DK960699
Clone id TST39A01NGRL0008_B22
Library
Length 510
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0008_B22. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID -
Sequence
GGCCGCACAACTTTGTACAAGAAAGTTGGGTTTTTTTTTTTTTTTTTTTTGGAAAATGAT
GAGCGACACAAATTTCGCTTTTTCTCTACTTAATGAGAAAGAGAGAGAGAATGCTTTTGC
TTTCATGTTTTGACTCTCCGTGAGAGAAAGAGAGCAATTGCTTTTGATTTGAAGCTTTTG
GGGCTCTGCTTTTGGGCATCCCTTGTAACCTTTAAATTAGTGGTGAGGGCCTCACTTCTC
AAGAGCATCTGGACGCAGAGTCTGAGAGTGAAACCCTAACCGCTCTTTTGTACTTTGATG
ATTGATTAATATAAAAAGAAATACCGAAAGGGGCACCAGTCTTTGGGGCCAACATCTCTA
GGCACGGAACTCCGCCGGGCCATACTCTCTGTCTGAATCTTCGTTGTGATCCCAGCCCGC
ATCTCCAGATGCAGAGGGAGTCGACTGATCATTGCCTGAAGGCCATAAGTGCCGCGGAAA
AAAAATTTCGGGGATCGGATTTCCCGTAAA
■■Homology search results ■■ -
sp_hit_id Q9DBA6
Definition sp|Q9DBA6|TYSD1_MOUSE Peroxisomal leader peptide-processing protease OS=Mus musculus
Align length 62
Score (bit) 35.0
E-value 0.14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960699|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0008_B22, 5'
(444 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9DBA6|TYSD1_MOUSE Peroxisomal leader peptide-processing prot... 35 0.14
sp|P92517|M760_ARATH Uncharacterized mitochondrial protein AtMg0... 32 1.5
sp|Q2T9J0|TYSD1_HUMAN Peroxisomal leader peptide-processing prot... 30 3.4
sp|Q67622|REP_WDVS Replication-associated protein OS=Wheat dwarf... 30 5.9
sp|Q9HB29|ILRL2_HUMAN Interleukin-1 receptor-like 2 OS=Homo sapi... 29 10.0
sp|O70585|DTNB_MOUSE Dystrobrevin beta OS=Mus musculus GN=Dtnb P... 29 10.0

>sp|Q9DBA6|TYSD1_MOUSE Peroxisomal leader peptide-processing
protease OS=Mus musculus GN=Tysnd1 PE=1 SV=1
Length = 568

Score = 35.0 bits (79), Expect = 0.14
Identities = 19/62 (30%), Positives = 30/62 (48%)
Frame = +2

Query: 257 TERGTSLWGQHL*ARNSAGPYSLSESSL*SQPASPDAEGVD*SLPEGHKCRGKKISGIGF 436
T + ++WGQ + A PY ++ SL + GV +P GH G+ +S +GF
Sbjct: 389 TPKNVAIWGQVVFATQETSPYDIAVVSL-----EEELNGVPTPVPAGHFHEGEPVSVVGF 443

Query: 437 PV 442
V
Sbjct: 444 GV 445


>sp|P92517|M760_ARATH Uncharacterized mitochondrial protein
AtMg00760 OS=Arabidopsis thaliana GN=AtMg00760 PE=4 SV=1
Length = 109

Score = 31.6 bits (70), Expect = 1.5
Identities = 13/43 (30%), Positives = 23/43 (53%)
Frame = -3

Query: 352 GLGSQRRFRQRVWPGGVPCLEMLAPKTGAPFGISFYINQSSKY 224
G+ S R+ R WP V C + + T AP+G + ++ + K+
Sbjct: 36 GMLSSARYGLRRWPFTVKCSPLTSQSTTAPYGFTSFMRKGKKH 78


>sp|Q2T9J0|TYSD1_HUMAN Peroxisomal leader peptide-processing
protease OS=Homo sapiens GN=TYSND1 PE=2 SV=3
Length = 566

Score = 30.4 bits (67), Expect = 3.4
Identities = 17/66 (25%), Positives = 31/66 (46%)
Frame = +2

Query: 245 IKRNTERGTSLWGQHL*ARNSAGPYSLSESSL*SQPASPDAEGVD*SLPEGHKCRGKKIS 424
++ T + ++WG+ + A PY ++ SL D + V +P H G+ +S
Sbjct: 383 VRSTTPKSVAIWGRVVFATQETCPYDIAVVSL-----EEDLDDVPIPVPAEHFHEGEAVS 437

Query: 425 GIGFPV 442
+GF V
Sbjct: 438 VVGFGV 443


>sp|Q67622|REP_WDVS Replication-associated protein OS=Wheat dwarf
virus (isolate Sweden) GN=C1/C2 PE=1 SV=2
Length = 351

Score = 29.6 bits (65), Expect = 5.9
Identities = 12/35 (34%), Positives = 22/35 (62%), Gaps = 7/35 (20%)
Frame = -3

Query: 361 WRCGLGSQRRF-------RQRVWPGGVPCLEMLAP 278
W+C +G+QR F +++V GG+PC+ ++ P
Sbjct: 271 WKCFVGAQRDFTVNPKYGKRKVIRGGIPCIILVNP 305


>sp|Q9HB29|ILRL2_HUMAN Interleukin-1 receptor-like 2 OS=Homo sapiens
GN=IL1RL2 PE=2 SV=2
Length = 575

Score = 28.9 bits (63), Expect = 10.0
Identities = 17/46 (36%), Positives = 24/46 (52%)
Frame = -2

Query: 410 RGTYGLQAMISRLPLHLEMRAGITTKIQTESMARRSSVPRDVGPKD 273
RG Y QA+++ E+ GIT I TE SVP+ + PK+
Sbjct: 190 RGNYACQAILTHSGKQYEVLNGITVSI-TERAGYGGSVPKIIYPKN 234


>sp|O70585|DTNB_MOUSE Dystrobrevin beta OS=Mus musculus GN=Dtnb PE=1
SV=2
Length = 700

Score = 28.9 bits (63), Expect = 10.0
Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 3/64 (4%)
Frame = +3

Query: 189 AESESETLTALLYFDD*LI*KEIPKGAPV---FGANISRHGTPPGHTLCLNLRCDPSPHL 359
A+S + T+++L+ KE+ GA G +R G PP C + C P P L
Sbjct: 585 ADSITNTMSSLV--------KELHSGAEAEEQAGTEKTREGLPPEAHSCPSFCCTPGPSL 636

Query: 360 QMQR 371
Q R
Sbjct: 637 QAAR 640


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960699|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0008_B22, 5'
(444 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******