DK960653
Clone id TST39A01NGRL0007_P24
Library
Length 639
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0007_P24. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID
Sequence
GAGAGAGAGAGAGAGAGAGAGAGAGAGAGGGGTAAGAAGAAGACGAGGCGGTGGAGGAGG
AGGAGAGAGAGTACGCGTGCGCGCACGCAGCCAGGGAGAGAGAATAGAACCTTGAGAGAG
GAACGTGCAGGTTTTTAGGTGATAGAGGAGTGCAGAGAGAGAGAGAGAGAGAGAGAGGCG
GTGTTTTTGCGTGTGTCTTTGTGCATTGAGAGGAAGAGGAGTAATGGAGGAGGAGGAGGC
GAAGTGGGCGCGCGTGTTTCTGAGCTGGAGGGATGTGAGTGTGAAGGTGAAGGTGGCGCT
GGGCAACTCGCGCTTCCTGCTGCAGGACGTGAGTGGCTACGCTGACCCCGGCTCCCTCGT
CGCCATCATGGGCTCCTCTGGTTGCGGCAAAACCACCCTCCTCAATACTCTTGCAGGGCG
TCTGGGGAATGCAAGTCTGGTGAGGGGTGAGATTCTGGCTAACGGCAGGCGGCAGCGGCT
GGCCTATGGAAACTTGGCGTACGTGACACAGGATGAGTCGCTGATTCCGACGCTAAGCGT
TTTTGAGACGATGATGTATGCTGCGCATTTGCAGCTGCCTTCCTCCATGTCGTCCTACGA
CAAGCAGGTCCAGGTCCACCGAGTCATCCGCGAGATGGG
■■Homology search results ■■ -
sp_hit_id Q8RXN0
Definition sp|Q8RXN0|WBC11_ARATH White-brown complex homolog protein 11 OS=Arabidopsis thaliana
Align length 126
Score (bit) 120.0
E-value 8.0e-27
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960653|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_P24, 5'
(639 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8RXN0|WBC11_ARATH White-brown complex homolog protein 11 OS=... 120 8e-27
sp|Q8RWI9|WBC15_ARATH White-brown complex homolog protein 15 OS=... 117 5e-26
sp|Q9C8K2|WBC12_ARATH White-brown complex homolog protein 12 OS=... 107 4e-23
sp|Q9C8J8|WBC13_ARATH White-brown complex homolog protein 13 OS=... 103 1e-21
sp|Q93YS4|WBC23_ARATH White-brown complex homolog protein 23 OS=... 88 3e-17
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae GN... 87 6e-17
sp|Q9M3D6|WBC19_ARATH White-brown complex homolog protein 19 OS=... 86 1e-16
sp|Q9ZUU9|WBC3_ARATH White-brown complex homolog protein 3 OS=Ar... 86 2e-16
sp|Q9ZU35|WBC7_ARATH White-brown complex homolog protein 7 OS=Ar... 85 3e-16
sp|O74676|CDR4_CANAL ABC transporter CDR4 OS=Candida albicans GN... 85 3e-16
sp|Q9LFG8|WBC20_ARATH White-brown complex homolog protein 20 OS=... 84 5e-16
sp|Q9FT51|WBC28_ARATH Probable white-brown complex homolog prote... 83 1e-15
sp|Q9ZUT0|WBC2_ARATH White-brown complex homolog protein 2 OS=Ar... 82 3e-15
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dict... 81 5e-15
sp|Q9LK50|WBC27_ARATH Putative white-brown complex homolog prote... 80 7e-15
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster ... 80 7e-15
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharo... 80 7e-15
sp|Q9M2V7|WBC16_ARATH Probable white-brown complex homolog prote... 80 9e-15
sp|P43071|CDR1_CANAL Multidrug resistance protein CDR1 OS=Candid... 80 1e-14
sp|Q9FNB5|WBC6_ARATH White-brown complex homolog protein 6 OS=Ar... 79 2e-14
sp|Q9M2V5|WBC18_ARATH White-brown complex homolog protein 18 OS=... 79 2e-14
sp|Q9M2V6|WBC17_ARATH Probable white-brown complex homolog prote... 79 2e-14
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomy... 79 3e-14
sp|O80946|WBC1_ARATH White-brown complex homolog protein 1 OS=Ar... 78 3e-14
sp|P53756|YN99_YEAST Uncharacterized ABC transporter ATP-binding... 78 4e-14
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomy... 78 4e-14
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multi... 77 6e-14
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Ca... 77 6e-14
sp|O42690|CDR3_CANAL Opaque-specific ABC transporter CDR3 OS=Can... 77 6e-14
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candid... 77 8e-14

>sp|Q8RXN0|WBC11_ARATH White-brown complex homolog protein 11
OS=Arabidopsis thaliana GN=WBC11 PE=2 SV=1
Length = 703

Score = 120 bits (300), Expect = 8e-27
Identities = 58/126 (46%), Positives = 90/126 (71%)
Frame = +2

Query: 260 LSWRDVSVKVKVALGNSRFLLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLAGRLGNASL 439
L+W+D++V V + G ++ +L+ ++GYA+PGSL A+MG SG GK+T+L+ LA RL +
Sbjct: 50 LTWQDLTVMVTMGDGETQNVLEGLTGYAEPGSLTALMGPSGSGKSTMLDALASRLAANAF 109

Query: 440 VRGEILANGRRQRLAYGNLAYVTQDESLIPTLSVFETMMYAAHLQLPSSMSSYDKQVQVH 619
+ G +L NGR+ +L++G AYVTQD++LI TL+V ET+ Y+A ++LP M +K+ V
Sbjct: 110 LSGTVLLNGRKTKLSFGTAAYVTQDDNLIGTLTVRETIWYSARVRLPDKMLRSEKRALVE 169

Query: 620 RVIREM 637
R I EM
Sbjct: 170 RTIIEM 175


>sp|Q8RWI9|WBC15_ARATH White-brown complex homolog protein 15
OS=Arabidopsis thaliana GN=WBC15 PE=2 SV=2
Length = 691

Score = 117 bits (293), Expect = 5e-26
Identities = 61/128 (47%), Positives = 91/128 (71%), Gaps = 1/128 (0%)
Frame = +2

Query: 257 FLSWRDVSVKV-KVALGNSRFLLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLAGRLGNA 433
+L+W D++V + + G +R LLQ ++GYA+PG ++AIMG SG GK+TLL++LAGRL
Sbjct: 24 YLAWEDLTVVIPNFSDGPTRRLLQRLNGYAEPGRIMAIMGPSGSGKSTLLDSLAGRLARN 83

Query: 434 SLVRGEILANGRRQRLAYGNLAYVTQDESLIPTLSVFETMMYAAHLQLPSSMSSYDKQVQ 613
++ G +L NG++ RL YG +AYVTQ++ L+ TL+V ET+ Y+AHL+LPS MS +
Sbjct: 84 VVMTGNLLLNGKKARLDYGLVAYVTQEDVLLGTLTVRETITYSAHLRLPSDMSKEEVSDI 143

Query: 614 VHRVIREM 637
V I E+
Sbjct: 144 VEGTIMEL 151


>sp|Q9C8K2|WBC12_ARATH White-brown complex homolog protein 12
OS=Arabidopsis thaliana GN=WBC12 PE=1 SV=1
Length = 687

Score = 107 bits (268), Expect = 4e-23
Identities = 56/128 (43%), Positives = 89/128 (69%), Gaps = 1/128 (0%)
Frame = +2

Query: 257 FLSWRDVSVKV-KVALGNSRFLLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLAGRLGNA 433
+L+W D++V + + G +R LL ++G+A+PG ++AIMG SG GK+TLL++LAGRL
Sbjct: 23 YLAWEDLTVVIPNFSGGPTRRLLDGLNGHAEPGRIMAIMGPSGSGKSTLLDSLAGRLARN 82

Query: 434 SLVRGEILANGRRQRLAYGNLAYVTQDESLIPTLSVFETMMYAAHLQLPSSMSSYDKQVQ 613
++ G +L NG++ RL YG +AYVTQ++ L+ TL+V ET+ Y+AHL+L S ++ +
Sbjct: 83 VIMTGNLLLNGKKARLDYGLVAYVTQEDILMGTLTVRETITYSAHLRLSSDLTKEEVNDI 142

Query: 614 VHRVIREM 637
V I E+
Sbjct: 143 VEGTIIEL 150


>sp|Q9C8J8|WBC13_ARATH White-brown complex homolog protein 13
OS=Arabidopsis thaliana GN=WBC13 PE=2 SV=1
Length = 678

Score = 103 bits (256), Expect = 1e-21
Identities = 52/129 (40%), Positives = 87/129 (67%), Gaps = 1/129 (0%)
Frame = +2

Query: 254 VFLSWRDVSVKV-KVALGNSRFLLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLAGRLGN 430
++++W D++V + G ++ LL V+G +P ++AIMG SG GK+TLL+ LAGRL
Sbjct: 8 MYVAWEDLTVVIPNFGEGATKRLLNGVNGCGEPNRILAIMGPSGSGKSTLLDALAGRLAG 67

Query: 431 ASLVRGEILANGRRQRLAYGNLAYVTQDESLIPTLSVFETMMYAAHLQLPSSMSSYDKQV 610
++ G++L NG+++RL +G AYVTQ++ L+ TL+V E++ Y+AHL+LPS ++ +
Sbjct: 68 NVVMSGKVLVNGKKRRLDFGAAAYVTQEDVLLGTLTVRESISYSAHLRLPSKLTREEISD 127

Query: 611 QVHRVIREM 637
V I +M
Sbjct: 128 IVEATITDM 136


>sp|Q93YS4|WBC23_ARATH White-brown complex homolog protein 23
OS=Arabidopsis thaliana GN=WBC23 PE=2 SV=1
Length = 751

Score = 88.2 bits (217), Expect = 3e-17
Identities = 51/132 (38%), Positives = 81/132 (61%), Gaps = 4/132 (3%)
Frame = +2

Query: 254 VFLSWRDVSVKV---KVALGNSRFLLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLAGRL 424
+FL +RDV+ KV K+ + +L +SG +PG ++A+MG SG GKTTLL+ LAGR+
Sbjct: 155 IFLKFRDVTYKVVIKKLTSSVEKEILTGISGSVNPGEVLALMGPSGSGKTTLLSLLAGRI 214

Query: 425 GNASLVRGEILANGR-RQRLAYGNLAYVTQDESLIPTLSVFETMMYAAHLQLPSSMSSYD 601
+S G + N + + + +VTQD+ L P L+V ET+ YAA L+LP +++
Sbjct: 215 SQSS-TGGSVTYNDKPYSKYLKSKIGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQ 273

Query: 602 KQVQVHRVIREM 637
K+ + VI+E+
Sbjct: 274 KKQRALDVIQEL 285


>sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae GN=SNQ2
PE=1 SV=2
Length = 1501

Score = 87.4 bits (215), Expect = 6e-17
Identities = 54/138 (39%), Positives = 81/138 (58%), Gaps = 1/138 (0%)
Frame = +2

Query: 221 VMEEEEAKWARVFLSWRDVSVKVKVALGNSRFLLQDVSGYADPGSLVAIMGSSGCGKTTL 400
V ++ EAK VF+ W+DV + G R LL +VSGY PG++ A+MG SG GKTTL
Sbjct: 843 VFDDLEAKG--VFI-WKDVCFTIPYE-GGKRMLLDNVSGYCIPGTMTALMGESGAGKTTL 898

Query: 401 LNTLAGRLGNASLVRGEILANGRRQRLAY-GNLAYVTQDESLIPTLSVFETMMYAAHLQL 577
LNTLA R N ++ G++L NGR ++ YV Q + I L+V E++ ++A ++
Sbjct: 899 LNTLAQR--NVGIITGDMLVNGRPIDASFERRTGYVQQQDIHIAELTVRESLQFSARMRR 956

Query: 578 PSSMSSYDKQVQVHRVIR 631
P + +K V ++IR
Sbjct: 957 PQHLPDSEKMDYVEKIIR 974


>sp|Q9M3D6|WBC19_ARATH White-brown complex homolog protein 19
OS=Arabidopsis thaliana GN=WBC19 PE=1 SV=1
Length = 725

Score = 86.3 bits (212), Expect = 1e-16
Identities = 48/110 (43%), Positives = 70/110 (63%), Gaps = 3/110 (2%)
Frame = +2

Query: 317 LLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLAGRLGNASLVRGEILANGRR---QRLAY 487
LL DVSG A G ++A++G+SG GK+TL++ LAGR+ SL RG + NG + RL
Sbjct: 99 LLDDVSGEASDGDILAVLGASGAGKSTLIDALAGRVAEGSL-RGSVTLNGEKVLQSRLLK 157

Query: 488 GNLAYVTQDESLIPTLSVFETMMYAAHLQLPSSMSSYDKQVQVHRVIREM 637
AYV QD+ L P L+V ET+M+A+ +LP S+S K +V +I ++
Sbjct: 158 VISAYVMQDDLLFPMLTVKETLMFASEFRLPRSLSKSKKMERVEALIDQL 207


>sp|Q9ZUU9|WBC3_ARATH White-brown complex homolog protein 3
OS=Arabidopsis thaliana GN=WBC3 PE=1 SV=1
Length = 705

Score = 85.5 bits (210), Expect = 2e-16
Identities = 50/142 (35%), Positives = 83/142 (58%)
Frame = +2

Query: 212 GRGVMEEEEAKWARVFLSWRDVSVKVKVALGNSRFLLQDVSGYADPGSLVAIMGSSGCGK 391
G GV+ K A ++W+D++V +K S +++ +GYA PG++ IMG + GK
Sbjct: 102 GTGVVR----KIAGASIAWKDLTVTMKGKRKYSDKVVKSSNGYAFPGTMTVIMGPAKSGK 157

Query: 392 TTLLNTLAGRLGNASLVRGEILANGRRQRLAYGNLAYVTQDESLIPTLSVFETMMYAAHL 571
+TLL LAGRL ++ + GE+ NG + + YG+ +V ++ LI +L+V E + Y+A L
Sbjct: 158 STLLRALAGRLPPSAKMYGEVFVNGSKSHMPYGSYGFVERETQLIGSLTVREFLYYSALL 217

Query: 572 QLPSSMSSYDKQVQVHRVIREM 637
QLP + + K+ V I+ M
Sbjct: 218 QLPGFL--FQKRSVVEDAIQAM 237


>sp|Q9ZU35|WBC7_ARATH White-brown complex homolog protein 7
OS=Arabidopsis thaliana GN=WBC7 PE=1 SV=1
Length = 725

Score = 85.1 bits (209), Expect = 3e-16
Identities = 51/131 (38%), Positives = 78/131 (59%), Gaps = 3/131 (2%)
Frame = +2

Query: 254 VFLSWRDVSVKVKVALGNS-RFLLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLAGRLGN 430
V + WR+++ + S RFLL++VSG A PG L+AIMG SG GKTTLLN LAG+L
Sbjct: 68 VTIRWRNITCSLSDKSSKSVRFLLKNVSGEAKPGRLLAIMGPSGSGKTTLLNVLAGQLSL 127

Query: 431 ASLVR--GEILANGRRQRLAYGNLAYVTQDESLIPTLSVFETMMYAAHLQLPSSMSSYDK 604
+ + G + NG+ LA+V Q++ L+V ET+ +AA LQLP S+ ++
Sbjct: 128 SPRLHLSGLLEVNGKPSSSKAYKLAFVRQEDLFFSQLTVRETLSFAAELQLPEISSAEER 187

Query: 605 QVQVHRVIREM 637
V+ ++ ++
Sbjct: 188 DEYVNNLLLKL 198


>sp|O74676|CDR4_CANAL ABC transporter CDR4 OS=Candida albicans GN=CDR4
PE=3 SV=1
Length = 1490

Score = 85.1 bits (209), Expect = 3e-16
Identities = 48/123 (39%), Positives = 73/123 (59%), Gaps = 1/123 (0%)
Frame = +2

Query: 266 WRDVSVKVKVALGNSRFLLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLAGRLGNASLVR 445
WRD++ +VK+ R +L VSG+ PG + A+MG+SG GKTTLLN L+ RL +
Sbjct: 848 WRDLTYQVKIK-SEDRVILDHVSGWVKPGQVTALMGASGAGKTTLLNALSDRLTTGVVTE 906

Query: 446 GEILANGRRQRLAY-GNLAYVTQDESLIPTLSVFETMMYAAHLQLPSSMSSYDKQVQVHR 622
G L NGR ++ ++ YV Q + + T +V E + +AA+L+ P S+S +K V
Sbjct: 907 GIRLVNGRPLDSSFQRSIGYVQQQDLHLETSTVREALEFAAYLRQPKSVSRKEKNEYVDY 966

Query: 623 VIR 631
+IR
Sbjct: 967 IIR 969



Score = 45.8 bits (107), Expect = 2e-04
Identities = 25/95 (26%), Positives = 48/95 (50%), Gaps = 5/95 (5%)
Frame = +2

Query: 317 LLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLAGR-----LGNASLVRGEILANGRRQRL 481
+L+ + G PG L ++G G G +T L T+A + + S++R L ++
Sbjct: 172 ILKPMDGLIKPGELTVVLGRPGAGCSTFLKTIASQTYGYHIDKDSVIRYNSLTPHEIKKH 231

Query: 482 AYGNLAYVTQDESLIPTLSVFETMMYAAHLQLPSS 586
G + Y + E+ P L+V +T+ +AA ++ P +
Sbjct: 232 YRGEVVYCAETENHFPQLTVGDTLEFAAKMRTPQN 266


tr_hit_id A7QT46
Definition tr|A7QT46|A7QT46_VITVI Chromosome undetermined scaffold_165, whole genome shotgun sequence OS=Vitis vinifera
Align length 128
Score (bit) 135.0
E-value 2.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960653|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_P24, 5'
(639 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QT46|A7QT46_VITVI Chromosome undetermined scaffold_165, who... 135 2e-30
tr|A5B907|A5B907_VITVI Putative uncharacterized protein OS=Vitis... 135 2e-30
tr|A7QT44|A7QT44_VITVI Chromosome undetermined scaffold_165, who... 134 6e-30
tr|A7R4M9|A7R4M9_VITVI Chromosome undetermined scaffold_744, who... 131 4e-29
tr|A7QT48|A7QT48_VITVI Chromosome undetermined scaffold_165, who... 131 4e-29
tr|A8I2E4|A8I2E4_CHLRE Predicted protein OS=Chlamydomonas reinha... 130 5e-29
tr|Q2QT07|Q2QT07_ORYSJ Os12g0411700 protein OS=Oryza sativa subs... 130 7e-29
tr|Q7XI02|Q7XI02_ORYSJ ABC transporter family protein-like OS=Or... 126 1e-27
tr|Q7EY81|Q7EY81_ORYSJ Os07g0288700 protein OS=Oryza sativa subs... 126 1e-27
tr|B8B578|B8B578_ORYSI Putative uncharacterized protein OS=Oryza... 126 1e-27
tr|A7QT42|A7QT42_VITVI Chromosome undetermined scaffold_165, who... 126 1e-27
tr|A5BIV5|A5BIV5_VITVI Putative uncharacterized protein OS=Vitis... 125 2e-27
tr|A9TTR9|A9TTR9_PHYPA ATP-binding cassette transporter, subfami... 124 4e-27
tr|Q7XUM2|Q7XUM2_ORYSJ OSJNBa0074L08.3 protein OS=Oryza sativa s... 124 5e-27
tr|Q0JBJ8|Q0JBJ8_ORYSJ Os04g0528300 protein OS=Oryza sativa subs... 124 5e-27
tr|Q01HN4|Q01HN4_ORYSA OSIGBa0115K01-H0319F09.18 protein OS=Oryz... 124 5e-27
tr|A3AVS2|A3AVS2_ORYSJ Putative uncharacterized protein OS=Oryza... 124 5e-27
tr|A2XVR4|A2XVR4_ORYSI Putative uncharacterized protein OS=Oryza... 124 5e-27
tr|A3BW71|A3BW71_ORYSJ Putative uncharacterized protein OS=Oryza... 123 8e-27
tr|Q6K4D2|Q6K4D2_ORYSJ Os09g0472100 protein OS=Oryza sativa subs... 122 1e-26
tr|B8BCP6|B8BCP6_ORYSI Putative uncharacterized protein OS=Oryza... 122 1e-26
tr|A3BZU2|A3BZU2_ORYSJ Putative uncharacterized protein OS=Oryza... 122 1e-26
tr|Q6K4D1|Q6K4D1_ORYSJ Os09g0472200 protein OS=Oryza sativa subs... 122 2e-26
tr|B8BD11|B8BD11_ORYSI Putative uncharacterized protein OS=Oryza... 122 2e-26
tr|B6SL34|B6SL34_MAIZE ATP-binding cassette sub-family G member ... 122 2e-26
tr|A7R4N0|A7R4N0_VITVI Chromosome undetermined scaffold_744, who... 122 2e-26
tr|A5C3S6|A5C3S6_VITVI Putative uncharacterized protein OS=Vitis... 122 2e-26
tr|A3BZU3|A3BZU3_ORYSJ Putative uncharacterized protein OS=Oryza... 122 2e-26
tr|A2Z298|A2Z298_ORYSI Putative uncharacterized protein OS=Oryza... 122 2e-26
tr|B6SVU3|B6SVU3_MAIZE ABC transporter C05D10.3 in chromosome II... 122 2e-26

>tr|A7QT46|A7QT46_VITVI Chromosome undetermined scaffold_165, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00006161001 PE=3 SV=1
Length = 653

Score = 135 bits (341), Expect = 2e-30
Identities = 69/128 (53%), Positives = 90/128 (70%)
Frame = +2

Query: 254 VFLSWRDVSVKVKVALGNSRFLLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLAGRLGNA 433
+FL+W D+SV G SR LLQ ++G+A PG ++AIMG SGCGK+TLL+ LAGRLG+
Sbjct: 22 IFLTWEDLSVTASNGKGGSRLLLQGLTGFARPGEVLAIMGPSGCGKSTLLDALAGRLGSN 81

Query: 434 SLVRGEILANGRRQRLAYGNLAYVTQDESLIPTLSVFETMMYAAHLQLPSSMSSYDKQVQ 613
G +L NG +Q LAYG AYVTQD++LI TL+V E + Y+A LQLP SMS +K+ +
Sbjct: 82 ISQSGMVLVNGHQQTLAYGTSAYVTQDDTLITTLTVGEAVCYSALLQLPDSMSKSEKKER 141

Query: 614 VHRVIREM 637
IREM
Sbjct: 142 ADMTIREM 149


>tr|A5B907|A5B907_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_013416 PE=3 SV=1
Length = 658

Score = 135 bits (341), Expect = 2e-30
Identities = 69/128 (53%), Positives = 90/128 (70%)
Frame = +2

Query: 254 VFLSWRDVSVKVKVALGNSRFLLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLAGRLGNA 433
+FL+W D+SV G SR LLQ ++G+A PG ++AIMG SGCGK+TLL+ LAGRLG+
Sbjct: 56 IFLTWEDLSVTASNGKGGSRLLLQGLTGFARPGEVLAIMGPSGCGKSTLLDALAGRLGSN 115

Query: 434 SLVRGEILANGRRQRLAYGNLAYVTQDESLIPTLSVFETMMYAAHLQLPSSMSSYDKQVQ 613
G +L NG +Q LAYG AYVTQD++LI TL+V E + Y+A LQLP SMS +K+ +
Sbjct: 116 ISQSGMVLVNGHQQTLAYGTSAYVTQDDTLITTLTVGEAVYYSALLQLPDSMSKSEKKER 175

Query: 614 VHRVIREM 637
IREM
Sbjct: 176 ADMTIREM 183


>tr|A7QT44|A7QT44_VITVI Chromosome undetermined scaffold_165, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00006159001 PE=3 SV=1
Length = 687

Score = 134 bits (336), Expect = 6e-30
Identities = 75/143 (52%), Positives = 97/143 (67%), Gaps = 1/143 (0%)
Frame = +2

Query: 212 GRGVMEEEEAKWARVFLSWRDVSVKVKVALGNSRFLLQDVSGYADPGSLVAIMGSSGCGK 391
G GV EE V+L+W ++ V V G SR +LQD++GYA PG ++AIMG SGCGK
Sbjct: 47 GGGVSEE-----GGVYLTWENLWVTVSNGKGGSRSILQDLTGYARPGEVLAIMGPSGCGK 101

Query: 392 TTLLNTLAGRL-GNASLVRGEILANGRRQRLAYGNLAYVTQDESLIPTLSVFETMMYAAH 568
+TLL+ LAGRL N S G IL NGR+Q LAYG AYVTQD++L+ TL+V E + Y+A
Sbjct: 102 STLLDALAGRLEANQS---GSILVNGRKQTLAYGTSAYVTQDDTLLTTLTVGEAVYYSAQ 158

Query: 569 LQLPSSMSSYDKQVQVHRVIREM 637
LQLP SMS +K+ + I+EM
Sbjct: 159 LQLPDSMSKQEKKERADMTIKEM 181


>tr|A7R4M9|A7R4M9_VITVI Chromosome undetermined scaffold_744, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00004588001 PE=3 SV=1
Length = 891

Score = 131 bits (329), Expect = 4e-29
Identities = 68/128 (53%), Positives = 91/128 (71%)
Frame = +2

Query: 254 VFLSWRDVSVKVKVALGNSRFLLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLAGRLGNA 433
VFL+W+D+ V V R +LQ ++GYA PG ++AIMG SGCGK+TLL+ LAGRLG+
Sbjct: 267 VFLTWKDLWVTVPDQQSGRRPILQRLTGYAQPGEVLAIMGPSGCGKSTLLDALAGRLGSN 326

Query: 434 SLVRGEILANGRRQRLAYGNLAYVTQDESLIPTLSVFETMMYAAHLQLPSSMSSYDKQVQ 613
+ GEIL NGR+QRLA+G AYVTQD++L+ TL+V E + Y+A LQLP SM + K+ +
Sbjct: 327 TRQAGEILINGRKQRLAFGTSAYVTQDDTLMTTLTVREAVHYSAQLQLPGSMPTSAKKER 386

Query: 614 VHRVIREM 637
I EM
Sbjct: 387 AEMTICEM 394


>tr|A7QT48|A7QT48_VITVI Chromosome undetermined scaffold_165, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00006163001 PE=3 SV=1
Length = 676

Score = 131 bits (329), Expect = 4e-29
Identities = 68/128 (53%), Positives = 89/128 (69%)
Frame = +2

Query: 254 VFLSWRDVSVKVKVALGNSRFLLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLAGRLGNA 433
VFL+W D+ V V R +LQ ++GYA PG ++AIMG SGCGK+TLL+ LAGRLG+
Sbjct: 45 VFLTWEDLWVTVSNGKSGCRSILQGLTGYARPGEVLAIMGPSGCGKSTLLDALAGRLGSN 104

Query: 434 SLVRGEILANGRRQRLAYGNLAYVTQDESLIPTLSVFETMMYAAHLQLPSSMSSYDKQVQ 613
+ G IL NG +Q L+YG AYVTQD++LI TL+V E + Y+A LQLP SMS +K+ +
Sbjct: 105 TSQSGIILVNGHKQALSYGTSAYVTQDDTLITTLTVGEAVYYSALLQLPDSMSKSEKKER 164

Query: 614 VHRVIREM 637
IREM
Sbjct: 165 ADMTIREM 172


>tr|A8I2E4|A8I2E4_CHLRE Predicted protein OS=Chlamydomonas
reinhardtii GN=CHLREDRAFT_142001 PE=3 SV=1
Length = 650

Score = 130 bits (328), Expect = 5e-29
Identities = 68/126 (53%), Positives = 89/126 (70%)
Frame = +2

Query: 260 LSWRDVSVKVKVALGNSRFLLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLAGRLGNASL 439
L+W++++V K G +R +L+DV GY P ++AIMG SGCGKTTLL+ LAGRL N+
Sbjct: 43 LTWQNLNVTSKDVKGGTRHILKDVRGYVAPRDMLAIMGPSGCGKTTLLDGLAGRLPNSVT 102

Query: 440 VRGEILANGRRQRLAYGNLAYVTQDESLIPTLSVFETMMYAAHLQLPSSMSSYDKQVQVH 619
G++L NG RL YG AYVTQDE L+ TLSV ET++YAA L+LPS+MS DK +V
Sbjct: 103 QTGDVLLNGHNSRLTYGLSAYVTQDEVLVGTLSVRETLVYAALLRLPSNMSKADKVARVD 162

Query: 620 RVIREM 637
VI E+
Sbjct: 163 DVISEL 168


>tr|Q2QT07|Q2QT07_ORYSJ Os12g0411700 protein OS=Oryza sativa subsp.
japonica GN=Os12g0411700 PE=2 SV=2
Length = 713

Score = 130 bits (327), Expect = 7e-29
Identities = 70/130 (53%), Positives = 89/130 (68%), Gaps = 2/130 (1%)
Frame = +2

Query: 254 VFLSWRDVSVKVKVALGNS--RFLLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLAGRLG 427
VFL+W DV V V S +L ++G+A PG ++AIMG SGCGKTTLL+TLAGRLG
Sbjct: 102 VFLTWEDVRVTVPGRTRGSPPARILDGITGHARPGEVLAIMGPSGCGKTTLLDTLAGRLG 161

Query: 428 NASLVRGEILANGRRQRLAYGNLAYVTQDESLIPTLSVFETMMYAAHLQLPSSMSSYDKQ 607
G IL NGR+++LA+G AYVTQD L+ TLSV E + Y+AHLQLP +M + +K+
Sbjct: 162 QEMNQTGVILINGRQEKLAFGTSAYVTQDNVLMSTLSVREAVYYSAHLQLPDTMLASEKR 221

Query: 608 VQVHRVIREM 637
RVIREM
Sbjct: 222 AHAERVIREM 231


>tr|Q7XI02|Q7XI02_ORYSJ ABC transporter family protein-like OS=Oryza
sativa subsp. japonica GN=P0438G07.112-2 PE=3 SV=1
Length = 362

Score = 126 bits (316), Expect = 1e-27
Identities = 66/134 (49%), Positives = 89/134 (66%), Gaps = 6/134 (4%)
Frame = +2

Query: 254 VFLSWRDVSVKVKVAL------GNSRFLLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLA 415
VFL+W D+SV A G +L +SGYA PG ++A+MG SGCGKTTLL+ LA
Sbjct: 118 VFLTWDDLSVTAPAAAAGCGGHGRRAVILDGLSGYARPGEVLALMGPSGCGKTTLLDALA 177

Query: 416 GRLGNASLVRGEILANGRRQRLAYGNLAYVTQDESLIPTLSVFETMMYAAHLQLPSSMSS 595
GRL +RG+IL NG R++L++G AYVTQ+ L+ TL+V E + Y+A LQLP SM +
Sbjct: 178 GRLSPNMKMRGDILINGLREKLSFGTSAYVTQENVLMATLTVTEAVHYSAQLQLPDSMPA 237

Query: 596 YDKQVQVHRVIREM 637
DK+ + R IR+M
Sbjct: 238 EDKRARADRAIRQM 251


>tr|Q7EY81|Q7EY81_ORYSJ Os07g0288700 protein OS=Oryza sativa subsp.
japonica GN=B1126F07.104-1 PE=2 SV=1
Length = 729

Score = 126 bits (316), Expect = 1e-27
Identities = 66/134 (49%), Positives = 89/134 (66%), Gaps = 6/134 (4%)
Frame = +2

Query: 254 VFLSWRDVSVKVKVAL------GNSRFLLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLA 415
VFL+W D+SV A G +L +SGYA PG ++A+MG SGCGKTTLL+ LA
Sbjct: 118 VFLTWDDLSVTAPAAAAGCGGHGRRAVILDGLSGYARPGEVLALMGPSGCGKTTLLDALA 177

Query: 416 GRLGNASLVRGEILANGRRQRLAYGNLAYVTQDESLIPTLSVFETMMYAAHLQLPSSMSS 595
GRL +RG+IL NG R++L++G AYVTQ+ L+ TL+V E + Y+A LQLP SM +
Sbjct: 178 GRLSPNMKMRGDILINGLREKLSFGTSAYVTQENVLMATLTVTEAVHYSAQLQLPDSMPA 237

Query: 596 YDKQVQVHRVIREM 637
DK+ + R IR+M
Sbjct: 238 EDKRARADRAIRQM 251


>tr|B8B578|B8B578_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_25665 PE=4 SV=1
Length = 753

Score = 126 bits (316), Expect = 1e-27
Identities = 66/134 (49%), Positives = 89/134 (66%), Gaps = 6/134 (4%)
Frame = +2

Query: 254 VFLSWRDVSVKVKVAL------GNSRFLLQDVSGYADPGSLVAIMGSSGCGKTTLLNTLA 415
VFL+W D+SV A G +L +SGYA PG ++A+MG SGCGKTTLL+ LA
Sbjct: 118 VFLTWDDLSVTAPAAAAGCGGHGRRAVILDGLSGYARPGEVLALMGPSGCGKTTLLDALA 177

Query: 416 GRLGNASLVRGEILANGRRQRLAYGNLAYVTQDESLIPTLSVFETMMYAAHLQLPSSMSS 595
GRL +RG+IL NG R++L++G AYVTQ+ L+ TL+V E + Y+A LQLP SM +
Sbjct: 178 GRLSPNMKMRGDILINGLREKLSFGTSAYVTQENVLMATLTVTEAVHYSAQLQLPDSMPA 237

Query: 596 YDKQVQVHRVIREM 637
DK+ + R IR+M
Sbjct: 238 EDKRARADRAIRQM 251