DK961025
Clone id TST39A01NGRL0009_A01
Library
Length 695
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0009_A01. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID
Sequence
ATATCATATGCGAGCGCATGTCTACCAATAAGGAGCTCTTTTCTAGTCATGCTATAGGAG
ATAGTATGCGAGTTTAAGGATCATCAAGGTAGTTGAGACTCAGTTTGGTATGGAACTTGA
AACCCAGGGGGAAAAAAGGAAAAAGAAGGTGCTAATTAGAGGGGCCGGCCCGCCAAAATG
ACTTGTGCGCTTTGGTGCCGAAGCAATGTTCAGTAGTTGACAGCAATGGAAAGGAGCGAG
CTGACTGTTGTTGAAGATCAGGGCTTGTACGCAAATCCCTGTGGCTACTGCAAGTCTCAA
GGTCCAACCAGTTTTGCTCATGGTCTATGGGCTCACTCCTTGTCACCATATGATTATCAA
GAGCTTCTTGATCAAAATTGGAGAAGATCAGGCATGGTTCTTTATCGGCCAGAGCTAGAA
CGATCATGTTGTCCAGCATATACAATTCGTCTGAAGGCTGGTTGCATGGAAAAATCTAGT
GAGCATGTTCGTGCTATGCGTCGGATGCAAAGGTATTTGGATGGAGTCTACTCTAGCCCT
TCTTCCGGGAGAAAGGAAACTGAATTGGCTGAAGAAGTAATGGACATTGATGTGAAGCCA
CATTATGAGAGGCTTAACACGAACATAGATATCAACCTTGCAACTCATTGCACAAAAGTC
AGCAAATTGGAATGAAGGCAAAACAGAAGTGTGCA
■■Homology search results ■■ -
sp_hit_id Q9ZT48
Definition sp|Q9ZT48|ATE1_ARATH Arginyl-tRNA--protein transferase 1 OS=Arabidopsis thaliana
Align length 94
Score (bit) 108.0
E-value 3.0e-23
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK961025|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0009_A01, 5'
(695 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9ZT48|ATE1_ARATH Arginyl-tRNA--protein transferase 1 OS=Arab... 108 3e-23
sp|Q2PFX0|ATE1_MACFA Arginyl-tRNA--protein transferase 1 OS=Maca... 89 3e-17
sp|O95260|ATE1_HUMAN Arginyl-tRNA--protein transferase 1 OS=Homo... 89 3e-17
sp|Q9Z2A5|ATE1_MOUSE Arginyl-tRNA--protein transferase 1 OS=Mus ... 86 1e-16
sp|O96539|ATE1_DROME Arginyl-tRNA--protein transferase 1 OS=Dros... 74 7e-13
sp|Q55EI0|ATE1_DICDI Arginyl-tRNA--protein transferase 1 OS=Dict... 67 9e-11
sp|O14133|ATE1_SCHPO Arginyl-tRNA--protein transferase 1 OS=Schi... 55 5e-07
sp|A1VN09|ATE_POLNA Putative arginyl-tRNA--protein transferase O... 37 0.10
sp|Q7VTR8|ATE_BORPE Putative arginyl-tRNA--protein transferase O... 37 0.10
sp|Q7W4W7|ATE_BORPA Putative arginyl-tRNA--protein transferase O... 37 0.10
sp|Q7WGE5|ATE_BORBR Putative arginyl-tRNA--protein transferase O... 37 0.10
sp|Q21VY8|ATE_RHOFD Putative arginyl-tRNA--protein transferase O... 36 0.23
sp|A4XUY1|ATE_PSEMY Putative arginyl-tRNA--protein transferase O... 35 0.29
sp|P16639|ATE1_YEAST Arginyl-tRNA--protein transferase 1 OS=Sacc... 35 0.38
sp|A4FBB7|SYH_SACEN Histidyl-tRNA synthetase OS=Saccharopolyspor... 35 0.50
sp|A4VLV4|ATE_PSEU5 Putative arginyl-tRNA--protein transferase O... 34 0.66
sp|Q0A7X7|ATE_ALHEH Putative arginyl-tRNA--protein transferase O... 34 0.66
sp|Q0BFQ9|ATE_BURCM Putative arginyl-tRNA--protein transferase O... 33 1.1
sp|Q9UX32|ARLY_SULSO Argininosuccinate lyase OS=Sulfolobus solfa... 33 1.1
sp|Q5LQC3|ATE_SILPO Putative arginyl-tRNA--protein transferase O... 33 1.5
sp|A1WWV3|ATE_HALHL Putative arginyl-tRNA--protein transferase O... 33 1.5
sp|A1U1G9|ATE_MARAV Putative arginyl-tRNA--protein transferase O... 33 1.9
sp|A1B416|ATE_PARDP Putative arginyl-tRNA--protein transferase O... 32 2.5
sp|Q1H2E4|ATE_METFK Putative arginyl-tRNA--protein transferase O... 32 2.5
sp|Q7MJ43|ATE_VIBVY Putative arginyl-tRNA--protein transferase O... 32 4.2
sp|Q8DAR7|ATE_VIBVU Putative arginyl-tRNA--protein transferase O... 32 4.2
sp|A4Y7L3|ATE_SHEPC Putative arginyl-tRNA--protein transferase O... 32 4.2
sp|Q82ST4|ATE_NITEU Putative arginyl-tRNA--protein transferase O... 32 4.2
sp|Q2SVM0|ATE_BURTA Putative arginyl-tRNA--protein transferase O... 32 4.2
sp|Q8PBH8|ATE_XANCP Putative arginyl-tRNA--protein transferase O... 31 5.5

>sp|Q9ZT48|ATE1_ARATH Arginyl-tRNA--protein transferase 1
OS=Arabidopsis thaliana GN=ATE1 PE=2 SV=2
Length = 632

Score = 108 bits (270), Expect = 3e-23
Identities = 47/94 (50%), Positives = 66/94 (70%)
Frame = +1

Query: 244 TVVEDQGLYANPCGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGMVLYRPELER 423
+V++D G + CGYCKS +S +HGL A +L+ YDYQ L+D+ WRRSG LY+ E+++
Sbjct: 19 SVIDDHGRRKSTCGYCKSPARSSISHGLSAQTLTVYDYQALIDRGWRRSGTYLYKHEMDK 78

Query: 424 SCCPAYTIRLKAGCMEKSSEHVRAMRRMQRYLDG 525
+CCP YTIRLKA + E R RR++R+LDG
Sbjct: 79 TCCPPYTIRLKASDFVPTKEQQRVSRRLERFLDG 112


>sp|Q2PFX0|ATE1_MACFA Arginyl-tRNA--protein transferase 1 OS=Macaca
fascicularis GN=ATE1 PE=2 SV=1
Length = 518

Score = 88.6 bits (218), Expect = 3e-17
Identities = 41/113 (36%), Positives = 67/113 (59%)
Frame = +1

Query: 280 CGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGMVLYRPELERSCCPAYTIRLKA 459
CGYCK++ S ++G+WAHS++ DYQ+L+D+ WRRSG +Y+P + ++CCP YTIR +
Sbjct: 23 CGYCKNESG-SRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRP 81

Query: 460 GCMEKSSEHVRAMRRMQRYLDGVYSSPSSGRKETELAEEVMDIDVKPHYERLN 618
+ S H + +++M ++L G E E + MD V + +N
Sbjct: 82 LQFQPSKSHKKVLKKMLKFL--AKGEVPKGSCEDEPMDSTMDDAVAGDFALIN 132


>sp|O95260|ATE1_HUMAN Arginyl-tRNA--protein transferase 1 OS=Homo
sapiens GN=ATE1 PE=1 SV=2
Length = 518

Score = 88.6 bits (218), Expect = 3e-17
Identities = 41/113 (36%), Positives = 67/113 (59%)
Frame = +1

Query: 280 CGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGMVLYRPELERSCCPAYTIRLKA 459
CGYCK++ S ++G+WAHS++ DYQ+L+D+ WRRSG +Y+P + ++CCP YTIR +
Sbjct: 23 CGYCKNESG-SRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRP 81

Query: 460 GCMEKSSEHVRAMRRMQRYLDGVYSSPSSGRKETELAEEVMDIDVKPHYERLN 618
+ S H + +++M ++L G E E + MD V + +N
Sbjct: 82 LQFQPSKSHKKVLKKMLKFL--AKGEVPKGSCEDEPMDSTMDDAVAGDFALIN 132


>sp|Q9Z2A5|ATE1_MOUSE Arginyl-tRNA--protein transferase 1 OS=Mus
musculus GN=Ate1 PE=1 SV=1
Length = 516

Score = 86.3 bits (212), Expect = 1e-16
Identities = 41/120 (34%), Positives = 71/120 (59%)
Frame = +1

Query: 259 QGLYANPCGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGMVLYRPELERSCCPA 438
+G + CGYCK++ S ++G+WAHS++ DYQ+L+D+ WRRSG +Y+P ++++CCP
Sbjct: 16 EGQTSFQCGYCKNK-LGSRSYGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMDQTCCPQ 74

Query: 439 YTIRLKAGCMEKSSEHVRAMRRMQRYLDGVYSSPSSGRKETELAEEVMDIDVKPHYERLN 618
YTIR + S H + +++M ++L S G E E + ++ V + +N
Sbjct: 75 YTIRCHPLQFQPSKSHKKVLKKMLKFL--AKGEISKGNCEDEPMDSTVEDAVDGDFALIN 132


>sp|O96539|ATE1_DROME Arginyl-tRNA--protein transferase 1
OS=Drosophila melanogaster GN=Ate1 PE=2 SV=3
Length = 484

Score = 73.9 bits (180), Expect = 7e-13
Identities = 40/110 (36%), Positives = 60/110 (54%), Gaps = 2/110 (1%)
Frame = +1

Query: 241 LTVVEDQGLYANPCGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGMVLYRPELE 420
L++V G + CGYC S +HG+ A+ L DYQ+L+D+ WRR G Y+ +
Sbjct: 3 LSIVSYYGSQQSKCGYCAGAN-CSLSHGMHAYQLDCRDYQDLIDRGWRRCGYYCYKLRNQ 61

Query: 421 RSCCPAYTIRLKAGCMEKSSEHVRAMRRMQRYL-DGV-YSSPSSGRKETE 564
+CCP YTI+ + S + R +RR+ R+L DG S P +G + E
Sbjct: 62 ETCCPCYTIKCNGLEFKLSKSNKRILRRINRFLRDGKRESKPEAGDGDGE 111


>sp|Q55EI0|ATE1_DICDI Arginyl-tRNA--protein transferase 1
OS=Dictyostelium discoideum GN=ate1 PE=3 SV=1
Length = 629

Score = 67.0 bits (162), Expect = 9e-11
Identities = 33/99 (33%), Positives = 53/99 (53%), Gaps = 4/99 (4%)
Frame = +1

Query: 235 SELTVVEDQGLYANPCGYCKSQGPTS--FAHGLWAHSLSPYDYQELLDQNWRRSGMVLYR 408
S +++ G Y + C YC + +G+ A L+ DYQ L+DQ WRRSG LY+
Sbjct: 11 STSSLIYPHGSYDSSCNYCDAGEDKKGRICYGMVADQLTCEDYQLLIDQGWRRSGTFLYK 70

Query: 409 PEL--ERSCCPAYTIRLKAGCMEKSSEHVRAMRRMQRYL 519
P +++CCP YTIRL + S ++ +++ Y+
Sbjct: 71 PNNSDKKTCCPQYTIRLDTSSFKPSKDNKSTIKKFNNYI 109


>sp|O14133|ATE1_SCHPO Arginyl-tRNA--protein transferase 1
OS=Schizosaccharomyces pombe GN=SPAC3C7.07c PE=2 SV=2
Length = 361

Score = 54.7 bits (130), Expect = 5e-07
Identities = 25/70 (35%), Positives = 39/70 (55%)
Frame = +1

Query: 355 YQELLDQNWRRSGMVLYRPELERSCCPAYTIRLKAGCMEKSSEHVRAMRRMQRYLDGVYS 534
Y L+D WRRSG LY+P + SCC YTIRL + + + E +A+++ +Y++G
Sbjct: 11 YNRLIDLGWRRSGHYLYKPNGKTSCCSLYTIRLDSYNFKIAKEQKKAIKKWVKYVNGKPL 70

Query: 535 SPSSGRKETE 564
P T+
Sbjct: 71 KPMKSEISTD 80


>sp|A1VN09|ATE_POLNA Putative arginyl-tRNA--protein transferase
OS=Polaromonas naphthalenivorans (strain CJ2) GN=ate
PE=3 SV=1
Length = 253

Score = 37.0 bits (84), Expect = 0.10
Identities = 24/81 (29%), Positives = 35/81 (43%)
Frame = +1

Query: 277 PCGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGMVLYRPELERSCCPAYTIRLK 456
PC Y + S +H + Y EL+ Q +RRSGM YRP + C +R+
Sbjct: 21 PCSYLPGRQARSQV-ATPSHLIHNNAYSELVTQGFRRSGMFTYRPYCD-GCQACVPLRVP 78

Query: 457 AGCMEKSSEHVRAMRRMQRYL 519
+ RA +R Q+ L
Sbjct: 79 VSTFQPDRSQRRAWKRHQKLL 99


>sp|Q7VTR8|ATE_BORPE Putative arginyl-tRNA--protein transferase
OS=Bordetella pertussis GN=ate PE=3 SV=1
Length = 244

Score = 37.0 bits (84), Expect = 0.10
Identities = 23/78 (29%), Positives = 36/78 (46%)
Frame = +1

Query: 277 PCGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGMVLYRPELERSCCPAYTIRLK 456
PC Y + S H ++ Y +L++Q +RRSG+ YRP + +C +R+
Sbjct: 24 PCSYLPGRQARSQVAAP-GHLINAGTYSQLVEQGFRRSGLFTYRPHCD-NCHACVPVRVD 81

Query: 457 AGCMEKSSEHVRAMRRMQ 510
A E + RA R Q
Sbjct: 82 AARFEPNRTQRRAWRSHQ 99


>sp|Q7W4W7|ATE_BORPA Putative arginyl-tRNA--protein transferase
OS=Bordetella parapertussis GN=ate PE=3 SV=1
Length = 244

Score = 37.0 bits (84), Expect = 0.10
Identities = 23/78 (29%), Positives = 36/78 (46%)
Frame = +1

Query: 277 PCGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGMVLYRPELERSCCPAYTIRLK 456
PC Y + S H ++ Y +L++Q +RRSG+ YRP + +C +R+
Sbjct: 24 PCSYLPGRQARSQVAAP-GHLINTGTYSQLVEQGFRRSGLFTYRPHCD-NCHACVPVRVD 81

Query: 457 AGCMEKSSEHVRAMRRMQ 510
A E + RA R Q
Sbjct: 82 AARFEPNRTQRRAWRSHQ 99


tr_hit_id A9TV97
Definition tr|A9TV97|A9TV97_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 125
Score (bit) 123.0
E-value 1.0e-26
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK961025|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0009_A01, 5'
(695 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TV97|A9TV97_PHYPA Predicted protein OS=Physcomitrella paten... 123 1e-26
tr|A7Q3F3|A7Q3F3_VITVI Chromosome chr13 scaffold_48, whole genom... 121 4e-26
tr|Q688J5|Q688J5_ORYSJ Os05g0446800 protein OS=Oryza sativa subs... 119 2e-25
tr|B8AYR5|B8AYR5_ORYSI Putative uncharacterized protein OS=Oryza... 119 2e-25
tr|Q9C776|Q9C776_ARATH Arginine-tRNA-protein transferase, putati... 112 2e-23
tr|Q682K5|Q682K5_ARATH Arginine-tRNA-protein transferase 1 homol... 108 3e-22
tr|Q67YK9|Q67YK9_ARATH Arginine-tRNA-protein transferase 1 homol... 108 3e-22
tr|Q56ZQ7|Q56ZQ7_ARATH At5g05700 OS=Arabidopsis thaliana GN=At5g... 108 3e-22
tr|Q6INP2|Q6INP2_XENLA MGC81517 protein OS=Xenopus laevis GN=MGC... 98 4e-19
tr|B3S882|B3S882_TRIAD Putative uncharacterized protein OS=Trich... 95 5e-18
tr|Q178G8|Q178G8_AEDAE Arginyltransferase, putative OS=Aedes aeg... 92 4e-17
tr|Q178G7|Q178G7_AEDAE Arginyltransferase, putative OS=Aedes aeg... 92 4e-17
tr|Q178G6|Q178G6_AEDAE Arginyltransferase, putative OS=Aedes aeg... 92 4e-17
tr|B0XEM1|B0XEM1_CULQU Arginyl-tRNA-protein transferase 1 OS=Cul... 91 5e-17
tr|Q4P2B7|Q4P2B7_USTMA Putative uncharacterized protein OS=Ustil... 91 7e-17
tr|Q5F446|Q5F446_CHICK Putative uncharacterized protein OS=Gallu... 90 2e-16
tr|A5PKR5|A5PKR5_XENLA LOC100101312 protein OS=Xenopus laevis GN... 89 2e-16
tr|Q4FCQ7|Q4FCQ7_MOUSE Arginine tRNA protein transferase OS=Mus ... 89 2e-16
tr|Q4FCQ6|Q4FCQ6_MOUSE Arginine tRNA protein transferase OS=Mus ... 89 2e-16
tr|Q3UUL7|Q3UUL7_MOUSE Putative uncharacterized protein (Fragmen... 89 2e-16
tr|Q5RB46|Q5RB46_PONAB Putative uncharacterized protein DKFZp469... 89 3e-16
tr|Q5SQQ2|Q5SQQ2_HUMAN Arginyltransferase 1 (Fragment) OS=Homo s... 89 3e-16
tr|Q5SQQ1|Q5SQQ1_HUMAN Arginyltransferase 1 (Fragment) OS=Homo s... 89 3e-16
tr|B4DR48|B4DR48_HUMAN cDNA FLJ56138, highly similar to Homo sap... 89 3e-16
tr|Q4S2G1|Q4S2G1_TETNG Chromosome 17 SCAF14762, whole genome sho... 88 5e-16
tr|Q7QDR4|Q7QDR4_ANOGA AGAP010373-PA OS=Anopheles gambiae GN=AGA... 88 6e-16
tr|A4IFW7|A4IFW7_DANRE Zgc:158849 protein OS=Danio rerio GN=zgc:... 86 2e-15
tr|Q8CFP7|Q8CFP7_MOUSE Arginyltransferase 1 OS=Mus musculus GN=A... 86 2e-15
tr|Q80YP1|Q80YP1_MOUSE Ate1 protein OS=Mus musculus GN=Ate1 PE=2... 86 2e-15
tr|B6P9B9|B6P9B9_BRAFL Putative uncharacterized protein OS=Branc... 86 3e-15

>tr|A9TV97|A9TV97_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_198612 PE=4 SV=1
Length = 660

Score = 123 bits (309), Expect = 1e-26
Identities = 56/125 (44%), Positives = 82/125 (65%)
Frame = +1

Query: 241 LTVVEDQGLYANPCGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGMVLYRPELE 420
+++VEDQG+Y++ CGYCKS +S + G+WAH+L+ DYQELL++ WRRSG LY+P +
Sbjct: 1 MSIVEDQGVYSSSCGYCKSSSRSSVSQGMWAHTLTVDDYQELLNRGWRRSGKFLYKPSMH 60

Query: 421 RSCCPAYTIRLKAGCMEKSSEHVRAMRRMQRYLDGVYSSPSSGRKETELAEEVMDIDVKP 600
R+CCP ++IRL A S + R MRRMQRYL+G Y G + +E ++ +
Sbjct: 61 RTCCPPHSIRLDANAFIISKDQARVMRRMQRYLEGSY----HGTRPSEYSDVGQSNSAEA 116

Query: 601 HYERL 615
H + L
Sbjct: 117 HCKEL 121


>tr|A7Q3F3|A7Q3F3_VITVI Chromosome chr13 scaffold_48, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00029267001
PE=4 SV=1
Length = 540

Score = 121 bits (304), Expect = 4e-26
Identities = 67/151 (44%), Positives = 90/151 (59%), Gaps = 13/151 (8%)
Frame = +1

Query: 244 TVVEDQGLYANPCGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGMVLYRPELER 423
+VV D G + CGYC+S TS +HGLWAHS++ DYQ+LLD+ WRRSG LY+PE+ER
Sbjct: 24 SVVVDVGRRRSTCGYCRSGARTSISHGLWAHSITVDDYQDLLDRGWRRSGSFLYKPEMER 83

Query: 424 SCCPAYTIRLKAGCMEKSSEHVRAMRRMQRYLDGVYS-----SPSSGRKETELA------ 570
+CCP+YTIRL+A S E +R +RMQR+ DG S + G K ++ A
Sbjct: 84 TCCPSYTIRLRADDFVPSKEQLRVSKRMQRFQDGTLSVKKQDKINDGPKTSKTAKGTLAG 143

Query: 571 --EEVMDIDVKPHYERLNTNIDINLATHCTK 657
EE ++ HY L+ ID N CT+
Sbjct: 144 KDEEKNKVEAFMHY--LSDQID-NAVCACTE 171


>tr|Q688J5|Q688J5_ORYSJ Os05g0446800 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0012G21.2 PE=2 SV=1
Length = 644

Score = 119 bits (298), Expect = 2e-25
Identities = 55/94 (58%), Positives = 67/94 (71%)
Frame = +1

Query: 244 TVVEDQGLYANPCGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGMVLYRPELER 423
+VV D G CGYC+S G TS +HGLWA+SL DYQ LLD+ WRRSG LY+PE+ER
Sbjct: 24 SVVIDYGRRRTACGYCRSTGQTSISHGLWANSLRADDYQALLDRGWRRSGCFLYKPEMER 83

Query: 424 SCCPAYTIRLKAGCMEKSSEHVRAMRRMQRYLDG 525
+CCP YTIRLKA S E R +++MQR+LDG
Sbjct: 84 TCCPQYTIRLKANDFICSKEQGRVLKKMQRFLDG 117


>tr|B8AYR5|B8AYR5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_20147 PE=4 SV=1
Length = 644

Score = 119 bits (298), Expect = 2e-25
Identities = 55/94 (58%), Positives = 67/94 (71%)
Frame = +1

Query: 244 TVVEDQGLYANPCGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGMVLYRPELER 423
+VV D G CGYC+S G TS +HGLWA+SL DYQ LLD+ WRRSG LY+PE+ER
Sbjct: 24 SVVIDYGRRRTACGYCRSTGQTSISHGLWANSLRADDYQALLDRGWRRSGCFLYKPEMER 83

Query: 424 SCCPAYTIRLKAGCMEKSSEHVRAMRRMQRYLDG 525
+CCP YTIRLKA S E R +++MQR+LDG
Sbjct: 84 TCCPQYTIRLKANDFICSKEQGRVLKKMQRFLDG 117


>tr|Q9C776|Q9C776_ARATH Arginine-tRNA-protein transferase, putative;
58258-55831 (Putative arginine-tRNA-protein transferase)
OS=Arabidopsis thaliana GN=At3g11240 PE=2 SV=1
Length = 605

Score = 112 bits (280), Expect = 2e-23
Identities = 52/107 (48%), Positives = 68/107 (63%)
Frame = +1

Query: 244 TVVEDQGLYANPCGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGMVLYRPELER 423
++V D G + CGYCKS S +HGLW L+ DYQ LLD WRRSG LY+PE+E+
Sbjct: 23 SIVADCGRNKSTCGYCKSSTRFSISHGLWTERLTVNDYQALLDSGWRRSGCYLYKPEMEK 82

Query: 424 SCCPAYTIRLKAGCMEKSSEHVRAMRRMQRYLDGVYSSPSSGRKETE 564
+CCP+YTIRLKA S E R RR++R+LDG + S + E +
Sbjct: 83 TCCPSYTIRLKASDFVPSKEQQRVRRRIERFLDGELDAKPSEQTEDQ 129


>tr|Q682K5|Q682K5_ARATH Arginine-tRNA-protein transferase 1 homolog
OS=Arabidopsis thaliana GN=At5g05700 PE=2 SV=1
Length = 632

Score = 108 bits (270), Expect = 3e-22
Identities = 47/94 (50%), Positives = 66/94 (70%)
Frame = +1

Query: 244 TVVEDQGLYANPCGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGMVLYRPELER 423
+V++D G + CGYCKS +S +HGL A +L+ YDYQ L+D+ WRRSG LY+ E+++
Sbjct: 19 SVIDDHGRRKSTCGYCKSPARSSISHGLSAQTLTVYDYQALIDRGWRRSGTYLYKHEMDK 78

Query: 424 SCCPAYTIRLKAGCMEKSSEHVRAMRRMQRYLDG 525
+CCP YTIRLKA + E R RR++R+LDG
Sbjct: 79 TCCPPYTIRLKASDFVPTKEQQRVSRRLERFLDG 112


>tr|Q67YK9|Q67YK9_ARATH Arginine-tRNA-protein transferase 1 homolog
OS=Arabidopsis thaliana GN=At5g05700 PE=2 SV=1
Length = 632

Score = 108 bits (270), Expect = 3e-22
Identities = 47/94 (50%), Positives = 66/94 (70%)
Frame = +1

Query: 244 TVVEDQGLYANPCGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGMVLYRPELER 423
+V++D G + CGYCKS +S +HGL A +L+ YDYQ L+D+ WRRSG LY+ E+++
Sbjct: 19 SVIDDHGRRKSTCGYCKSPARSSISHGLSAQTLTVYDYQALIDRGWRRSGTYLYKHEMDK 78

Query: 424 SCCPAYTIRLKAGCMEKSSEHVRAMRRMQRYLDG 525
+CCP YTIRLKA + E R RR++R+LDG
Sbjct: 79 TCCPPYTIRLKASDFVPTKEQQRVSRRLERFLDG 112


>tr|Q56ZQ7|Q56ZQ7_ARATH At5g05700 OS=Arabidopsis thaliana
GN=At5g05700 PE=2 SV=1
Length = 632

Score = 108 bits (270), Expect = 3e-22
Identities = 47/94 (50%), Positives = 66/94 (70%)
Frame = +1

Query: 244 TVVEDQGLYANPCGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGMVLYRPELER 423
+V++D G + CGYCKS +S +HGL A +L+ YDYQ L+D+ WRRSG LY+ E+++
Sbjct: 19 SVIDDHGRRKSTCGYCKSPARSSISHGLSAQTLTVYDYQALIDRGWRRSGTYLYKHEMDK 78

Query: 424 SCCPAYTIRLKAGCMEKSSEHVRAMRRMQRYLDG 525
+CCP YTIRLKA + E R RR++R+LDG
Sbjct: 79 TCCPPYTIRLKASDFVPTKEQQRVSRRLERFLDG 112


>tr|Q6INP2|Q6INP2_XENLA MGC81517 protein OS=Xenopus laevis
GN=MGC81517 PE=2 SV=1
Length = 499

Score = 98.2 bits (243), Expect = 4e-19
Identities = 43/104 (41%), Positives = 69/104 (66%)
Frame = +1

Query: 274 NPCGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGMVLYRPELERSCCPAYTIRL 453
N CGYCKS+ +S +HG+WAH+L+ DYQ+L+D+ WRRSG +Y+P + ++CCP YTIRL
Sbjct: 21 NRCGYCKSEA-SSMSHGMWAHTLTVQDYQDLIDRGWRRSGKYVYKPLMNQTCCPQYTIRL 79

Query: 454 KAGCMEKSSEHVRAMRRMQRYLDGVYSSPSSGRKETELAEEVMD 585
A + + H + ++++ +YL ++ S K+ + E MD
Sbjct: 80 SASNFQPTKSHKKVLKKVLKYL---HAGEVSHSKDEGTSGEPMD 120


>tr|B3S882|B3S882_TRIAD Putative uncharacterized protein
OS=Trichoplax adhaerens GN=TRIADDRAFT_60443 PE=4 SV=1
Length = 481

Score = 94.7 bits (234), Expect = 5e-18
Identities = 48/138 (34%), Positives = 73/138 (52%)
Frame = +1

Query: 217 LTAMERSELTVVEDQGLYANPCGYCKSQGPTSFAHGLWAHSLSPYDYQELLDQNWRRSGM 396
+ +M S + Q + CGYC G + A G+W H L DYQ L+D+ WRR G
Sbjct: 1 MISMRTSSVVGYVPQSSEPHHCGYCGKNG-SRHAAGIWGHRLRVSDYQILMDRGWRRCGK 59

Query: 397 VLYRPELERSCCPAYTIRLKAGCMEKSSEHVRAMRRMQRYLDGVYSSPSSGRKETELAEE 576
+Y+P+L++SCCP YTIR++A S H + ++++ YL G + RK E +
Sbjct: 60 FIYKPDLQKSCCPLYTIRIEALECVISKSHRKVIKKVMNYLQGNTTLEELKRKHEE-GND 118

Query: 577 VMDIDVKPHYERLNTNID 630
ID K H + + +ID
Sbjct: 119 TQQIDTKSHNDNVKKSID 136