DK960589
Clone id TST39A01NGRL0007_N06
Library
Length 615
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0007_N06. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
AGAGAATCTCCAATTGTAATCGGGGGAAAATATATAACGACTGAATCAGGGACAGGCTTG
GTTCATACTGCACCAGGTCATGGCCAAGAGGATTTTGTGACCGGACAGAAATATGATCTT
CCAATGCTCTCACCCGTGGATGATGAAGGCAATTTCACCGAAGATGCAGGAGACTTTAAA
GGCTTGAGTGTATTGAGTGAGGGTAATGTCGCTGTTGTGGAGGCTCTTGACAAGGCTTCA
TATCTCTTGATGGAAGAACCTTATGCGCACAAATACCCTTATGATTGGCGGACCAAAAAG
CCTACCATATTCAGGGCAACAGAGCAGTGGTTTGCTTCAGTGGAAGGTTTCAAGGAAGCT
GCTCTAAGTGCCATTGCCAATGTGGAGTGGTTTCCTCCCCAGGGTGAAAATCGAATTACA
GCTATGGTTTCCGGACGCTCAGATTGGTGTATCTCAAGGCAAAGAACCTGGGGTGTACCC
ATTCCAGTGTTTTATAATATCAAGAATGGTGAACCTTTAATGAATCCCAAAACAATTAGC
CATGTTCAAGAAATTATAAGGCAGAAGGGCAGTGATGCCTGGTGGTACATGGGGAGTTGA
AGATCTCTTGCCTGA
■■Homology search results ■■ -
sp_hit_id Q8YXY3
Definition sp|Q8YXY3|SYI_ANASP Isoleucyl-tRNA synthetase OS=Anabaena sp. (strain PCC 7120)
Align length 195
Score (bit) 314.0
E-value 3.0e-85
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960589|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_N06, 5'
(615 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8YXY3|SYI_ANASP Isoleucyl-tRNA synthetase OS=Anabaena sp. (s... 314 3e-85
sp|Q8DGI7|SYI_THEEB Isoleucyl-tRNA synthetase OS=Thermosynechoco... 308 2e-83
sp|P73505|SYI_SYNY3 Isoleucyl-tRNA synthetase OS=Synechocystis s... 301 1e-81
sp|B0C872|SYI_ACAM1 Isoleucyl-tRNA synthetase OS=Acaryochloris m... 300 4e-81
sp|B0JSP4|SYI_MICAN Isoleucyl-tRNA synthetase OS=Microcystis aer... 295 2e-79
sp|Q5N1G1|SYI_SYNP6 Isoleucyl-tRNA synthetase OS=Synechococcus s... 294 2e-79
sp|Q7U9G9|SYI_SYNPX Isoleucyl-tRNA synthetase OS=Synechococcus s... 284 3e-76
sp|Q7TUN3|SYI_PROMM Isoleucyl-tRNA synthetase OS=Prochlorococcus... 283 7e-76
sp|Q0IDA5|SYI_SYNS3 Isoleucyl-tRNA synthetase OS=Synechococcus s... 275 2e-73
sp|Q7VDV0|SYI_PROMA Isoleucyl-tRNA synthetase OS=Prochlorococcus... 270 3e-72
sp|Q46HD5|SYI_PROMT Isoleucyl-tRNA synthetase OS=Prochlorococcus... 263 7e-70
sp|A8G2P6|SYI_PROM2 Isoleucyl-tRNA synthetase OS=Prochlorococcus... 261 2e-69
sp|A3PAV8|SYI_PROM0 Isoleucyl-tRNA synthetase OS=Prochlorococcus... 261 3e-69
sp|A2BUL8|SYI_PROM5 Isoleucyl-tRNA synthetase OS=Prochlorococcus... 260 5e-69
sp|A2BP36|SYI_PROMS Isoleucyl-tRNA synthetase OS=Prochlorococcus... 258 1e-68
sp|A2C071|SYI_PROM1 Isoleucyl-tRNA synthetase OS=Prochlorococcus... 258 2e-68
sp|Q7V352|SYI_PROMP Isoleucyl-tRNA synthetase OS=Prochlorococcus... 257 4e-68
sp|Q31CU4|SYI_PROM9 Isoleucyl-tRNA synthetase OS=Prochlorococcus... 253 6e-67
sp|Q7NF75|SYI_GLOVI Isoleucyl-tRNA synthetase OS=Gloeobacter vio... 252 9e-67
sp|Q8R9L3|SYI_THETN Isoleucyl-tRNA synthetase OS=Thermoanaerobac... 235 1e-61
sp|Q3AEP2|SYI_CARHZ Isoleucyl-tRNA synthetase OS=Carboxydothermu... 229 9e-60
sp|Q2RK59|SYI_MOOTA Isoleucyl-tRNA synthetase OS=Moorella thermo... 229 1e-59
sp|A4J2F4|SYI_DESRM Isoleucyl-tRNA synthetase OS=Desulfotomaculu... 227 4e-59
sp|Q0AYC7|SYI_SYNWW Isoleucyl-tRNA synthetase OS=Syntrophomonas ... 222 1e-57
sp|Q54CE4|SYIM_DICDI Probable isoleucyl-tRNA synthetase, mitocho... 221 3e-57
sp|A4IM25|SYI_GEOTN Isoleucyl-tRNA synthetase OS=Geobacillus the... 220 5e-57
sp|Q45477|SYI_BACSU Isoleucyl-tRNA synthetase OS=Bacillus subtil... 219 9e-57
sp|Q65JV7|SYI_BACLD Isoleucyl-tRNA synthetase OS=Bacillus lichen... 219 9e-57
sp|Q6HER9|SYI1_BACHK Isoleucyl-tRNA synthetase 1 OS=Bacillus thu... 218 3e-56
sp|Q636D1|SYI1_BACCZ Isoleucyl-tRNA synthetase 1 OS=Bacillus cer... 217 3e-56

>sp|Q8YXY3|SYI_ANASP Isoleucyl-tRNA synthetase OS=Anabaena sp.
(strain PCC 7120) GN=ileS PE=3 SV=1
Length = 960

Score = 314 bits (804), Expect = 3e-85
Identities = 144/195 (73%), Positives = 168/195 (86%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
RESP+V+GG YITTESGTGLVHTAPGHGQED+V G +Y LP+L+PVDD G+FT++AG F
Sbjct: 324 RESPVVVGGDYITTESGTGLVHTAPGHGQEDYVVGLRYGLPILAPVDDNGDFTQEAGQFA 383

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GL+VL EGN AV++AL A LL EE YAHKYPYDWRTKKPTIFRATEQWFASVEGF++
Sbjct: 384 GLNVLGEGNQAVIDALTAAGSLLKEEAYAHKYPYDWRTKKPTIFRATEQWFASVEGFRDE 443

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
AL AIA V+W P QGENRIT MV+ RSDWCISRQR+WGVPIPVFY+ + GEPL+N +TI+
Sbjct: 444 ALKAIAAVKWIPAQGENRITPMVAERSDWCISRQRSWGVPIPVFYDEETGEPLLNEETIN 503

Query: 541 HVQEIIRQKGSDAWW 585
+VQ II +KGSDAWW
Sbjct: 504 YVQAIIAEKGSDAWW 518


>sp|Q8DGI7|SYI_THEEB Isoleucyl-tRNA synthetase
OS=Thermosynechococcus elongatus (strain BP-1) GN=ileS
PE=3 SV=2
Length = 953

Score = 308 bits (788), Expect = 2e-83
Identities = 142/195 (72%), Positives = 163/195 (83%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
RE I+IGG Y+TTESGTGLVHTAPGHG ED+ GQ+Y LP+LSPVD+ G FT +AG F
Sbjct: 320 REGKILIGGDYVTTESGTGLVHTAPGHGLEDYGVGQRYGLPILSPVDENGCFTAEAGPFA 379

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GL+VL EGN AV+ AL + LL EEPY HKYPYDWRTKKPTIFRATEQWFASVEGF++A
Sbjct: 380 GLNVLQEGNAAVIAALQECGALLKEEPYVHKYPYDWRTKKPTIFRATEQWFASVEGFRDA 439

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
AL AIA V+W P QGENRITAMV+ RSDWCISRQR+WGVPIPVFY+ + GEPL+ +TI+
Sbjct: 440 ALRAIAEVKWIPAQGENRITAMVAERSDWCISRQRSWGVPIPVFYDKETGEPLLTAETIA 499

Query: 541 HVQEIIRQKGSDAWW 585
HVQ IIR +GSDAWW
Sbjct: 500 HVQAIIRDRGSDAWW 514


>sp|P73505|SYI_SYNY3 Isoleucyl-tRNA synthetase OS=Synechocystis sp.
(strain PCC 6803) GN=ileS PE=3 SV=1
Length = 988

Score = 301 bits (772), Expect = 1e-81
Identities = 139/195 (71%), Positives = 158/195 (81%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
R SPIVIGG Y+TTESGTGLVHTAPGHGQED+V GQ+Y LP+LSPVD GN TE+AG F
Sbjct: 320 RVSPIVIGGDYVTTESGTGLVHTAPGHGQEDYVVGQRYGLPILSPVDAAGNLTEEAGKFA 379

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GL+VL++ N A++ AL LL EE Y HKYPYDWRTKKPTIFRATEQWFASVEGF++
Sbjct: 380 GLNVLNDANEAIINALQDQKVLLKEEAYEHKYPYDWRTKKPTIFRATEQWFASVEGFRDQ 439

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
AL AI V W P QGENRIT MV RSDWCISRQR WGVPIPVFY+ + EPL+ +TI+
Sbjct: 440 ALKAIKEVTWIPTQGENRITPMVGDRSDWCISRQRAWGVPIPVFYDEETSEPLLTEETIN 499

Query: 541 HVQEIIRQKGSDAWW 585
HVQ+II +KGSDAWW
Sbjct: 500 HVQQIIAEKGSDAWW 514


>sp|B0C872|SYI_ACAM1 Isoleucyl-tRNA synthetase OS=Acaryochloris
marina (strain MBIC 11017) GN=ileS PE=3 SV=1
Length = 971

Score = 300 bits (768), Expect = 4e-81
Identities = 139/195 (71%), Positives = 159/195 (81%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
RE P+V+G Y+TTESGTGLVHTAPGHGQED+ GQ+Y L MLSPVD +G FT++AG F
Sbjct: 315 REGPLVLGD-YVTTESGTGLVHTAPGHGQEDYQVGQQYGLAMLSPVDGDGTFTDEAGPFA 373

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GL+VL+ GN AV+EAL A LL EE YAHKYPYDWRTKKP I RATEQWFASV+GF+EA
Sbjct: 374 GLNVLNGGNEAVIEALQSAGALLKEESYAHKYPYDWRTKKPVILRATEQWFASVDGFREA 433

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
L AIA V W P QGENRIT+MVS RSDWCISRQR WGVPIPVFYN GEPL+N T++
Sbjct: 434 VLDAIATVNWIPAQGENRITSMVSERSDWCISRQRNWGVPIPVFYNDATGEPLLNEATVN 493

Query: 541 HVQEIIRQKGSDAWW 585
H+Q I+ +KGSDAWW
Sbjct: 494 HIQGIVAEKGSDAWW 508


>sp|B0JSP4|SYI_MICAN Isoleucyl-tRNA synthetase OS=Microcystis
aeruginosa (strain NIES-843) GN=ileS PE=3 SV=1
Length = 952

Score = 295 bits (754), Expect = 2e-79
Identities = 135/195 (69%), Positives = 160/195 (82%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
RES I+IGG Y+TT+SGTGLVHTAPGHGQED++ GQ+Y LP+LSPVDD+GNFT +AG F
Sbjct: 313 RESAILIGGDYVTTDSGTGLVHTAPGHGQEDYIVGQRYGLPILSPVDDKGNFTAEAGQFA 372

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GL+VL + N A++ AL + LL EE Y HKYPYDWRTKKPTIFRATEQWFASVEGF+E
Sbjct: 373 GLNVLKDANEAIILALTEKGALLKEEAYQHKYPYDWRTKKPTIFRATEQWFASVEGFREL 432

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
AL AI +V W P G+NRIT+MVS RSDWCISRQR+WGVPIPVFY+ + EPL+ +TI+
Sbjct: 433 ALEAIDSVRWIPATGKNRITSMVSERSDWCISRQRSWGVPIPVFYDEETNEPLLTEETIN 492

Query: 541 HVQEIIRQKGSDAWW 585
HVQ I KGS+AWW
Sbjct: 493 HVQAIFGVKGSNAWW 507


>sp|Q5N1G1|SYI_SYNP6 Isoleucyl-tRNA synthetase OS=Synechococcus sp.
(strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=ileS
PE=3 SV=1
Length = 954

Score = 294 bits (753), Expect = 2e-79
Identities = 136/196 (69%), Positives = 161/196 (82%), Gaps = 1/196 (0%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGD-F 177
RESP+VIGG YITTESGTGLVHTAPGHGQ+DF+ G +Y L + PVDD+G+FT GD
Sbjct: 314 RESPVVIGGDYITTESGTGLVHTAPGHGQDDFIVGNRYGLEVFCPVDDKGDFTAAVGDRL 373

Query: 178 KGLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKE 357
G +VL + N AV+E L + LL EE YAH+YPYDWRTKKPTIFRATEQWFASVEGF+E
Sbjct: 374 VGKNVLKDANAAVIEWLTEVGALLKEESYAHRYPYDWRTKKPTIFRATEQWFASVEGFRE 433

Query: 358 AALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTI 537
AL AIA V+W P QGENRIT+MVS RSDWCISRQRTWGVPIPVFY+ ++GE L+N +TI
Sbjct: 434 QALQAIAEVDWIPAQGENRITSMVSERSDWCISRQRTWGVPIPVFYDEESGEALLNAETI 493

Query: 538 SHVQEIIRQKGSDAWW 585
+HV+ I+ ++GSDAWW
Sbjct: 494 AHVRAIVAERGSDAWW 509


>sp|Q7U9G9|SYI_SYNPX Isoleucyl-tRNA synthetase OS=Synechococcus sp.
(strain WH8102) GN=ileS PE=3 SV=1
Length = 974

Score = 284 bits (726), Expect = 3e-76
Identities = 128/195 (65%), Positives = 154/195 (78%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
R SP+VIGG+YITTESGTGLVHTAPGHG +DF TGQK+ LP+L PVD+ G T +AG F
Sbjct: 336 RTSPVVIGGEYITTESGTGLVHTAPGHGVDDFHTGQKHGLPVLCPVDEAGTLTAEAGPFA 395

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GL+VL + N ++EAL++A LL +E Y+H+YPYDWRTKKPTIFRATEQWFASVEGF++
Sbjct: 396 GLNVLKDANPGIIEALEQAGALLKQEAYSHRYPYDWRTKKPTIFRATEQWFASVEGFRQD 455

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
AL AI V+W P G NRI AMV R DWCISRQRTWGVPIPVFY+ NGE L+N T+S
Sbjct: 456 ALDAIDQVQWTPASGRNRIEAMVKERGDWCISRQRTWGVPIPVFYHHSNGEVLLNADTLS 515

Query: 541 HVQEIIRQKGSDAWW 585
H++ +I G+D WW
Sbjct: 516 HIETLIASHGADVWW 530


>sp|Q7TUN3|SYI_PROMM Isoleucyl-tRNA synthetase OS=Prochlorococcus
marinus (strain MIT 9313) GN=ileS PE=3 SV=1
Length = 968

Score = 283 bits (723), Expect = 7e-76
Identities = 128/195 (65%), Positives = 154/195 (78%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
R+SPIVIGG+YITTESGTGLVHTAPGHG +DF TGQK+DL ML PVD+ G T +AG F
Sbjct: 335 RDSPIVIGGEYITTESGTGLVHTAPGHGVDDFNTGQKHDLGMLCPVDESGTMTSEAGPFA 394

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GL+VL + N ++ AL++ LL EPYAH+YPYDWRTKKPTIFRATEQWFASVEGF+
Sbjct: 395 GLNVLKDANPTIIAALEERGALLKHEPYAHRYPYDWRTKKPTIFRATEQWFASVEGFRNE 454

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
AL+AI +VEW P G NR+ AMV R DWCISRQRTWGVPIPVFY + E L+N +T++
Sbjct: 455 ALTAINSVEWLPASGRNRMEAMVRERGDWCISRQRTWGVPIPVFYEREGNEVLLNDETLA 514

Query: 541 HVQEIIRQKGSDAWW 585
HV+ +I + G+D WW
Sbjct: 515 HVKALITEHGADVWW 529


>sp|Q0IDA5|SYI_SYNS3 Isoleucyl-tRNA synthetase OS=Synechococcus sp.
(strain CC9311) GN=ileS PE=3 SV=1
Length = 968

Score = 275 bits (702), Expect = 2e-73
Identities = 123/195 (63%), Positives = 154/195 (78%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
R S IV+GG+YITTESGTGLVHTAPGHG +DF TG+K+ LP+L PVD+ G T +AG F+
Sbjct: 335 RRSAIVVGGEYITTESGTGLVHTAPGHGVDDFNTGRKHGLPVLCPVDEAGTLTAEAGPFE 394

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GL+VL + N ++ AL+ + LL++E Y+H+YPYDWRTKKPTIFRATEQWFASVEGF+
Sbjct: 395 GLNVLKDANAKIIAALEDSGSLLLQESYSHRYPYDWRTKKPTIFRATEQWFASVEGFRTE 454

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
AL+AI V+W P G NRI +MVS R DWCISRQRTWGVPIPVFY + GE L+N +I+
Sbjct: 455 ALTAIDGVQWLPASGRNRIESMVSERGDWCISRQRTWGVPIPVFYQRETGEVLLNSDSIA 514

Query: 541 HVQEIIRQKGSDAWW 585
HV+ +I + G+D WW
Sbjct: 515 HVKALIAEHGADIWW 529


>sp|Q7VDV0|SYI_PROMA Isoleucyl-tRNA synthetase OS=Prochlorococcus
marinus GN=ileS PE=3 SV=1
Length = 969

Score = 270 bits (691), Expect = 3e-72
Identities = 119/193 (61%), Positives = 149/193 (77%)
Frame = +1

Query: 7 SPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFKGL 186
+P V+GG YITTESGTG+VHTAPGHG +DF TG KY LP++ PVD++G FT +AGDF+GL
Sbjct: 337 NPFVLGGNYITTESGTGIVHTAPGHGVDDFNTGMKYKLPIICPVDEKGFFTSEAGDFEGL 396

Query: 187 SVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEAAL 366
+VL + N ++ AL ++ LL E+PY HKYPYDWRTKKPTIFRATEQWFASVEGF+ AL
Sbjct: 397 NVLKDANTKIINALKESGCLLKEKPYIHKYPYDWRTKKPTIFRATEQWFASVEGFRNDAL 456

Query: 367 SAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTISHV 546
++I VEW P G+ RI +MV R DWCISRQR WGVPIPVFY+ + + L+N TI H+
Sbjct: 457 NSIEKVEWLPQSGKKRIKSMVEDRGDWCISRQRNWGVPIPVFYSKEGSKVLLNEATIKHI 516

Query: 547 QEIIRQKGSDAWW 585
+ + G+DAWW
Sbjct: 517 YNLFVKYGADAWW 529


tr_hit_id A7NW51
Definition tr|A7NW51|A7NW51_VITVI Chromosome chr5 scaffold_2, whole genome shotgun sequence OS=Vitis vinifera
Align length 197
Score (bit) 323.0
E-value 4.0e-87
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960589|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_N06, 5'
(615 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7NW51|A7NW51_VITVI Chromosome chr5 scaffold_2, whole genome ... 323 4e-87
tr|Q9FI67|Q9FI67_ARATH Isoleucyl-tRNA synthetase OS=Arabidopsis ... 321 2e-86
tr|Q8RXK8|Q8RXK8_ARATH Putative isoleucyl-tRNA synthetase OS=Ara... 321 2e-86
tr|Q2V303|Q2V303_ARATH Uncharacterized protein At5g49030.2 OS=Ar... 321 2e-86
tr|A9RSP9|A9RSP9_PHYPA Predicted protein OS=Physcomitrella paten... 321 2e-86
tr|B2IZP5|B2IZP5_NOSP7 Isoleucyl-tRNA synthetase OS=Nostoc punct... 320 5e-86
tr|Q10YK7|Q10YK7_TRIEI Isoleucyl-tRNA synthetase OS=Trichodesmiu... 317 4e-85
tr|B5VWN4|B5VWN4_SPIMA Isoleucyl-tRNA synthetase OS=Arthrospira ... 317 5e-85
tr|Q3M6K7|Q3M6K7_ANAVT Isoleucyl-tRNA synthetase OS=Anabaena var... 314 2e-84
tr|A0ZIG5|A0ZIG5_NODSP Isoleucyl-tRNA synthetase OS=Nodularia sp... 313 5e-84
tr|B7K5H5|B7K5H5_SYNP8 Isoleucyl-tRNA synthetase OS=Synechococcu... 312 1e-83
tr|B7KFT1|B7KFT1_9CHRO Isoleucyl-tRNA synthetase OS=Cyanothece s... 311 2e-83
tr|B4BYU4|B4BYU4_9CHRO Isoleucyl-tRNA synthetase OS=Cyanothece s... 310 4e-83
tr|Q6ZGC2|Q6ZGC2_ORYSJ Os02g0778200 protein OS=Oryza sativa subs... 306 5e-82
tr|B8AJH5|B8AJH5_ORYSI Putative uncharacterized protein OS=Oryza... 306 5e-82
tr|A3ABX3|A3ABX3_ORYSJ Putative uncharacterized protein OS=Oryza... 306 5e-82
tr|B8HMX3|B8HMX3_9CHRO Isoleucyl-tRNA synthetase OS=Cyanothece s... 305 1e-81
tr|B4B636|B4B636_9CHRO Isoleucyl-tRNA synthetase OS=Cyanothece s... 304 3e-81
tr|B4VIN1|B4VIN1_9CYAN Isoleucyl-tRNA synthetase OS=Microcoleus ... 301 2e-80
tr|B1XPN1|B1XPN1_SYNP2 Isoleucyl-tRNA synthetase OS=Synechococcu... 300 3e-80
tr|A3ISL0|A3ISL0_9CHRO Isoleucyl-tRNA synthetase OS=Cyanothece s... 299 8e-80
tr|Q4C778|Q4C778_CROWT Isoleucyl-tRNA synthetase, class Ia OS=Cr... 296 8e-79
tr|A8YNM8|A8YNM8_MICAE IleS protein OS=Microcystis aeruginosa PC... 295 1e-78
tr|Q31KF2|Q31KF2_SYNE7 Isoleucyl-tRNA synthetase OS=Synechococcu... 294 2e-78
tr|B1WVA3|B1WVA3_CYAA5 Isoleucyl-tRNA synthetase OS=Cyanothece (... 292 9e-78
tr|Q061D4|Q061D4_9SYNE Isoleucyl-tRNA synthetase OS=Synechococcu... 290 6e-77
tr|A5GW56|A5GW56_SYNR3 Isoleucyl-tRNA synthetase OS=Synechococcu... 288 2e-76
tr|B4WPD1|B4WPD1_9SYNE Isoleucyl-tRNA synthetase OS=Synechococcu... 287 3e-76
tr|A3Z8M3|A3Z8M3_9SYNE Isoleucyl-tRNA synthetase OS=Synechococcu... 286 9e-76
tr|Q3AW39|Q3AW39_SYNS9 Isoleucyl-tRNA synthetase OS=Synechococcu... 285 1e-75

>tr|A7NW51|A7NW51_VITVI Chromosome chr5 scaffold_2, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00019784001
PE=3 SV=1
Length = 925

Score = 323 bits (829), Expect = 4e-87
Identities = 146/197 (74%), Positives = 167/197 (84%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
RE P+VIGG YITTESGTGLVHTAPGHGQED+VTG KY LP+LSPVDD+G FTE+AG F
Sbjct: 291 RECPVVIGGDYITTESGTGLVHTAPGHGQEDYVTGMKYGLPILSPVDDDGKFTEEAGQFS 350

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GL VL +GN AVV LD+ ++MEEPY HKYPYDWRTKKPTIFRATEQWFASVEGF++
Sbjct: 351 GLDVLGDGNAAVVRFLDENLSIIMEEPYKHKYPYDWRTKKPTIFRATEQWFASVEGFRQV 410

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
A++AI V W P Q ENRI+AM S RSDWCISRQRTWGVPIPVFY++++ EPLMN +TI
Sbjct: 411 AMTAIGQVTWIPAQAENRISAMTSSRSDWCISRQRTWGVPIPVFYHVQSKEPLMNKETID 470

Query: 541 HVQEIIRQKGSDAWWYM 591
HV+ I+ QKGSDAWWYM
Sbjct: 471 HVKSIVSQKGSDAWWYM 487


>tr|Q9FI67|Q9FI67_ARATH Isoleucyl-tRNA synthetase OS=Arabidopsis
thaliana PE=3 SV=1
Length = 988

Score = 321 bits (823), Expect = 2e-86
Identities = 148/197 (75%), Positives = 166/197 (84%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
R+ P+VIGG YITTESGTGLVHTAPGHGQED+ TG KY LP++SPVDDEG FTE+AG F+
Sbjct: 328 RDCPVVIGGDYITTESGTGLVHTAPGHGQEDYATGLKYGLPLVSPVDDEGKFTEEAGQFR 387

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GLSVL EGN AVV LD+ L+MEE YAHKYPYDWRTKKPTIFRATEQWFASVEGF+ A
Sbjct: 388 GLSVLGEGNTAVVSYLDENMSLVMEESYAHKYPYDWRTKKPTIFRATEQWFASVEGFRTA 447

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
+ AI NV+W P Q NRI+AM S RSDWCISRQRTWGVPIP FY++K EPLMN +TI+
Sbjct: 448 TMDAINNVKWVPHQAVNRISAMTSSRSDWCISRQRTWGVPIPAFYHVKTKEPLMNEETIN 507

Query: 541 HVQEIIRQKGSDAWWYM 591
HV+ II QKGSDAWWYM
Sbjct: 508 HVKSIISQKGSDAWWYM 524


>tr|Q8RXK8|Q8RXK8_ARATH Putative isoleucyl-tRNA synthetase
OS=Arabidopsis thaliana GN=At5g49030 PE=2 SV=1
Length = 1093

Score = 321 bits (823), Expect = 2e-86
Identities = 148/197 (75%), Positives = 166/197 (84%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
R+ P+VIGG YITTESGTGLVHTAPGHGQED+ TG KY LP++SPVDDEG FTE+AG F+
Sbjct: 433 RDCPVVIGGDYITTESGTGLVHTAPGHGQEDYATGLKYGLPLVSPVDDEGKFTEEAGQFR 492

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GLSVL EGN AVV LD+ L+MEE YAHKYPYDWRTKKPTIFRATEQWFASVEGF+ A
Sbjct: 493 GLSVLGEGNTAVVSYLDENMSLVMEESYAHKYPYDWRTKKPTIFRATEQWFASVEGFRTA 552

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
+ AI NV+W P Q NRI+AM S RSDWCISRQRTWGVPIP FY++K EPLMN +TI+
Sbjct: 553 TMDAINNVKWVPHQAVNRISAMTSSRSDWCISRQRTWGVPIPAFYHVKTKEPLMNEETIN 612

Query: 541 HVQEIIRQKGSDAWWYM 591
HV+ II QKGSDAWWYM
Sbjct: 613 HVKSIISQKGSDAWWYM 629


>tr|Q2V303|Q2V303_ARATH Uncharacterized protein At5g49030.2
OS=Arabidopsis thaliana GN=At5g49030 PE=3 SV=1
Length = 955

Score = 321 bits (823), Expect = 2e-86
Identities = 148/197 (75%), Positives = 166/197 (84%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
R+ P+VIGG YITTESGTGLVHTAPGHGQED+ TG KY LP++SPVDDEG FTE+AG F+
Sbjct: 433 RDCPVVIGGDYITTESGTGLVHTAPGHGQEDYATGLKYGLPLVSPVDDEGKFTEEAGQFR 492

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GLSVL EGN AVV LD+ L+MEE YAHKYPYDWRTKKPTIFRATEQWFASVEGF+ A
Sbjct: 493 GLSVLGEGNTAVVSYLDENMSLVMEESYAHKYPYDWRTKKPTIFRATEQWFASVEGFRTA 552

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
+ AI NV+W P Q NRI+AM S RSDWCISRQRTWGVPIP FY++K EPLMN +TI+
Sbjct: 553 TMDAINNVKWVPHQAVNRISAMTSSRSDWCISRQRTWGVPIPAFYHVKTKEPLMNEETIN 612

Query: 541 HVQEIIRQKGSDAWWYM 591
HV+ II QKGSDAWWYM
Sbjct: 613 HVKSIISQKGSDAWWYM 629


>tr|A9RSP9|A9RSP9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_56033 PE=3 SV=1
Length = 1002

Score = 321 bits (822), Expect = 2e-86
Identities = 145/197 (73%), Positives = 167/197 (84%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
RE+P+V+GG YITTESGTGLVHTAPGHGQED++TG KY LP+LSPVDD GNFT +AG F
Sbjct: 335 RENPVVVGGDYITTESGTGLVHTAPGHGQEDYITGLKYGLPLLSPVDDNGNFTSEAGQFS 394

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GL+VL EGN +VV ALD S LLMEE Y HKYPYDWRTKKPTIFRATEQWFASVEGF++
Sbjct: 395 GLNVLGEGNSSVVTALDSHSVLLMEEAYVHKYPYDWRTKKPTIFRATEQWFASVEGFRQT 454

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
AL AI +V+W P GE RIT+M RSDWCISRQR+WGVPIPVFY++++ EPLM +TI+
Sbjct: 455 ALEAIRSVQWVPATGEKRITSMTVSRSDWCISRQRSWGVPIPVFYHVESNEPLMTQETIA 514

Query: 541 HVQEIIRQKGSDAWWYM 591
H+Q II QKGSDAWWYM
Sbjct: 515 HIQAIIAQKGSDAWWYM 531


>tr|B2IZP5|B2IZP5_NOSP7 Isoleucyl-tRNA synthetase OS=Nostoc
punctiforme (strain ATCC 29133 / PCC 73102)
GN=Npun_F1478 PE=4 SV=1
Length = 959

Score = 320 bits (819), Expect = 5e-86
Identities = 146/195 (74%), Positives = 168/195 (86%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
RESPIV+GG YITTESGTGLVHTAPGHGQED++ GQ+Y LP+L+PVDD GNFT++AG+F
Sbjct: 322 RESPIVVGGDYITTESGTGLVHTAPGHGQEDYIVGQRYGLPILAPVDDNGNFTQEAGEFA 381

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GL+VL +GN AV++AL A LL EEPY HKYPYDWRTKKPTIFRATEQWFASVEGF+E
Sbjct: 382 GLNVLGDGNQAVIDALAAAGSLLKEEPYPHKYPYDWRTKKPTIFRATEQWFASVEGFREE 441

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
AL AIA V+W P QGENRIT MV+ RSDWCISRQR+WGVPIPVFY+ GEPL+N + I+
Sbjct: 442 ALKAIATVKWIPAQGENRITPMVAERSDWCISRQRSWGVPIPVFYDEATGEPLLNEEIIN 501

Query: 541 HVQEIIRQKGSDAWW 585
HVQ II +KGSDAWW
Sbjct: 502 HVQGIIAEKGSDAWW 516


>tr|Q10YK7|Q10YK7_TRIEI Isoleucyl-tRNA synthetase OS=Trichodesmium
erythraeum (strain IMS101) GN=Tery_3586 PE=3 SV=1
Length = 1152

Score = 317 bits (812), Expect = 4e-85
Identities = 145/197 (73%), Positives = 166/197 (84%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
RES IVIGG Y+TTESGTGLVHTAPGHGQED++ GQ+Y L +LSPVD G FT +AG+F
Sbjct: 322 RESKIVIGGDYVTTESGTGLVHTAPGHGQEDYIVGQRYSLSILSPVDGNGKFTAEAGEFT 381

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GLSVL+EGN+AV+EAL + LL EEPY HKYPYDWRTKKPTIFRATEQWFASVEGF+
Sbjct: 382 GLSVLAEGNIAVIEALQNVNSLLKEEPYEHKYPYDWRTKKPTIFRATEQWFASVEGFRSE 441

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
AL AIA V W P QGENRIT MV+ RSDWCISRQR+WGVPIPVFY+ K GEPL+ +T++
Sbjct: 442 ALKAIAEVNWIPAQGENRITPMVNDRSDWCISRQRSWGVPIPVFYDEKTGEPLLTEETVA 501

Query: 541 HVQEIIRQKGSDAWWYM 591
HVQ+II +KGSDAWW M
Sbjct: 502 HVQKIIAEKGSDAWWEM 518


>tr|B5VWN4|B5VWN4_SPIMA Isoleucyl-tRNA synthetase OS=Arthrospira
maxima CS-328 GN=AmaxDRAFT_0926 PE=4 SV=1
Length = 697

Score = 317 bits (811), Expect = 5e-85
Identities = 142/195 (72%), Positives = 168/195 (86%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
RESPI+IGG Y+TTESGTGLVHTAPGHGQED++ GQ+Y LP+LSPVD+ G+FTE+AG+F
Sbjct: 323 RESPILIGGDYVTTESGTGLVHTAPGHGQEDYIVGQRYGLPILSPVDENGDFTEEAGEFA 382

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GL+VL + N A++EAL +A L+ EEPY HKYPYDWRTKKPTIFRATEQWFASVEGF+E
Sbjct: 383 GLNVLKDANGAIIEALQEAGSLIKEEPYQHKYPYDWRTKKPTIFRATEQWFASVEGFREQ 442

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
AL AI V+W P QGENRIT MVS RSDWCISRQR+WGVPIPVFY + GEPL+N +TI+
Sbjct: 443 ALEAIKQVQWIPSQGENRITPMVSDRSDWCISRQRSWGVPIPVFYEEETGEPLLNEETIN 502

Query: 541 HVQEIIRQKGSDAWW 585
HV++II Q G+DAWW
Sbjct: 503 HVKDIIAQHGTDAWW 517


>tr|Q3M6K7|Q3M6K7_ANAVT Isoleucyl-tRNA synthetase OS=Anabaena
variabilis (strain ATCC 29413 / PCC 7937) GN=Ava_3774
PE=3 SV=1
Length = 978

Score = 314 bits (805), Expect = 2e-84
Identities = 143/195 (73%), Positives = 169/195 (86%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
RESP+V+GG YITTESGTGLVHTAPGHGQED+V G +Y LP+L+PVDD G+FT++AG+F
Sbjct: 342 RESPVVVGGDYITTESGTGLVHTAPGHGQEDYVVGLRYGLPILAPVDDNGDFTQEAGEFA 401

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GL+VL +GN AV++AL A LL EE YAHKYPYDWRTKKPTIFRATEQWFASVEGF++
Sbjct: 402 GLNVLGDGNQAVIDALTAAGSLLKEEAYAHKYPYDWRTKKPTIFRATEQWFASVEGFRDE 461

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
AL AIA V+W P QGENRIT MV+ RSDWCISRQR+WGVPIPVFY+ + GEPL+N +TI+
Sbjct: 462 ALKAIATVKWIPAQGENRITPMVAERSDWCISRQRSWGVPIPVFYDEETGEPLLNEETIN 521

Query: 541 HVQEIIRQKGSDAWW 585
+VQ II +KGSDAWW
Sbjct: 522 YVQAIIAEKGSDAWW 536


>tr|A0ZIG5|A0ZIG5_NODSP Isoleucyl-tRNA synthetase OS=Nodularia
spumigena CCY 9414 GN=N9414_12438 PE=3 SV=1
Length = 958

Score = 313 bits (802), Expect = 5e-84
Identities = 142/197 (72%), Positives = 169/197 (85%)
Frame = +1

Query: 1 RESPIVIGGKYITTESGTGLVHTAPGHGQEDFVTGQKYDLPMLSPVDDEGNFTEDAGDFK 180
RESP+V+GG YITTESGTGLVHTAPGHGQED++ GQ+Y LP+L+PVDD G+FT++AG+F
Sbjct: 322 RESPVVVGGDYITTESGTGLVHTAPGHGQEDYIVGQRYGLPILAPVDDNGDFTQEAGEFA 381

Query: 181 GLSVLSEGNVAVVEALDKASYLLMEEPYAHKYPYDWRTKKPTIFRATEQWFASVEGFKEA 360
GL+VL +GN AV++AL A LL EE YAHKYPYDWRTKKPTIFRATEQWFASV GF++
Sbjct: 382 GLNVLGDGNQAVIDALTAAGSLLKEEAYAHKYPYDWRTKKPTIFRATEQWFASVAGFRDE 441

Query: 361 ALSAIANVEWFPPQGENRITAMVSGRSDWCISRQRTWGVPIPVFYNIKNGEPLMNPKTIS 540
AL AIA+V+W P QGENRI MV+ RSDWCISRQR+WGVPIPVFY+ GEPL+N ++I+
Sbjct: 442 ALKAIASVKWIPAQGENRIRPMVAERSDWCISRQRSWGVPIPVFYDEATGEPLLNEESIN 501

Query: 541 HVQEIIRQKGSDAWWYM 591
HVQ II +KGSDAWW M
Sbjct: 502 HVQGIIAEKGSDAWWEM 518