
CID WL SH+T
Sbjct: 161 CIDTWLLSHST 171


>sp|Q9SJJ7|ATL2E_ARATH RING-H2 finger protein ATL2E OS=Arabidopsis
thaliana GN=ATL2E PE=2 SV=1
Length = 237

Score = 89.7 bits (221), Expect = 1e-17
Identities = 61/182 (33%), Positives = 90/182 (49%), Gaps = 32/182 (17%)
Frame = +1

Query: 190 HTRRLLQ---------------ETAASSPFSPNAEDDNQDVNAFDVNARFSPSMAIILVI 324
H R+LLQ + SSP +P Q +A D +MA+ + I
Sbjct: 5 HLRKLLQLYQACGGEQELTKTVQNVTSSPLTPTPPP--QPPSALD------STMALTIFI 56

Query: 325 LLTAFFFMAFFSIYVKR---CSSRQTDAT---RTPAALPHPSDIPS-----------QGV 453
LL A FFM FFS+Y + SS D + RT ++ P + + +G+
Sbjct: 57 LLVALFFMGFFSVYFRHFADSSSSTVDISSMPRTRSSRMSPRRLSTSVVVSRPYSFRRGL 116

Query: 454 DSAFLETLPLVAYSSSKKKGSNIECVVCLTDFEESEPLCQLPRCKHVFHKDCIDMWLFSH 633
DS + +LP+ Y+ + K+ N +CV+CL+DFEE E + +P C HVFH DC+D WL S+
Sbjct: 117 DSQAVRSLPVYRYTKAAKQ-RNEDCVICLSDFEEGETVKVIPHCGHVFHVDCVDTWLSSY 175

Query: 634 TT 639
T
Sbjct: 176 VT 177


>sp|O64763|ATL2G_ARATH RING-H2 finger protein ATL2G OS=Arabidopsis
thaliana GN=ATL2G PE=2 SV=1
Length = 378

Score = 82.0 bits (201), Expect = 2e-15
Identities = 44/124 (35%), Positives = 68/124 (54%), Gaps = 12/124 (9%)
Frame = +1

Query: 304 MAIILVILLTAFFFMAFFSIYVKRCSS--------RQTDATRTPAALPHPSDIPSQGVDS 459
+ +++ +L FFM F SI+ +R ++ R TDA + + + ++G+D+
Sbjct: 51 VVVVITVLFLVIFFMVFGSIFCRRSNAQFSRSSIFRSTDAD-AESQVVRIRRLTARGLDA 109

Query: 460 AFLETLPLVAYSSSKK----KGSNIECVVCLTDFEESEPLCQLPRCKHVFHKDCIDMWLF 627
+ET P YS K KG +EC VCL +FE+ E L +P C HVFH DC+D+WL
Sbjct: 110 EAIETFPTFLYSEVKAVRIGKGG-VECAVCLCEFEDDETLRLMPPCCHVFHADCVDVWLS 168

Query: 628 SHTT 639
H+T
Sbjct: 169 EHST 172


>sp|Q9ZV53|ATL2C_ARATH Putative RING-H2 finger protein ATL2C
OS=Arabidopsis thaliana GN=ATL2C PE=2 SV=1
Length = 423

Score = 81.6 bits (200), Expect = 3e-15
Identities = 50/153 (32%), Positives = 78/153 (50%), Gaps = 9/153 (5%)
Frame = +1

Query: 208 QETAASSPFSPNAEDDNQDVNAFDVNARFSPSMAIILVILLTAFFFMAFFSIYVK--RCS 381
Q +SSP P + + ++N++ +P++ +I++IL FF I VK
Sbjct: 12 QNLISSSP-PPPLIPLKSNTSLSNLNSKITPNILLIIIILSIIFFISGLLHILVKFLLTP 70

Query: 382 SRQT------DATRTPAALPHPSDIPSQGVDSAFLETLPLVAYSSSKK-KGSNIECVVCL 540
SR++ + T L ++ GVD + ++TLP+ Y S K S +C VCL
Sbjct: 71 SRESREDYFDNVTALQGQLQQLFNLHDSGVDQSLIDTLPVFHYKSIVGLKISPFDCPVCL 130

Query: 541 TDFEESEPLCQLPRCKHVFHKDCIDMWLFSHTT 639
+FE + L LP+C H FH +CID WL SH+T
Sbjct: 131 CEFETEDKLRLLPKCSHAFHVECIDTWLLSHST 163


>sp|Q8GW38|ATL1D_ARATH RING-H2 finger protein ATL1D OS=Arabidopsis
thaliana GN=ATL1D PE=2 SV=1
Length = 369

Score = 80.1 bits (196), Expect = 9e-15
Identities = 48/163 (29%), Positives = 75/163 (46%), Gaps = 18/163 (11%)
Frame = +1

Query: 205 LQETAASSPFSPNAE-DDNQDVNAFDVNARFSPSMAIILVILLTAFFFMAFFSI----YV 369
+ ++A SP + N + D+ ++ N R SP + I+V+L FF + + Y+
Sbjct: 19 ISPSSAPSPITLNHQLTDSSSSSSSGGNNRISPIILFIIVLLSVIFFICSILHLLVRYYL 78

Query: 370 KRCSSRQTDATRTPAALPHPSD-------------IPSQGVDSAFLETLPLVAYSSSKKK 510
K+ S + + P SD + G+D A ++ LP+ Y K
Sbjct: 79 KKKRSNLSSSPNESNQNPEFSDSDTYQRQLQQLFHLHDSGLDQALIDALPVFLYKEIKGT 138

Query: 511 GSNIECVVCLTDFEESEPLCQLPRCKHVFHKDCIDMWLFSHTT 639
+C VCL +F E + L LP C H FH DCID WL S++T
Sbjct: 139 KEPFDCAVCLCEFSEDDKLRLLPNCSHAFHIDCIDTWLLSNST 181


tr_hit_id B8LN45
Definition tr|B8LN45|B8LN45_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 143
Score (bit) 124.0
E-value 5.0e-27
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960494|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_J05, 5'
(640 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8LN45|B8LN45_PICSI Putative uncharacterized protein OS=Picea... 124 5e-27
tr|A7R0H9|A7R0H9_VITVI Chromosome undetermined scaffold_309, who... 118 3e-25
tr|B8LL09|B8LL09_PICSI Putative uncharacterized protein OS=Picea... 117 5e-25
tr|Q84KA9|Q84KA9_CUCME RING/C3HC4/PHD zinc finger-like protein O... 116 1e-24
tr|Q6K5E4|Q6K5E4_ORYSJ RING-H2 zinc finger protein ATL6-like OS=... 116 1e-24
tr|A3BZR6|A3BZR6_ORYSJ Putative uncharacterized protein OS=Oryza... 116 1e-24
tr|A2Z274|A2Z274_ORYSI Putative uncharacterized protein OS=Oryza... 116 1e-24
tr|B4FZV3|B4FZV3_MAIZE Putative uncharacterized protein OS=Zea m... 113 1e-23
tr|A7NUS9|A7NUS9_VITVI Chromosome chr18 scaffold_1, whole genome... 110 6e-23
tr|Q2HTN3|Q2HTN3_MEDTR Zinc finger, RING-type OS=Medicago trunca... 110 1e-22
tr|A7PQN4|A7PQN4_VITVI Chromosome chr6 scaffold_25, whole genome... 109 2e-22
tr|A5BY68|A5BY68_VITVI Putative uncharacterized protein OS=Vitis... 108 2e-22
tr|B4FCV0|B4FCV0_MAIZE Putative uncharacterized protein OS=Zea m... 108 4e-22
tr|B8LQS8|B8LQS8_PICSI Putative uncharacterized protein OS=Picea... 106 1e-21
tr|Q0V7Y3|Q0V7Y3_ARATH At1g72200 OS=Arabidopsis thaliana PE=2 SV=1 103 1e-20
tr|A9RPJ9|A9RPJ9_PHYPA Predicted protein OS=Physcomitrella paten... 103 1e-20
tr|Q4FE31|Q4FE31_ARATH At3g05200 OS=Arabidopsis thaliana PE=2 SV=1 102 2e-20
tr|A7PSE2|A7PSE2_VITVI Chromosome chr14 scaffold_27, whole genom... 101 3e-20
tr|Q6YTT7|Q6YTT7_ORYSJ Os08g0484200 protein OS=Oryza sativa subs... 100 6e-20
tr|Q0WUY7|Q0WUY7_ARATH RING-H2 zinc finger protein-like OS=Arabi... 100 6e-20
tr|A3BU82|A3BU82_ORYSJ Putative uncharacterized protein OS=Oryza... 100 6e-20
tr|A2YWD6|A2YWD6_ORYSI Putative uncharacterized protein OS=Oryza... 100 6e-20
tr|Q69QB2|Q69QB2_ORYSJ Putative RING-H2 zinc finger protein OS=O... 99 2e-19
tr|A3B9P7|A3B9P7_ORYSJ Putative uncharacterized protein OS=Oryza... 99 2e-19
tr|A2YAR0|A2YAR0_ORYSI Putative uncharacterized protein OS=Oryza... 99 2e-19
tr|A7PC74|A7PC74_VITVI Chromosome chr2 scaffold_11, whole genome... 92 3e-17
tr|A9T8Z5|A9T8Z5_PHYPA Predicted protein OS=Physcomitrella paten... 91 5e-17
tr|Q4TU37|Q4TU37_ARATH RING finger family protein OS=Arabidopsis... 90 1e-16
tr|A7PEJ8|A7PEJ8_VITVI Chromosome chr11 scaffold_13, whole genom... 88 4e-16
tr|A5AYP8|A5AYP8_VITVI Putative uncharacterized protein OS=Vitis... 88 5e-16

>tr|B8LN45|B8LN45_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 466

Score = 124 bits (311), Expect = 5e-27
Identities = 64/143 (44%), Positives = 84/143 (58%), Gaps = 10/143 (6%)
Frame = +1

Query: 241 NAEDDNQDVNAFDVNARFSPSMAIILVILLTAFFFMAFFSIYVKRCSSRQTD------AT 402
+A DN +N RF+PSMAII+V+LL+AFFFM FFSIYV+RC+
Sbjct: 45 SAPSDNNSDPYGGLNNRFNPSMAIIIVVLLSAFFFMGFFSIYVRRCAGEDDSFRASRQGA 104

Query: 403 RTPAALPHPSDIPSQGVDSAFLETLPLVAYSSSK----KKGSNIECVVCLTDFEESEPLC 570
R A D + G+D A +E+ P+ +Y K + +EC VCL +FE+ E L
Sbjct: 105 RGANAQARRQDDGTHGLDRAVIESFPVFSYDLVKGLKAQTKETLECAVCLNEFEDDEQLR 164

Query: 571 QLPRCKHVFHKDCIDMWLFSHTT 639
LP+C H FH +CIDMWLFSHTT
Sbjct: 165 LLPKCSHAFHPECIDMWLFSHTT 187


>tr|A7R0H9|A7R0H9_VITVI Chromosome undetermined scaffold_309, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00011451001 PE=4 SV=1
Length = 309

Score = 118 bits (295), Expect = 3e-25
Identities = 56/128 (43%), Positives = 85/128 (66%), Gaps = 4/128 (3%)
Frame = +1

Query: 268 NAFDVNARFSPSMAIILVILLTAFFFMAFFSIYVKRCSSRQTDATRTPAALPHPSDIPSQ 447
N + ++A F+PSM II+V+L+ AFFFM S+Y+++C+ + + PAA + + +Q
Sbjct: 5 NPYGIDANFNPSMTIIIVVLVLAFFFMGLLSVYIRQCTESRITGSARPAAAINSGN-STQ 63

Query: 448 GVDSAFLETLPLVAYSSSKK----KGSNIECVVCLTDFEESEPLCQLPRCKHVFHKDCID 615
G+D+A ++ P+ YSS K KG+ +EC VCL++FE+ E L LP+C HVFH +CID
Sbjct: 64 GLDAALIQAFPVFVYSSVKDLKIGKGT-LECAVCLSEFEDEETLRLLPKCDHVFHPNCID 122

Query: 616 MWLFSHTT 639
WL HTT
Sbjct: 123 AWLAFHTT 130


>tr|B8LL09|B8LL09_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 467

Score = 117 bits (294), Expect = 5e-25
Identities = 66/150 (44%), Positives = 90/150 (60%), Gaps = 11/150 (7%)
Frame = +1

Query: 223 SSPFS-------PNAEDDNQDVNAFDVNARFSPSMAIILVILLTAFFFMAFFSIYVKRCS 381
+SPFS N+ DN D NARFSPSMAI+LV L+ A FFMA FSI ++C+
Sbjct: 36 ASPFSGVRLADNSNSPPDNNDDLYGGFNARFSPSMAIVLVGLVGACFFMACFSICFRKCA 95

Query: 382 SRQTDATRTPAALPHPSDIPSQGVDSAFLETLPLVAYSSSK----KKGSNIECVVCLTDF 549
S + ++ R A + ++G+D A +E+ P+ +Y K + +EC VCL++F
Sbjct: 96 S-EDESLRGANAQARRQNEGNRGLDRAVIESFPVFSYDLVKGLKAQTKETLECAVCLSEF 154

Query: 550 EESEPLCQLPRCKHVFHKDCIDMWLFSHTT 639
E+ E L LP+C H FH DCID WLFSHTT
Sbjct: 155 EDDEQLRLLPKCSHAFHPDCIDTWLFSHTT 184


>tr|Q84KA9|Q84KA9_CUCME RING/C3HC4/PHD zinc finger-like protein
OS=Cucumis melo GN=Drzf PE=4 SV=1
Length = 379

Score = 116 bits (291), Expect = 1e-24
Identities = 61/145 (42%), Positives = 87/145 (60%), Gaps = 3/145 (2%)
Frame = +1

Query: 214 TAASSPFSPNAEDDNQDVNAFDVNARFSPSMAIILVILLTAFFFMAFFSIYVKRCSSRQT 393
++ S+ F P A D D + R S SMA+I+VIL+ A FFMAFFS+Y++ C+ +
Sbjct: 22 SSVSAQFQP-APDPRSDPYQY----RLSGSMAVIIVILIAALFFMAFFSVYIRHCNDSPS 76

Query: 394 DATRTPAALPHPSDIPSQGVDSAFLETLPLVAYSSSKKK---GSNIECVVCLTDFEESEP 564
+ R A S ++G+D A +ET P + YS K+ S +EC VCL +FE+ E
Sbjct: 77 NTVRPITAAAGRSRRATRGLDPAVIETFPTLIYSDVKEHKIGKSALECAVCLNEFEDDET 136

Query: 565 LCQLPRCKHVFHKDCIDMWLFSHTT 639
L +P+C HVFH +CID WL SH+T
Sbjct: 137 LRLIPKCDHVFHPECIDAWLASHST 161


>tr|Q6K5E4|Q6K5E4_ORYSJ RING-H2 zinc finger protein ATL6-like
OS=Oryza sativa subsp. japonica GN=P0676H02.10 PE=4 SV=1
Length = 392

Score = 116 bits (291), Expect = 1e-24
Identities = 61/135 (45%), Positives = 83/135 (61%), Gaps = 6/135 (4%)
Frame = +1

Query: 253 DNQDVNAFDVNARFSPSMAIILVILLTAFFFMAFFSIYVKRCSSRQTDATRTPAALPHPS 432
DN + N FSPSMAI++V+L+ AFFF+ FFSIYV+ C + D + TP LP
Sbjct: 32 DNPPAGYYATN--FSPSMAIVIVVLIAAFFFLGFFSIYVRHCYGGRGDYSTTP--LPRSG 87

Query: 433 DIPSQ---GVDSAFLETLPLVAYSSSKKKGS---NIECVVCLTDFEESEPLCQLPRCKHV 594
S+ G+D + L T P +AY+ K S +EC VC+++F++ E L LP+C HV
Sbjct: 88 AARSRRQRGLDQSVLATFPTMAYADVKAHKSVKGALECAVCISEFDDDETLRLLPKCSHV 147

Query: 595 FHKDCIDMWLFSHTT 639
FH+DCID WL SH T
Sbjct: 148 FHQDCIDTWLASHAT 162


>tr|A3BZR6|A3BZR6_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_028538 PE=4 SV=1
Length = 441

Score = 116 bits (291), Expect = 1e-24
Identities = 61/135 (45%), Positives = 83/135 (61%), Gaps = 6/135 (4%)
Frame = +1

Query: 253 DNQDVNAFDVNARFSPSMAIILVILLTAFFFMAFFSIYVKRCSSRQTDATRTPAALPHPS 432
DN + N FSPSMAI++V+L+ AFFF+ FFSIYV+ C + D + TP LP
Sbjct: 32 DNPPAGYYATN--FSPSMAIVIVVLIAAFFFLGFFSIYVRHCYGGRGDYSTTP--LPRSG 87

Query: 433 DIPSQ---GVDSAFLETLPLVAYSSSKKKGS---NIECVVCLTDFEESEPLCQLPRCKHV 594
S+ G+D + L T P +AY+ K S +EC VC+++F++ E L LP+C HV
Sbjct: 88 AARSRRQRGLDQSVLATFPTMAYADVKAHKSVKGALECAVCISEFDDDETLRLLPKCSHV 147

Query: 595 FHKDCIDMWLFSHTT 639
FH+DCID WL SH T
Sbjct: 148 FHQDCIDTWLASHAT 162


>tr|A2Z274|A2Z274_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_31707 PE=4 SV=1
Length = 401

Score = 116 bits (291), Expect = 1e-24
Identities = 61/135 (45%), Positives = 83/135 (61%), Gaps = 6/135 (4%)
Frame = +1

Query: 253 DNQDVNAFDVNARFSPSMAIILVILLTAFFFMAFFSIYVKRCSSRQTDATRTPAALPHPS 432
DN + N FSPSMAI++V+L+ AFFF+ FFSIYV+ C + D + TP LP
Sbjct: 32 DNPPAGYYATN--FSPSMAIVIVVLIAAFFFLGFFSIYVRHCYGGRGDYSTTP--LPRSG 87

Query: 433 DIPSQ---GVDSAFLETLPLVAYSSSKKKGS---NIECVVCLTDFEESEPLCQLPRCKHV 594
S+ G+D + L T P +AY+ K S +EC VC+++F++ E L LP+C HV
Sbjct: 88 AARSRRQRGLDQSVLATFPTMAYADVKAHKSVKGALECAVCISEFDDDETLRLLPKCSHV 147

Query: 595 FHKDCIDMWLFSHTT 639
FH+DCID WL SH T
Sbjct: 148 FHQDCIDTWLASHAT 162


>tr|B4FZV3|B4FZV3_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 393

Score = 113 bits (282), Expect = 1e-23
Identities = 61/123 (49%), Positives = 78/123 (63%), Gaps = 7/123 (5%)
Frame = +1

Query: 292 FSPSMAIILVILLTAFFFMAFFSIYVKRC---SSRQTDATRTPAALPHPSDIPSQ-GVDS 459
FSPSMAI++V+L+ AFFF+ FFSIYV+ C S A R PA + Q G+D
Sbjct: 50 FSPSMAIVIVVLIAAFFFLGFFSIYVRHCYGDGSSGYSANRPPAPGGAAARSRRQRGLDE 109

Query: 460 AFLETLPLVAYSSSK--KKGSN-IECVVCLTDFEESEPLCQLPRCKHVFHKDCIDMWLFS 630
A LE+ P +AY+ K K G +EC VCL++F++ E L LP+C HVFH DCID WL S
Sbjct: 110 AVLESFPTMAYADVKAHKAGKGALECAVCLSEFDDDETLRLLPKCSHVFHPDCIDTWLAS 169

Query: 631 HTT 639
H T
Sbjct: 170 HVT 172


>tr|A7NUS9|A7NUS9_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015165001
PE=4 SV=1
Length = 409

Score = 110 bits (276), Expect = 6e-23
Identities = 54/125 (43%), Positives = 81/125 (64%), Gaps = 8/125 (6%)
Frame = +1

Query: 289 RFSPSMAIILVILLTAFFFMAFFSIYVKRCSSRQTDA---TRTPAALPHPSDIPSQGVDS 459
+F+PSMAI+++ +++AFFFM FFS+Y+++C R+ T H S + ++G++S
Sbjct: 58 KFNPSMAIVMIAIVSAFFFMGFFSVYLRQCIERRVRGRFNTEIVGIGGHRSWMAARGLNS 117

Query: 460 AFLETLPLVAYSSSK-----KKGSNIECVVCLTDFEESEPLCQLPRCKHVFHKDCIDMWL 624
+ +E P YS+ K K+G +EC VCL +FE+ E L LP+C HVFH DCID+WL
Sbjct: 118 SDIERFPTFVYSAVKAHKIGKEG--LECAVCLNEFEDDETLRLLPKCNHVFHSDCIDLWL 175

Query: 625 FSHTT 639
SH T
Sbjct: 176 ASHVT 180


>tr|Q2HTN3|Q2HTN3_MEDTR Zinc finger, RING-type OS=Medicago
truncatula GN=MtrDRAFT_AC150244g10v2 PE=4 SV=1
Length = 361

Score = 110 bits (274), Expect = 1e-22
Identities = 55/122 (45%), Positives = 79/122 (64%), Gaps = 3/122 (2%)
Frame = +1

Query: 283 NARFSPSMAIILVILLTAFFFMAFFSIYVKRCSSRQTDATRTPAALPHPSDIPSQGVDSA 462
N F+PS AII+VIL+ A F M FFSIY++RCS + + + + ++G+D +
Sbjct: 37 NQEFNPSFAIIIVILVAALFLMGFFSIYIRRCSDSPS-SNNLLLPITNGRRAVARGLDPS 95

Query: 463 FLETLPLVAYSSSK--KKGSNI-ECVVCLTDFEESEPLCQLPRCKHVFHKDCIDMWLFSH 633
+ET P++ YS K K G ++ EC VCL +FE++E L +P+C HVFH +CID WL SH
Sbjct: 96 VIETFPILEYSEVKIHKIGKDVLECAVCLMEFEDTETLRLIPKCDHVFHPECIDEWLSSH 155

Query: 634 TT 639
TT
Sbjct: 156 TT 157