DK961030
Clone id TST39A01NGRL0009_A06
Library
Length 625
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0009_A06. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID
Sequence
CTTGACGAGCGAGTGAGCGAGCAAGCAAGCAAGCAGCATGGCGAGTTTCATGTGTAGAGG
CGCAGCTGTTGCTTCCATCACCCACCCCGATGCTGTCGACGTGTCTACCATCGCCAACCC
CCTCCTGCGCAACGCCGCCACGATGAAATCGACGATAGTGCGGAATCACGCCGCCAGCGG
CGATCTGAGATCGGGGTGGCGCCCCTCTTTCAGGGCACAGGCAGCTCCCGCCGCCGCCGC
TGAAGTCGCACCCAAACCCACCCTCACGCCAGGCTACTCTTCCTGGCGCAGCGTTCCTAC
GCATCGCTGGGAAGGTGAGCCTGCTGTCCAAGGCGTCATCCCCTACTGGCTCGATGGAGC
CTACCTTAGAAATGGGCCTGGGCAATTCCATGTTGGTGATCATGAGTTCAAGCATCTGTT
TGATGGGTATGCCACGCTTGTGCGCTTGCACTTTCAGAAGGGAAAGTTAAAGGTGACTCA
TGCACAACTTCAATCACAAGCATATACCAATGCCATGAAGCTTGGAAAGCCATTCTTTAG
AGAATTTGCAGAAGCACCCAAGAAAGAAAACTTGCTCTCATATTTTGGAGATTTGGCGGG
CATGGCTTTCGGGACTACCTTGACT
■■Homology search results ■■ -
sp_hit_id Q8VY26
Definition sp|Q8VY26|CCD8_ARATH Carotenoid cleavage dioxygenase 8, chloroplastic OS=Arabidopsis thaliana
Align length 119
Score (bit) 120.0
E-value 7.0e-27
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK961030|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0009_A06, 5'
(598 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8VY26|CCD8_ARATH Carotenoid cleavage dioxygenase 8, chloropl... 120 7e-27
sp|O70276|RPE65_RAT Retinal pigment epithelium-specific 65 kDa p... 60 8e-09
sp|Q91ZQ5|RPE65_MOUSE Retinal pigment epithelium-specific 65 kDa... 60 8e-09
sp|Q16518|RPE65_HUMAN Retinal pigment epithelium-specific 65 kDa... 60 8e-09
sp|Q9XT71|RPE65_CERAE Retinal pigment epithelium-specific 65 kDa... 60 8e-09
sp|Q9TVB8|RPE65_CANFA Retinal pigment epithelium-specific 65 kDa... 60 8e-09
sp|Q28175|RPE65_BOVIN Retinal pigment epithelium-specific 65 kDa... 60 8e-09
sp|Q8AXN9|RPE65_CYNPY Retinal pigment epithelium-specific 65 kDa... 60 1e-08
sp|Q9YI25|RPE65_AMBTI Retinal pigment epithelium-specific 65 kDa... 59 2e-08
sp|Q9YGX2|RPE65_CHICK Retinal pigment epithelium-specific 65 kDa... 58 3e-08
sp|Q9I993|BCDO1_CHICK Beta,beta-carotene 15,15'-monooxygenase OS... 58 3e-08
sp|Q91XT5|BCDO1_RAT Beta,beta-carotene 15,15'-monooxygenase OS=R... 57 9e-08
sp|Q5RF16|BCDO2_PONAB Beta,beta-carotene 9',10'-oxygenase OS=Pon... 55 2e-07
sp|Q9JJS6|BCDO1_MOUSE Beta,beta-carotene 15,15'-monooxygenase OS... 55 4e-07
sp|Q9HAY6|BCDO1_HUMAN Beta,beta-carotene 15,15'-monooxygenase OS... 54 6e-07
sp|Q99NF1|BCDO2_MOUSE Beta,beta-carotene 9',10'-oxygenase OS=Mus... 54 8e-07
sp|Q8HXG8|BCDO2_MACFA Beta,beta-carotene 9',10'-oxygenase OS=Mac... 53 1e-06
sp|Q9BYV7|BCDO2_HUMAN Beta,beta-carotene 9',10'-oxygenase OS=Hom... 53 1e-06
sp|Q9M6E8|NCED1_PHAVU 9-cis-epoxycarotenoid dioxygenase NCED1, c... 40 0.009
sp|O49675|CCD4_ARATH Probable carotenoid cleavage dioxygenase 4,... 39 0.015
sp|Q9C6Z1|NCED5_ARATH Probable 9-cis-epoxycarotenoid dioxygenase... 38 0.045
sp|Q9M9F5|NCED9_ARATH 9-cis-epoxycarotenoid dioxygenase NCED9, c... 37 0.058
sp|Q9LRR7|NCED3_ARATH 9-cis-epoxycarotenoid dioxygenase NCED3, c... 36 0.13
sp|O49505|NCED2_ARATH 9-cis-epoxycarotenoid dioxygenase NCED2, c... 35 0.22
sp|O24592|NCED1_MAIZE 9-cis-epoxycarotenoid dioxygenase 1, chlor... 32 3.2
sp|Q2H7G2|KYNU2_CHAGB Kynureninase 2 OS=Chaetomium globosum GN=B... 32 3.2
sp|Q5NVT2|ZN770_PONAB Zinc finger protein 770 (Fragment) OS=Pong... 30 9.3
sp|Q6IQ21|ZN770_HUMAN Zinc finger protein 770 OS=Homo sapiens GN... 30 9.3

>sp|Q8VY26|CCD8_ARATH Carotenoid cleavage dioxygenase 8,
chloroplastic OS=Arabidopsis thaliana GN=CCD8 PE=2 SV=1
Length = 570

Score = 120 bits (300), Expect = 7e-27
Identities = 57/119 (47%), Positives = 77/119 (64%), Gaps = 4/119 (3%)
Frame = +2

Query: 254 SWRSVPTHRWEGEPAVQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQK 433
+W SV WEGE VQG IP WL+G YLRNGPG +++GDH+F+HLFDGY+TLV+L F
Sbjct: 82 AWTSVQQENWEGELTVQGKIPTWLNGTYLRNGPGLWNIGDHDFRHLFDGYSTLVKLQFDG 141

Query: 434 GKLKVTHAQLQSQAYTNAMKLGKPFFREFAEAPK----KENLLSYFGDLAGMAFGTTLT 598
G++ H L+S AY A K + +REF+E PK +N S G++ + G +LT
Sbjct: 142 GRIFAAHRLLESDAYKAAKKHNRLCYREFSETPKSVIINKNPFSGIGEIVRLFSGESLT 200


>sp|O70276|RPE65_RAT Retinal pigment epithelium-specific 65 kDa
protein OS=Rattus norvegicus GN=Rpe65 PE=2 SV=3
Length = 533

Score = 60.1 bits (144), Expect = 8e-09
Identities = 31/74 (41%), Positives = 40/74 (54%)
Frame = +2

Query: 299 VQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQKGKLKVTHAQLQSQAY 478
V G IP WL G+ LR GPG F VG F HLFDG A L + F++G + +++ AY
Sbjct: 30 VTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLFDGQALLHKFDFKEGHVTYYRRFIRTDAY 89

Query: 479 TNAMKLGKPFFREF 520
AM + EF
Sbjct: 90 VRAMTEKRIVITEF 103


>sp|Q91ZQ5|RPE65_MOUSE Retinal pigment epithelium-specific 65 kDa
protein OS=Mus musculus GN=Rpe65 PE=1 SV=3
Length = 533

Score = 60.1 bits (144), Expect = 8e-09
Identities = 31/74 (41%), Positives = 40/74 (54%)
Frame = +2

Query: 299 VQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQKGKLKVTHAQLQSQAY 478
V G IP WL G+ LR GPG F VG F HLFDG A L + F++G + +++ AY
Sbjct: 30 VTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLFDGQALLHKFDFKEGHVTYHRRFIRTDAY 89

Query: 479 TNAMKLGKPFFREF 520
AM + EF
Sbjct: 90 VRAMTEKRIVITEF 103


>sp|Q16518|RPE65_HUMAN Retinal pigment epithelium-specific 65 kDa
protein OS=Homo sapiens GN=RPE65 PE=1 SV=3
Length = 533

Score = 60.1 bits (144), Expect = 8e-09
Identities = 31/74 (41%), Positives = 40/74 (54%)
Frame = +2

Query: 299 VQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQKGKLKVTHAQLQSQAY 478
V G IP WL G+ LR GPG F VG F HLFDG A L + F++G + +++ AY
Sbjct: 30 VTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLFDGQALLHKFDFKEGHVTYHRRFIRTDAY 89

Query: 479 TNAMKLGKPFFREF 520
AM + EF
Sbjct: 90 VRAMTEKRIVITEF 103


>sp|Q9XT71|RPE65_CERAE Retinal pigment epithelium-specific 65 kDa
protein OS=Cercopithecus aethiops GN=RPE65 PE=2 SV=3
Length = 533

Score = 60.1 bits (144), Expect = 8e-09
Identities = 31/74 (41%), Positives = 40/74 (54%)
Frame = +2

Query: 299 VQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQKGKLKVTHAQLQSQAY 478
V G IP WL G+ LR GPG F VG F HLFDG A L + F++G + +++ AY
Sbjct: 30 VTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLFDGQALLHKFDFKEGHVTYHRRFIRTDAY 89

Query: 479 TNAMKLGKPFFREF 520
AM + EF
Sbjct: 90 VRAMTEKRIVITEF 103


>sp|Q9TVB8|RPE65_CANFA Retinal pigment epithelium-specific 65 kDa
protein OS=Canis familiaris GN=RPE65 PE=2 SV=3
Length = 533

Score = 60.1 bits (144), Expect = 8e-09
Identities = 31/74 (41%), Positives = 40/74 (54%)
Frame = +2

Query: 299 VQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQKGKLKVTHAQLQSQAY 478
V G IP WL G+ LR GPG F VG F HLFDG A L + F++G + +++ AY
Sbjct: 30 VTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLFDGQALLHKFDFKEGHVTYHRRFIRTDAY 89

Query: 479 TNAMKLGKPFFREF 520
AM + EF
Sbjct: 90 VRAMTEKRIVITEF 103


>sp|Q28175|RPE65_BOVIN Retinal pigment epithelium-specific 65 kDa
protein OS=Bos taurus GN=RPE65 PE=1 SV=3
Length = 533

Score = 60.1 bits (144), Expect = 8e-09
Identities = 31/74 (41%), Positives = 40/74 (54%)
Frame = +2

Query: 299 VQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQKGKLKVTHAQLQSQAY 478
V G IP WL G+ LR GPG F VG F HLFDG A L + F++G + +++ AY
Sbjct: 30 VTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLFDGQALLHKFDFKEGHVTYHRRFIRTDAY 89

Query: 479 TNAMKLGKPFFREF 520
AM + EF
Sbjct: 90 VRAMTEKRIVITEF 103


>sp|Q8AXN9|RPE65_CYNPY Retinal pigment epithelium-specific 65 kDa
protein OS=Cynops pyrrhogaster GN=RPE65 PE=2 SV=3
Length = 533

Score = 59.7 bits (143), Expect = 1e-08
Identities = 30/74 (40%), Positives = 40/74 (54%)
Frame = +2

Query: 299 VQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQKGKLKVTHAQLQSQAY 478
V G IP WL G+ LR GPG F VG +F HLFDG A L + F++G + +++ Y
Sbjct: 30 VTGRIPVWLTGSLLRCGPGLFEVGSEQFYHLFDGQALLHKFDFKEGHVTYHRRFIRTDTY 89

Query: 479 TNAMKLGKPFFREF 520
AM + EF
Sbjct: 90 VRAMTEKRIVITEF 103


>sp|Q9YI25|RPE65_AMBTI Retinal pigment epithelium-specific 65 kDa
protein OS=Ambystoma tigrinum GN=RPE65 PE=2 SV=3
Length = 533

Score = 58.5 bits (140), Expect = 2e-08
Identities = 30/74 (40%), Positives = 39/74 (52%)
Frame = +2

Query: 299 VQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQKGKLKVTHAQLQSQAY 478
V G IP WL G+ LR GPG F VG +F HLFDG A L + F+ G + +++ Y
Sbjct: 30 VTGRIPVWLSGSLLRCGPGLFEVGSEQFYHLFDGQALLHKFEFKGGHVIYHRRFIRTDTY 89

Query: 479 TNAMKLGKPFFREF 520
AM + EF
Sbjct: 90 VRAMTEKRIVITEF 103


>sp|Q9YGX2|RPE65_CHICK Retinal pigment epithelium-specific 65 kDa
protein OS=Gallus gallus GN=RPE65 PE=2 SV=1
Length = 533

Score = 58.2 bits (139), Expect = 3e-08
Identities = 31/74 (41%), Positives = 40/74 (54%)
Frame = +2

Query: 299 VQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQKGKLKVTHAQLQSQAY 478
V G IP WL G+ LR GPG F VG F HLFDG A L + F++G + +++ AY
Sbjct: 30 VTGRIPTWLRGSLLRCGPGLFEVGAEPFYHLFDGQALLHKFDFKEGHVTYHRRFVRTDAY 89

Query: 479 TNAMKLGKPFFREF 520
AM + EF
Sbjct: 90 VRAMTEKRIVITEF 103


tr_hit_id A7P572
Definition tr|A7P572|A7P572_VITVI Chromosome chr4 scaffold_6, whole genome shotgun sequence OS=Vitis vinifera
Align length 116
Score (bit) 151.0
E-value 3.0e-35
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK961030|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0009_A06, 5'
(598 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7P572|A7P572_VITVI Chromosome chr4 scaffold_6, whole genome ... 151 3e-35
tr|Q5C8T4|Q5C8T4_PETHY Decreased apical dominance protein OS=Pet... 149 1e-34
tr|Q5IFI1|Q5IFI1_PETHY Dad1/CCD8 OS=Petunia hybrida PE=2 SV=1 147 6e-34
tr|Q6Q623|Q6Q623_PEA Dioxygenase RAMOSUS1 OS=Pisum sativum GN=RM... 145 2e-33
tr|A9RKQ2|A9RKQ2_PHYPA Predicted protein OS=Physcomitrella paten... 144 3e-33
tr|Q1EP33|Q1EP33_MUSBA Dioxygenase-related protein OS=Musa balbi... 137 6e-31
tr|Q8LIY8|Q8LIY8_ORYSJ Putative dioxygenase OS=Oryza sativa subs... 132 1e-29
tr|Q0JJD5|Q0JJD5_ORYSJ Os01g0746400 protein OS=Oryza sativa subs... 132 1e-29
tr|A2ZXS1|A2ZXS1_ORYSJ Putative uncharacterized protein OS=Oryza... 132 1e-29
tr|A2WV02|A2WV02_ORYSI Putative uncharacterized protein OS=Oryza... 132 1e-29
tr|B8AAB5|B8AAB5_ORYSI Putative uncharacterized protein OS=Oryza... 120 6e-26
tr|Q93VD5|Q93VD5_ORYSJ cDNA clone:001-016-B12, full insert seque... 117 7e-25
tr|B8AAB4|B8AAB4_ORYSI Putative uncharacterized protein OS=Oryza... 117 7e-25
tr|A2WRI7|A2WRI7_ORYSI Putative uncharacterized protein OS=Oryza... 117 7e-25
tr|B6J721|B6J721_COXB1 Lignostilbene-alpha,beta-dioxygenase OS=C... 71 5e-11
tr|A9KG67|A9KG67_COXBN Lignostilbene-alpha,beta-dioxygenase OS=C... 71 5e-11
tr|A9ZHF7|A9ZHF7_COXBU Putative dioxygenase OS=Coxiella burnetii... 71 5e-11
tr|Q9U2E4|Q9U2E4_CAEEL Protein Y46G5A.24, partially confirmed by... 67 8e-10
tr|Q2S6A1|Q2S6A1_SALRD 15,15' beta carotene dioxygenase OS=Salin... 66 1e-09
tr|Q4T643|Q4T643_TETNG Chromosome 12 SCAF8937, whole genome shot... 66 2e-09
tr|Q7Q411|Q7Q411_ANOGA AGAP008143-PA OS=Anopheles gambiae GN=AGA... 64 7e-09
tr|A8XTA1|A8XTA1_CAEBR Putative uncharacterized protein OS=Caeno... 64 7e-09
tr|Q18IM2|Q18IM2_HALWD Beta,beta-carotene 9',10'-dioxygenase 2 O... 64 7e-09
tr|B6MW10|B6MW10_BRAFL Putative uncharacterized protein OS=Branc... 63 1e-08
tr|B6M3X9|B6M3X9_BRAFL Putative uncharacterized protein OS=Branc... 63 1e-08
tr|A5YSU6|A5YSU6_9EURY Beta,beta-carotene 9',10'-dioxygenase 2 O... 63 1e-08
tr|Q90WH3|Q90WH3_DANRE Putative b,b-carotene-9',10'-dioxygenase ... 63 1e-08
tr|Q1RLW1|Q1RLW1_DANRE Beta-carotene oxygenase 2a OS=Danio rerio... 62 2e-08
tr|A4QN78|A4QN78_DANRE Bcdo2l protein OS=Danio rerio GN=bcdo2l P... 62 2e-08
tr|Q2PE71|Q2PE71_CIOIN RPE65 homolog OS=Ciona intestinalis GN=Ci... 62 2e-08

>tr|A7P572|A7P572_VITVI Chromosome chr4 scaffold_6, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00032423001
PE=4 SV=1
Length = 563

Score = 151 bits (381), Expect = 3e-35
Identities = 69/116 (59%), Positives = 87/116 (75%)
Frame = +2

Query: 251 SSWRSVPTHRWEGEPAVQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQ 430
++W S+ RWEGE AVQG IP WL+G YLRNGPG +H+GD+ F+HLFDGYATLVRLHFQ
Sbjct: 81 AAWTSIRQERWEGELAVQGEIPLWLNGTYLRNGPGLWHIGDYNFRHLFDGYATLVRLHFQ 140

Query: 431 KGKLKVTHAQLQSQAYTNAMKLGKPFFREFAEAPKKENLLSYFGDLAGMAFGTTLT 598
G+L H Q+QS+AY A+K K +REF+E PK +N LSY G+LA + G +LT
Sbjct: 141 DGRLIAGHRQIQSEAYKAAIKNKKLCYREFSEVPKADNFLSYVGELASLFSGASLT 196


>tr|Q5C8T4|Q5C8T4_PETHY Decreased apical dominance protein
OS=Petunia hybrida GN=Dad1 PE=4 SV=1
Length = 556

Score = 149 bits (376), Expect = 1e-34
Identities = 68/116 (58%), Positives = 85/116 (73%)
Frame = +2

Query: 251 SSWRSVPTHRWEGEPAVQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQ 430
++W SV RWEGE V+G +P WL G YLRNGPG +HVGD+ F+HLFDGYATL+RLHF+
Sbjct: 74 AAWTSVCQERWEGELVVEGELPLWLSGTYLRNGPGLWHVGDYNFRHLFDGYATLIRLHFE 133

Query: 431 KGKLKVTHAQLQSQAYTNAMKLGKPFFREFAEAPKKENLLSYFGDLAGMAFGTTLT 598
G+L + H QL+S AY A K K +REF+EAPK EN LSY GD+A + G +LT
Sbjct: 134 NGRLIMGHRQLESDAYKAAKKNNKVCYREFSEAPKPENFLSYIGDMAKLFSGASLT 189


>tr|Q5IFI1|Q5IFI1_PETHY Dad1/CCD8 OS=Petunia hybrida PE=2 SV=1
Length = 556

Score = 147 bits (370), Expect = 6e-34
Identities = 67/116 (57%), Positives = 84/116 (72%)
Frame = +2

Query: 251 SSWRSVPTHRWEGEPAVQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQ 430
++W SV RWEGE V+G +P WL G YLRNGPG +HVGD+ +HLFDGYATL+RLHF+
Sbjct: 74 AAWTSVCQERWEGELVVEGELPLWLSGTYLRNGPGLWHVGDYNLRHLFDGYATLIRLHFE 133

Query: 431 KGKLKVTHAQLQSQAYTNAMKLGKPFFREFAEAPKKENLLSYFGDLAGMAFGTTLT 598
G+L + H QL+S AY A K K +REF+EAPK EN LSY GD+A + G +LT
Sbjct: 134 NGRLIMGHRQLESDAYKAAKKNNKVCYREFSEAPKPENFLSYIGDMAKLFSGASLT 189


>tr|Q6Q623|Q6Q623_PEA Dioxygenase RAMOSUS1 OS=Pisum sativum GN=RMS1
PE=4 SV=1
Length = 561

Score = 145 bits (365), Expect = 2e-33
Identities = 66/115 (57%), Positives = 84/115 (73%)
Frame = +2

Query: 254 SWRSVPTHRWEGEPAVQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQK 433
+W SVP RWEGE VQG IP WL G Y+RNGPG +++GD+ F+HLFDGYATLV LHF+
Sbjct: 80 AWTSVPQERWEGELLVQGHIPLWLKGTYIRNGPGMWNIGDYNFRHLFDGYATLVGLHFED 139

Query: 434 GKLKVTHAQLQSQAYTNAMKLGKPFFREFAEAPKKENLLSYFGDLAGMAFGTTLT 598
G+L H Q++SQAY A K K +REF+E PK EN L+Y G+LA + G++LT
Sbjct: 140 GQLTAGHRQIESQAYQAAKKNQKICYREFSEVPKAENFLAYVGELASLFSGSSLT 194


>tr|A9RKQ2|A9RKQ2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_115616 PE=4 SV=1
Length = 523

Score = 144 bits (364), Expect = 3e-33
Identities = 67/119 (56%), Positives = 81/119 (68%)
Frame = +2

Query: 242 PGYSSWRSVPTHRWEGEPAVQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRL 421
PG ++W++V W+GE VQG IP WLDG YLRNGPG F G EF HLFDGY+TL+RL
Sbjct: 35 PGSNAWQTVKQDEWQGEMEVQGEIPSWLDGTYLRNGPGYFEAGGKEFPHLFDGYSTLIRL 94

Query: 422 HFQKGKLKVTHAQLQSQAYTNAMKLGKPFFREFAEAPKKENLLSYFGDLAGMAFGTTLT 598
+F KL HAQLQS+AY GK FREFA PK N+ + G++AG+A GTTLT
Sbjct: 95 NFNNSKLIAHHAQLQSEAYKAVKSSGKVSFREFAVTPKHNNVFEWMGEVAGIAMGTTLT 153


>tr|Q1EP33|Q1EP33_MUSBA Dioxygenase-related protein OS=Musa
balbisiana GN=MBP_91N22.40 PE=4 SV=1
Length = 566

Score = 137 bits (344), Expect = 6e-31
Identities = 58/116 (50%), Positives = 87/116 (75%)
Frame = +2

Query: 251 SSWRSVPTHRWEGEPAVQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQ 430
++W S+ RWEG+ V+G +P WL+G YLRNGPG +H+ D+ F+HLFDGYATLVR++F+
Sbjct: 84 AAWTSIRQERWEGKLVVEGDVPRWLNGTYLRNGPGLWHIDDYNFRHLFDGYATLVRVYFE 143

Query: 431 KGKLKVTHAQLQSQAYTNAMKLGKPFFREFAEAPKKENLLSYFGDLAGMAFGTTLT 598
+G++ +H Q++S+AY AMK + +REF+EAPK N L+Y G++A + G +LT
Sbjct: 144 QGRVMASHRQVESEAYKAAMKNRRLCYREFSEAPKPANFLAYVGEVASLFSGASLT 199


>tr|Q8LIY8|Q8LIY8_ORYSJ Putative dioxygenase OS=Oryza sativa subsp.
japonica GN=OSJNBa0014K08.38 PE=4 SV=1
Length = 569

Score = 132 bits (333), Expect = 1e-29
Identities = 61/115 (53%), Positives = 81/115 (70%)
Frame = +2

Query: 254 SWRSVPTHRWEGEPAVQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQK 433
+W+SV RWEG V G +P WLDG YLRNGPG +++GD+ F+HLFDGYATLVR+ F+
Sbjct: 84 AWKSVRQERWEGALEVDGELPLWLDGTYLRNGPGLWNLGDYGFRHLFDGYATLVRVSFRG 143

Query: 434 GKLKVTHAQLQSQAYTNAMKLGKPFFREFAEAPKKENLLSYFGDLAGMAFGTTLT 598
G+ H Q++S+AY A GK +REF+E PK +N LSY G LA + G++LT
Sbjct: 144 GRAVGAHRQIESEAYKAARAHGKVCYREFSEVPKPDNFLSYVGQLATLFSGSSLT 198


>tr|Q0JJD5|Q0JJD5_ORYSJ Os01g0746400 protein OS=Oryza sativa subsp.
japonica GN=Os01g0746400 PE=4 SV=1
Length = 1322

Score = 132 bits (333), Expect = 1e-29
Identities = 61/115 (53%), Positives = 81/115 (70%)
Frame = +2

Query: 254 SWRSVPTHRWEGEPAVQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQK 433
+W+SV RWEG V G +P WLDG YLRNGPG +++GD+ F+HLFDGYATLVR+ F+
Sbjct: 84 AWKSVRQERWEGALEVDGELPLWLDGTYLRNGPGLWNLGDYGFRHLFDGYATLVRVSFRG 143

Query: 434 GKLKVTHAQLQSQAYTNAMKLGKPFFREFAEAPKKENLLSYFGDLAGMAFGTTLT 598
G+ H Q++S+AY A GK +REF+E PK +N LSY G LA + G++LT
Sbjct: 144 GRAVGAHRQIESEAYKAARAHGKVCYREFSEVPKPDNFLSYVGQLATLFSGSSLT 198


>tr|A2ZXS1|A2ZXS1_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_003343 PE=4 SV=1
Length = 569

Score = 132 bits (333), Expect = 1e-29
Identities = 61/115 (53%), Positives = 81/115 (70%)
Frame = +2

Query: 254 SWRSVPTHRWEGEPAVQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQK 433
+W+SV RWEG V G +P WLDG YLRNGPG +++GD+ F+HLFDGYATLVR+ F+
Sbjct: 84 AWKSVRQERWEGALEVDGELPLWLDGTYLRNGPGLWNLGDYGFRHLFDGYATLVRVSFRG 143

Query: 434 GKLKVTHAQLQSQAYTNAMKLGKPFFREFAEAPKKENLLSYFGDLAGMAFGTTLT 598
G+ H Q++S+AY A GK +REF+E PK +N LSY G LA + G++LT
Sbjct: 144 GRAVGAHRQIESEAYKAARAHGKVCYREFSEVPKPDNFLSYVGQLATLFSGSSLT 198


>tr|A2WV02|A2WV02_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_03714 PE=4 SV=1
Length = 569

Score = 132 bits (333), Expect = 1e-29
Identities = 61/115 (53%), Positives = 81/115 (70%)
Frame = +2

Query: 254 SWRSVPTHRWEGEPAVQGVIPYWLDGAYLRNGPGQFHVGDHEFKHLFDGYATLVRLHFQK 433
+W+SV RWEG V G +P WLDG YLRNGPG +++GD+ F+HLFDGYATLVR+ F+
Sbjct: 84 AWKSVRQERWEGALEVDGELPLWLDGTYLRNGPGLWNLGDYGFRHLFDGYATLVRVSFRG 143

Query: 434 GKLKVTHAQLQSQAYTNAMKLGKPFFREFAEAPKKENLLSYFGDLAGMAFGTTLT 598
G+ H Q++S+AY A GK +REF+E PK +N LSY G LA + G++LT
Sbjct: 144 GRAVGAHRQIESEAYKAARAHGKVCYREFSEVPKPDNFLSYVGQLATLFSGSSLT 198