DK960535
Clone id TST39A01NGRL0007_K22
Library
Length 595
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0007_K22. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
GTTTGTGTTTTTGGGTAGAGGAATGTGCAAAAACTTCTGGTAGGGAGGTATGCCACAATT
GAGGTCTGGTTCCTTGCAATCACATTAATGCTCGCATCTTACATGAGATTTTTGGACTAT
TGGTTTAGACTCTTCTTATGATTGGTAATAACATCTGGCTGGGAGGCGTGCGACAGTCAA
GTTCTGGTTCCTTGCATATGCACTACTGCTTCAATGCTACATGAAAATCTTGGTGTAGAT
GTTACTCGTCATTGGGTAGAGGAGTGAGAGGCATGCCAAAGTCATATGCAGCTGTGCCTT
CTCACCAGCATCTGTCCATTTCTTTTCTGAATATTGGGGTTGGGGAGAGGTTTGTATGGG
AAGCTATGCTTAAAGACAGGTGTCTTTCATTTTGAATGCATCCTGACAGCCAAATATGCA
CATGTAGAGTCAGTTAAATATTTTATTTCTTTTCTAGTGTTCGCAATATTTGGTTCCACA
TTAAGTCTCGATGAAGCTTTTTCCATTGATACCCCCATCTTAGACATCATCCTGTCATTT
TTACATGGTACAAGATATCAATGTTTCCCTTGTACGTTCCTCTTACATAATTCTG
■■Homology search results ■■ -
sp_hit_id O42385
Definition sp|O42385|5H1AA_FUGRU 5-hydroxytryptamine receptor 1A-alpha OS=Fugu rubripes
Align length 79
Score (bit) 35.4
E-value 0.22
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960535|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_K22, 5'
(595 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O42385|5H1AA_FUGRU 5-hydroxytryptamine receptor 1A-alpha OS=F... 35 0.22
sp|Q6XXY0|5HT1A_VULVU 5-hydroxytryptamine receptor 1A OS=Vulpes ... 34 0.49
sp|P19327|5HT1A_RAT 5-hydroxytryptamine receptor 1A OS=Rattus no... 34 0.49
sp|Q9N296|5HT1A_PONPY 5-hydroxytryptamine receptor 1A OS=Pongo p... 34 0.49
sp|Q9N298|5HT1A_PANTR 5-hydroxytryptamine receptor 1A OS=Pan tro... 34 0.49
sp|Q64264|5HT1A_MOUSE 5-hydroxytryptamine receptor 1A OS=Mus mus... 34 0.49
sp|P08908|5HT1A_HUMAN 5-hydroxytryptamine receptor 1A OS=Homo sa... 34 0.49
sp|Q0EAB6|5HT1A_HORSE 5-hydroxytryptamine receptor 1A OS=Equus c... 34 0.49
sp|Q9N297|5HT1A_GORGO 5-hydroxytryptamine receptor 1A OS=Gorilla... 34 0.49
sp|Q6XXX9|5HT1A_CANFA 5-hydroxytryptamine receptor 1A OS=Canis f... 34 0.49
sp|Q98998|5HT1A_XENLA 5-hydroxytryptamine receptor 1A OS=Xenopus... 33 0.83
sp|O42384|5H1AB_FUGRU 5-hydroxytryptamine receptor 1A-beta OS=Fu... 33 1.4
sp|Q7VQW8|HIS7_BLOFL Histidine biosynthesis bifunctional protein... 30 9.2
sp|Q6IQ26|DEN5A_HUMAN DENN domain-containing protein 5A OS=Homo ... 30 9.2

>sp|O42385|5H1AA_FUGRU 5-hydroxytryptamine receptor 1A-alpha OS=Fugu
rubripes GN=htr1aa PE=3 SV=1
Length = 423

Score = 35.4 bits (80), Expect = 0.22
Identities = 20/79 (25%), Positives = 38/79 (48%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCI 198
+NV L+G A ++ + L +A+ + L+ W T G + CD + + +
Sbjct: 77 QNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQDICDLFIALDVL 127

Query: 199 CTTASMLHENLGVDVTRHW 255
C T+S+LH + + R+W
Sbjct: 128 CCTSSILH-LCAIALDRYW 145


>sp|Q6XXY0|5HT1A_VULVU 5-hydroxytryptamine receptor 1A OS=Vulpes
vulpes GN=HTR1A PE=3 SV=1
Length = 423

Score = 34.3 bits (77), Expect = 0.49
Identities = 20/79 (25%), Positives = 37/79 (46%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCI 198
+NV L+G A ++ + L +A+ + L+ W T G CD + + +
Sbjct: 68 QNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQVTCDLFIALDVL 118

Query: 199 CTTASMLHENLGVDVTRHW 255
C T+S+LH + + R+W
Sbjct: 119 CCTSSILH-LCAIALDRYW 136


>sp|P19327|5HT1A_RAT 5-hydroxytryptamine receptor 1A OS=Rattus
norvegicus GN=Htr1a PE=2 SV=1
Length = 422

Score = 34.3 bits (77), Expect = 0.49
Identities = 20/79 (25%), Positives = 37/79 (46%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCI 198
+NV L+G A ++ + L +A+ + L+ W T G CD + + +
Sbjct: 68 QNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQVTCDLFIALDVL 118

Query: 199 CTTASMLHENLGVDVTRHW 255
C T+S+LH + + R+W
Sbjct: 119 CCTSSILH-LCAIALDRYW 136


>sp|Q9N296|5HT1A_PONPY 5-hydroxytryptamine receptor 1A OS=Pongo
pygmaeus GN=HTR1A PE=3 SV=1
Length = 422

Score = 34.3 bits (77), Expect = 0.49
Identities = 20/79 (25%), Positives = 37/79 (46%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCI 198
+NV L+G A ++ + L +A+ + L+ W T G CD + + +
Sbjct: 68 QNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQVTCDLFIALDVL 118

Query: 199 CTTASMLHENLGVDVTRHW 255
C T+S+LH + + R+W
Sbjct: 119 CCTSSILH-LCAIALDRYW 136


>sp|Q9N298|5HT1A_PANTR 5-hydroxytryptamine receptor 1A OS=Pan
troglodytes GN=HTR1A PE=3 SV=1
Length = 422

Score = 34.3 bits (77), Expect = 0.49
Identities = 20/79 (25%), Positives = 37/79 (46%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCI 198
+NV L+G A ++ + L +A+ + L+ W T G CD + + +
Sbjct: 68 QNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQVTCDLFIALDVL 118

Query: 199 CTTASMLHENLGVDVTRHW 255
C T+S+LH + + R+W
Sbjct: 119 CCTSSILH-LCAIALDRYW 136


>sp|Q64264|5HT1A_MOUSE 5-hydroxytryptamine receptor 1A OS=Mus
musculus GN=Htr1a PE=2 SV=1
Length = 421

Score = 34.3 bits (77), Expect = 0.49
Identities = 20/79 (25%), Positives = 37/79 (46%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCI 198
+NV L+G A ++ + L +A+ + L+ W T G CD + + +
Sbjct: 68 QNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQVTCDLFIALDVL 118

Query: 199 CTTASMLHENLGVDVTRHW 255
C T+S+LH + + R+W
Sbjct: 119 CCTSSILH-LCAIALDRYW 136


>sp|P08908|5HT1A_HUMAN 5-hydroxytryptamine receptor 1A OS=Homo
sapiens GN=HTR1A PE=1 SV=3
Length = 422

Score = 34.3 bits (77), Expect = 0.49
Identities = 20/79 (25%), Positives = 37/79 (46%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCI 198
+NV L+G A ++ + L +A+ + L+ W T G CD + + +
Sbjct: 68 QNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQVTCDLFIALDVL 118

Query: 199 CTTASMLHENLGVDVTRHW 255
C T+S+LH + + R+W
Sbjct: 119 CCTSSILH-LCAIALDRYW 136


>sp|Q0EAB6|5HT1A_HORSE 5-hydroxytryptamine receptor 1A OS=Equus
caballus GN=HTR1A PE=2 SV=1
Length = 422

Score = 34.3 bits (77), Expect = 0.49
Identities = 20/79 (25%), Positives = 37/79 (46%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCI 198
+NV L+G A ++ + L +A+ + L+ W T G CD + + +
Sbjct: 68 QNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQVTCDLFIALDVL 118

Query: 199 CTTASMLHENLGVDVTRHW 255
C T+S+LH + + R+W
Sbjct: 119 CCTSSILH-LCAIALDRYW 136


>sp|Q9N297|5HT1A_GORGO 5-hydroxytryptamine receptor 1A OS=Gorilla
gorilla gorilla GN=HTR1A PE=3 SV=1
Length = 422

Score = 34.3 bits (77), Expect = 0.49
Identities = 20/79 (25%), Positives = 37/79 (46%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCI 198
+NV L+G A ++ + L +A+ + L+ W T G CD + + +
Sbjct: 68 QNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQVTCDLFIALDVL 118

Query: 199 CTTASMLHENLGVDVTRHW 255
C T+S+LH + + R+W
Sbjct: 119 CCTSSILH-LCAIALDRYW 136


>sp|Q6XXX9|5HT1A_CANFA 5-hydroxytryptamine receptor 1A OS=Canis
familiaris GN=HTR1A PE=3 SV=1
Length = 423

Score = 34.3 bits (77), Expect = 0.49
Identities = 20/79 (25%), Positives = 37/79 (46%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCI 198
+NV L+G A ++ + L +A+ + L+ W T G CD + + +
Sbjct: 68 QNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQVTCDLFIALDVL 118

Query: 199 CTTASMLHENLGVDVTRHW 255
C T+S+LH + + R+W
Sbjct: 119 CCTSSILH-LCAIALDRYW 136


tr_hit_id Q4T0Z1
Definition tr|Q4T0Z1|Q4T0Z1_TETNG Chromosome 12 SCAF10787, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis
Align length 79
Score (bit) 36.2
E-value 1.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960535|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_K22, 5'
(595 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q4T0Z1|Q4T0Z1_TETNG Chromosome 12 SCAF10787, whole genome sho... 36 1.5
tr|B0S6X1|B0S6X1_DANRE Novel protein similar to vertebrate 5-hyd... 36 1.5
tr|A7DW69|A7DW69_PLAFE Serotonin receptor (Fragment) OS=Platicht... 35 3.3
tr|Q8BGS4|Q8BGS4_MOUSE Putative uncharacterized protein OS=Mus m... 34 5.6
tr|A3UIC6|A3UIC6_9RHOB Putative uncharacterized protein OS=Ocean... 34 5.6
tr|Q8HYB0|Q8HYB0_CANFA Serotonin receptor 1A OS=Canis familiaris... 34 5.6
tr|Q5ZGX3|Q5ZGX3_HUMAN 5-hydroxytryptamine receptor 1A (5-hydrox... 34 5.6
tr|A8K5W4|A8K5W4_HUMAN cDNA FLJ75939, highly similar to Homo sap... 34 5.6
tr|Q68HY0|Q68HY0_9MUSC Cytochrome c oxidase subunit 1 (Fragment)... 34 7.2
tr|Q8BZP1|Q8BZP1_MOUSE Putative uncharacterized protein OS=Mus m... 34 7.3

>tr|Q4T0Z1|Q4T0Z1_TETNG Chromosome 12 SCAF10787, whole genome
shotgun sequence. (Fragment) OS=Tetraodon nigroviridis
GN=GSTENG00009075001 PE=3 SV=1
Length = 422

Score = 36.2 bits (82), Expect = 1.5
Identities = 21/79 (26%), Positives = 38/79 (48%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCI 198
+NV L+G A ++ + L +A+ + L+ W T G E CD + + +
Sbjct: 77 QNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQEICDIFISLDVL 127

Query: 199 CTTASMLHENLGVDVTRHW 255
C T+S+LH + + R+W
Sbjct: 128 CCTSSILH-LCAIALDRYW 145


>tr|B0S6X1|B0S6X1_DANRE Novel protein similar to vertebrate
5-hydroxytryptamine (Serotonin) receptor 1A (HTR1A)
OS=Danio rerio GN=htr1a PE=3 SV=1
Length = 398

Score = 36.2 bits (82), Expect = 1.5
Identities = 21/79 (26%), Positives = 38/79 (48%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCI 198
+NV L+G A ++ + L +A+ + L+ W T G E CD + + +
Sbjct: 60 QNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQEMCDIFISLDVL 110

Query: 199 CTTASMLHENLGVDVTRHW 255
C T+S+LH + + R+W
Sbjct: 111 CCTSSILH-LCAIALDRYW 128


>tr|A7DW69|A7DW69_PLAFE Serotonin receptor (Fragment) OS=Platichthys
flesus GN=5HTR PE=2 SV=1
Length = 381

Score = 35.0 bits (79), Expect = 3.3
Identities = 20/79 (25%), Positives = 38/79 (48%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCI 198
+NV L+G A ++ + L +A+ + L+ W T G + CD + + +
Sbjct: 34 QNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQDICDLFISLDVL 84

Query: 199 CTTASMLHENLGVDVTRHW 255
C T+S+LH + + R+W
Sbjct: 85 CCTSSILH-LCAIALDRYW 102


>tr|Q8BGS4|Q8BGS4_MOUSE Putative uncharacterized protein OS=Mus
musculus GN=Htr1a PE=2 SV=1
Length = 421

Score = 34.3 bits (77), Expect = 5.6
Identities = 20/79 (25%), Positives = 37/79 (46%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCI 198
+NV L+G A ++ + L +A+ + L+ W T G CD + + +
Sbjct: 68 QNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQVTCDLFIALDVL 118

Query: 199 CTTASMLHENLGVDVTRHW 255
C T+S+LH + + R+W
Sbjct: 119 CCTSSILH-LCAIALDRYW 136


>tr|A3UIC6|A3UIC6_9RHOB Putative uncharacterized protein
OS=Oceanicaulis alexandrii HTCC2633 GN=OA2633_10044 PE=4
SV=1
Length = 151

Score = 34.3 bits (77), Expect = 5.6
Identities = 19/44 (43%), Positives = 27/44 (61%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVI 150
RN+ K++V A I VW LAIT+++A+ F WF L LV+
Sbjct: 58 RNLLKIIVNP-AMIAVWLLAITMIIANPALFTQGWFHFKLLLVL 100


>tr|Q8HYB0|Q8HYB0_CANFA Serotonin receptor 1A OS=Canis familiaris
GN=HTR1A PE=3 SV=1
Length = 423

Score = 34.3 bits (77), Expect = 5.6
Identities = 20/79 (25%), Positives = 37/79 (46%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCI 198
+NV L+G A ++ + L +A+ + L+ W T G CD + + +
Sbjct: 68 QNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQVTCDLFIALDVL 118

Query: 199 CTTASMLHENLGVDVTRHW 255
C T+S+LH + + R+W
Sbjct: 119 CCTSSILH-LCAIALDRYW 136


>tr|Q5ZGX3|Q5ZGX3_HUMAN 5-hydroxytryptamine receptor 1A
(5-hydroxytryptamine (Serotonin) receptor 1A) OS=Homo
sapiens GN=5HT1A PE=2 SV=1
Length = 422

Score = 34.3 bits (77), Expect = 5.6
Identities = 20/79 (25%), Positives = 37/79 (46%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCI 198
+NV L+G A ++ + L +A+ + L+ W T G CD + + +
Sbjct: 68 QNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQVTCDLFIALDVL 118

Query: 199 CTTASMLHENLGVDVTRHW 255
C T+S+LH + + R+W
Sbjct: 119 CCTSSILH-LCAIALDRYW 136


>tr|A8K5W4|A8K5W4_HUMAN cDNA FLJ75939, highly similar to Homo
sapiens 5-hydroxytryptamine (serotonin) receptor 1A
(HTR1A), mRNA OS=Homo sapiens PE=2 SV=1
Length = 422

Score = 34.3 bits (77), Expect = 5.6
Identities = 20/79 (25%), Positives = 37/79 (46%)
Frame = +1

Query: 19 RNVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCI 198
+NV L+G A ++ + L +A+ + L+ W T G CD + + +
Sbjct: 68 QNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQVTCDLFIALDVL 118

Query: 199 CTTASMLHENLGVDVTRHW 255
C T+S+LH + + R+W
Sbjct: 119 CCTSSILH-LCAIALDRYW 136


>tr|Q68HY0|Q68HY0_9MUSC Cytochrome c oxidase subunit 1 (Fragment)
OS=Fergusonina purcelli GN=COI PE=3 SV=1
Length = 248

Score = 33.9 bits (76), Expect = 7.2
Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 9/61 (14%)
Frame = +3

Query: 261 GVRGMPKSYAAVPSHQHL---------SISFLNIGVGERFVWEAMLKDRCLSF*MHPDSQ 413
G+ GMP+ Y+ P L SISFL+I + +WE+M+ R + + H +S
Sbjct: 180 GLAGMPRRYSDYPDSYTLWNIMSSIGASISFLSIIMFIMIMWESMISQRSIMYTTHLNSS 239

Query: 414 I 416
I
Sbjct: 240 I 240


>tr|Q8BZP1|Q8BZP1_MOUSE Putative uncharacterized protein OS=Mus
musculus GN=Htr1a PE=2 SV=1
Length = 421

Score = 33.9 bits (76), Expect = 7.3
Identities = 20/78 (25%), Positives = 36/78 (46%)
Frame = +1

Query: 22 NVQKLLVGRYATIEVWFLAITLMLASYMRFLDYWFRLFL*LVITSGWEACDSQVLVPCIC 201
NV L+G A ++ + L +A+ + L+ W T G CD + + +C
Sbjct: 69 NVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKW---------TLGQVTCDLFIALDVLC 119

Query: 202 TTASMLHENLGVDVTRHW 255
T+S+LH + + R+W
Sbjct: 120 CTSSILH-LCAIALDRYW 136