1BS5A-3CPMA
confEVID 1BS5A-3CPMA
pdbIDA 1BS5
pdbIDB 3CPM
pdbChainA A
pdbChainB A
identity 0.301099985837936
indelSize 3
alignment <alignment>
<seq1>-----SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRD--ERLVLINPELLEKS-GETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQ-----QRIRQKVEKLDRLKARA---</seq1>
<seq2>DVQFETPLKIVEYPDPILRAKNKRIDIFDENLKNLVDAMFDVMYKTDGIGLSAPQVGLNVQLMVFNPAGEPGEGKEIVLVNPKIKKYSDKLVPFDEGCLSFPGIYAEVVRPQSVKIDARDITGERFSISLSRLPARIFQHEYDHLEGVLFFDRMTDQVLDSIREELEALEKKYEEKTGLPSPER</seq2>
<ss_1>----- GGGG HHHHHHHHHHHHHHHH EEEEE EEEEEEEE -- EEEE EEE- EEEEE EEEEEEEEEEE EEEEEEEEEHHHHHHHHHHHH GGGG HH-----HHHHHHHHHHHH ---</ss_1>
<ss_2> HHHHHHHHHHHHHHHH EEEEE EEEEEEE EEEE EEEEEEEEE EEEEEEE EEEEEEEE EEEEEEE HHHHHHHHHHHHH GGGG HHHHGGGHHHHHHHHHHHHHHH </ss_2>
</alignment>
indel <indel>
<confEVID></confEVID>
<index>0</index>
<entryChain>
<pdbID>1BS5</pdbID>
<pdbChain>A</pdbChain>
<entryIDChain>1BS5A</entryIDChain>
<sequence>SENRD--ERLVL</sequence>
<secondary-structure> -- EEE</secondary-structure>
<atom-coordinate>
<line>ATOM 496 CA SER A 63 38.616 37.538 79.989 1.00 49.23 C </line>
<line>ATOM 502 CA GLU A 64 35.722 39.046 81.893 1.00 56.78 C </line>
<line>ATOM 511 CA ASN A 65 37.895 41.224 84.162 1.00 60.81 C </line>
<line>ATOM 519 CA ARG A 66 41.098 41.539 82.101 1.00 63.61 C </line>
<line>ATOM 530 CA ASP A 67 43.163 39.153 84.250 1.00 64.10 C </line>
<line>ATOM 538 CA GLU A 68 44.690 37.212 81.319 1.00 55.25 C </line>
<line>ATOM 547 CA ARG A 69 45.787 39.258 78.328 1.00 42.01 C </line>
<line>ATOM 558 CA LEU A 70 47.470 36.988 75.759 1.00 31.29 C </line>
<line>ATOM 566 CA VAL A 71 50.306 38.201 73.514 1.00 26.29 C </line>
<line>ATOM 573 CA LEU A 72 51.446 36.242 70.460 1.00 24.42 C </line>
</atom-coordinate>
<distance-map>
<line> LEU VAL LEU ARG GLU ASP ARG ASN GLU SER </line>
<line> CA CA CA CA CA CA CA CA CA CA </line>
<line>SER CA 16.03 13.38 9.83 7.56 6.23 6.44 5.16 5.61 3.78 </line>
<line>GLU CA 19.64 16.84 13.41 10.68 9.17 7.81 5.93 3.82 </line>
<line>ASN CA 19.90 16.63 13.43 10.01 8.39 5.66 3.82 </line>
<line>ARG CA 16.45 13.03 10.08 6.44 5.68 3.82 </line>
<line>ASP CA 16.35 12.93 9.76 6.48 3.83 </line>
<line>GLU CA 12.83 9.67 6.22 3.79 </line>
<line>ARG CA 10.15 6.69 3.82 </line>
<line>LEU CA 6.67 3.82 </line>
<line>VAL CA 3.80 </line>
<line>LEU CA </line>
</distance-map>
<n14>
<line>SER CA 193</line>
<line>GLU CA 145</line>
<line>ASN CA 134</line>
<line>ARG CA 194</line>
<line>ASP CA 140</line>
<line>GLU CA 214</line>
<line>ARG CA 317</line>
<line>LEU CA 405</line>
<line>VAL CA 449</line>
<line>LEU CA 490</line>
</n14>
</entryChain>
<entryChain>
<pdbID>3CPM</pdbID>
<pdbChain>A</pdbChain>
<entryIDChain>3CPMA</entryIDChain>
<sequence>AGEPGEGKEIVL</sequence>
<secondary-structure> EEE</secondary-structure>
<atom-coordinate>
<line>ATOM 538 CA ALA A 141 23.200 10.921 -46.138 1.00 31.62 C </line>
<line>ATOM 543 CA GLY A 142 25.989 8.461 -46.916 1.00 37.02 C </line>
<line>ATOM 547 CA GLU A 143 28.327 11.321 -47.808 1.00 40.97 C </line>
<line>ATOM 556 CA PRO A 144 31.062 12.690 -45.535 1.00 43.37 C </line>
<line>ATOM 563 CA GLY A 145 30.260 16.070 -44.010 1.00 47.83 C </line>
<line>ATOM 567 CA GLU A 146 26.834 15.989 -45.664 1.00 52.36 C </line>
<line>ATOM 576 CA GLY A 147 24.546 14.281 -43.167 1.00 46.68 C </line>
<line>ATOM 580 CA LYS A 148 24.353 13.171 -39.541 1.00 40.96 C </line>
<line>ATOM 589 CA GLU A 149 27.062 10.853 -38.227 1.00 34.47 C </line>
<line>ATOM 598 CA ILE A 150 25.808 8.622 -35.434 1.00 27.49 C </line>
<line>ATOM 606 CA VAL A 151 27.931 6.057 -33.629 1.00 20.62 C </line>
<line>ATOM 613 CA LEU A 152 26.600 3.716 -30.938 1.00 18.22 C </line>
</atom-coordinate>
<distance-map>
<line> LEU VAL ILE GLU LYS GLY GLU GLY PRO GLU GLY ALA </line>
<line> CA CA CA CA CA CA CA CA CA CA CA CA </line>
<line>ALA CA 17.16 14.23 11.25 8.80 7.06 4.68 6.25 8.99 8.08 5.41 3.80 </line>
<line>GLY CA 16.68 13.64 11.48 9.08 8.90 7.07 7.68 9.20 6.75 3.80 </line>
<line>GLU CA 18.59 15.13 12.91 9.68 9.36 6.68 5.35 6.38 3.81 </line>
<line>PRO CA 17.71 13.98 12.09 8.53 9.01 7.11 5.36 3.79 </line>
<line>GLY CA 18.35 14.61 12.20 8.42 7.95 6.05 3.81 </line>
<line>GLU CA 19.17 15.64 12.65 9.04 7.18 3.79 </line>
<line>GLY CA 16.29 13.04 9.67 6.52 3.80 </line>
<line>LYS CA 12.98 9.92 6.30 3.80 </line>
<line>GLU CA 10.21 6.70 3.79 </line>
<line>ILE CA 6.70 3.79 </line>
<line>VAL CA 3.81 </line>
<line>LEU CA </line>
</distance-map>
<n14>
<line>ALA CA 237</line>
<line>GLY CA 270</line>
<line>GLU CA 209</line>
<line>PRO CA 212</line>
<line>GLY CA 162</line>
<line>GLU CA 148</line>
<line>GLY CA 187</line>
<line>LYS CA 240</line>
<line>GLU CA 313</line>
<line>ILE CA 405</line>
<line>VAL CA 464</line>
<line>LEU CA 502</line>
</n14>
</entryChain>
<parallel>
<x>14.79800033569336</x>
<y>27.481000900268555</y>
<z>123.9260025024414</z>
</parallel>
<rotation>
<x>0.25099998712539673</x>
<y>0.9440000057220459</y>
<z>0.21400000154972076</z>
<x>0.39500001072883606</x>
<y>-0.3019999861717224</y>
<z>0.8669999837875366</z>
<x>0.8830000162124634</x>
<y>-0.13300000131130219</y>
<z>-0.4490000009536743</z>
</rotation>
<rmsd>1.874019980430603</rmsd>
<dmax>2.516490936279297</dmax>
</indel>
<indel>
<confEVID></confEVID>
<index>1</index>
<entryChain>
<pdbID>1BS5</pdbID>
<pdbChain>A</pdbChain>
<entryIDChain>1BS5A</entryIDChain>
<sequence>LLEKS-GETGI</sequence>
<secondary-structure> EEE- EEE</secondary-structure>
<atom-coordinate>
<line>ATOM 613 CA LEU A 77 51.068 27.052 63.927 1.00 27.46 C </line>
<line>ATOM 621 CA LEU A 78 52.422 23.631 64.880 1.00 30.46 C </line>
<line>ATOM 629 CA GLU A 79 49.292 21.482 64.649 1.00 34.83 C </line>
<line>ATOM 638 CA LYS A 80 45.557 21.760 64.124 1.00 31.21 C </line>
<line>ATOM 647 CA SER A 81 42.674 19.304 64.121 1.00 31.39 C </line>
<line>ATOM 653 CA GLY A 82 38.899 19.100 64.018 1.00 27.27 C </line>
<line>ATOM 657 CA GLU A 83 36.506 21.698 62.696 1.00 27.78 C </line>
<line>ATOM 666 CA THR A 84 34.115 24.254 64.180 1.00 23.24 C </line>
<line>ATOM 673 CA GLY A 85 32.605 27.595 63.526 1.00 23.93 C </line>
<line>ATOM 677 CA ILE A 86 30.950 30.382 65.458 1.00 21.79 C </line>
</atom-coordinate>
<distance-map>
<line> ILE GLY THR GLU GLY SER LYS GLU LEU LEU </line>
<line> CA CA CA CA CA CA CA CA CA CA </line>
<line>LEU CA 20.45 18.48 17.18 15.56 14.54 11.42 7.64 5.89 3.80 </line>
<line>LEU CA 22.52 20.25 18.33 16.18 14.29 10.69 7.16 3.80 </line>
<line>GLU CA 20.40 17.81 15.44 12.94 10.68 6.99 3.78 </line>
<line>LYS CA 17.01 14.22 11.71 9.16 7.17 3.79 </line>
<line>SER CA 16.19 13.06 9.89 6.77 3.78 </line>
<line>GLY CA 13.88 10.58 7.03 3.77 </line>
<line>GLU CA 10.67 7.12 3.80 </line>
<line>THR CA 7.01 3.72 </line>
<line>GLY CA 3.77 </line>
<line>ILE CA </line>
</distance-map>
<n14>
<line>LEU CA 307</line>
<line>LEU CA 211</line>
<line>GLU CA 204</line>
<line>LYS CA 246</line>
<line>SER CA 189</line>
<line>GLY CA 166</line>
<line>GLU CA 192</line>
<line>THR CA 218</line>
<line>GLY CA 252</line>
<line>ILE CA 234</line>
</n14>
</entryChain>
<entryChain>
<pdbID>3CPM</pdbID>
<pdbChain>A</pdbChain>
<entryIDChain>3CPMA</entryIDChain>
<sequence>IKKYSDKLVPF</sequence>
<secondary-structure> EEEEE</secondary-structure>
<atom-coordinate>
<line>ATOM 652 CA ILE A 157 16.571 -1.148 -27.616 1.00 25.06 C </line>
<line>ATOM 660 CA LYS A 158 14.411 0.052 -24.732 1.00 32.06 C </line>
<line>ATOM 669 CA LYS A 159 11.269 0.349 -26.834 1.00 34.67 C </line>
<line>ATOM 678 CA TYR A 160 10.187 -0.025 -30.439 1.00 35.87 C </line>
<line>ATOM 690 CA SER A 161 7.117 1.037 -32.406 1.00 24.27 C </line>
<line>ATOM 696 CA ASP A 162 3.988 -1.078 -32.512 1.00 17.56 C </line>
<line>ATOM 704 CA LYS A 163 3.458 -0.060 -36.157 1.00 14.27 C </line>
<line>ATOM 713 CA LEU A 164 5.167 -1.934 -38.987 1.00 14.48 C </line>
<line>ATOM 721 CA VAL A 165 6.466 -0.457 -42.209 1.00 17.17 C </line>
<line>ATOM 728 CA PRO A 166 8.137 -2.047 -45.251 1.00 20.13 C </line>
<line>ATOM 735 CA PHE A 167 11.405 -0.966 -46.859 1.00 24.14 C </line>
</atom-coordinate>
<distance-map>
<line> PHE PRO VAL LEU LYS ASP SER TYR LYS LYS ILE </line>
<line> CA CA CA CA CA CA CA CA CA CA CA </line>
<line>ILE CA 19.93 19.57 17.76 16.12 15.69 13.50 10.82 7.07 5.56 3.80 </line>
<line>LYS CA 22.35 21.56 19.20 17.11 15.83 13.06 10.63 7.10 3.79 </line>
<line>LYS CA 20.07 18.83 16.13 13.79 12.17 9.34 6.98 3.78 </line>
<line>TYR CA 16.49 15.09 12.35 10.10 8.83 6.62 3.80 </line>
<line>SER CA 15.21 13.25 9.94 7.48 5.35 3.78 </line>
<line>ASP CA 16.15 13.43 10.03 6.64 3.82 </line>
<line>LYS CA 13.36 10.42 6.77 3.80 </line>
<line>LEU CA 10.09 6.93 3.77 </line>
<line>VAL CA 6.80 3.82 </line>
<line>PRO CA 3.80 </line>
<line>PHE CA </line>
</distance-map>
<n14>
<line>ILE CA 328</line>
<line>LYS CA 224</line>
<line>LYS CA 226</line>
<line>TYR CA 270</line>
<line>SER CA 229</line>
<line>ASP CA 156</line>
<line>LYS CA 159</line>
<line>LEU CA 208</line>
<line>VAL CA 230</line>
<line>PRO CA 248</line>
<line>PHE CA 274</line>
</n14>
</entryChain>
<parallel>
<x>34.486000061035156</x>
<y>22.558000564575195</y>
<z>96.49700164794922</z>
</parallel>
<rotation>
<x>0.4300000071525574</x>
<y>0.8840000033378601</y>
<z>0.1850000023841858</z>
<x>0.007000000216066837</x>
<y>-0.20900000631809235</y>
<z>0.9779999852180481</z>
<x>0.902999997138977</x>
<y>-0.4189999997615814</y>
<z>-0.09600000083446503</z>
</rotation>
<rmsd>0.7351530194282532</rmsd>
<dmax>1.1854710578918457</dmax>
</indel>
<indel>
<confEVID></confEVID>
<index>2</index>
<entryChain>
<pdbID>1BS5</pdbID>
<pdbChain>A</pdbChain>
<entryIDChain>1BS5A</entryIDChain>
<sequence>SPLKQ-----QRIRQ</sequence>
<secondary-structure> HH-----HHHHH</secondary-structure>
<atom-coordinate>
<line>ATOM 1161 CA SER A 147 30.544 33.278 48.771 1.00 36.54 C </line>
<line>ATOM 1167 CA PRO A 148 31.147 36.147 46.295 1.00 41.07 C </line>
<line>ATOM 1174 CA LEU A 149 27.533 37.109 46.947 1.00 45.04 C </line>
<line>ATOM 1182 CA LYS A 150 27.935 37.081 50.724 1.00 45.63 C </line>
<line>ATOM 1191 CA GLN A 151 31.052 39.195 50.327 1.00 41.42 C </line>
<line>ATOM 1200 CA GLN A 152 29.326 41.907 48.281 1.00 51.08 C </line>
<line>ATOM 1209 CA ARG A 153 26.645 42.641 50.874 1.00 55.52 C </line>
<line>ATOM 1220 CA ILE A 154 29.275 42.695 53.628 1.00 51.55 C </line>
<line>ATOM 1228 CA ARG A 155 31.328 45.227 51.708 1.00 60.05 C </line>
<line>ATOM 1239 CA GLN A 156 28.282 47.458 51.197 1.00 59.29 C </line>
</atom-coordinate>
<distance-map>
<line> GLN ARG ILE ARG GLN GLN LYS LEU PRO SER </line>
<line> CA CA CA CA CA CA CA CA CA CA </line>
<line>SER CA 14.56 12.33 10.67 10.36 8.73 6.14 5.01 5.20 3.84 </line>
<line>PRO CA 12.66 10.57 10.01 9.13 6.36 5.06 5.55 3.80 </line>
<line>LEU CA 11.21 10.15 8.88 6.84 5.29 5.31 3.80 </line>
<line>LYS CA 10.39 8.88 6.46 5.71 5.59 3.79 </line>
<line>GLN CA 8.76 6.19 5.13 5.62 3.81 </line>
<line>GLN CA 6.36 5.17 5.40 3.80 </line>
<line>ARG CA 5.10 5.41 3.81 </line>
<line>ILE CA 5.44 3.78 </line>
<line>ARG CA 3.81 </line>
<line>GLN CA </line>
</distance-map>
<n14>
<line>SER CA 172</line>
<line>PRO CA 158</line>
<line>LEU CA 143</line>
<line>LYS CA 216</line>
<line>GLN CA 261</line>
<line>GLN CA 224</line>
<line>ARG CA 233</line>
<line>ILE CA 320</line>
<line>ARG CA 317</line>
<line>GLN CA 243</line>
</n14>
</entryChain>
<entryChain>
<pdbID>3CPM</pdbID>
<pdbChain>A</pdbChain>
<entryIDChain>3CPMA</entryIDChain>
<sequence>TDQVLDSIREELEAL</sequence>
<secondary-structure> HHHHGGGHHHHHHH</secondary-structure>
<atom-coordinate>
<line>ATOM 1234 CA THR A 228 9.129 -13.269 -45.401 1.00 21.50 C </line>
<line>ATOM 1241 CA ASP A 229 9.418 -16.689 -47.014 1.00 30.74 C </line>
<line>ATOM 1249 CA GLN A 230 8.238 -15.162 -50.305 1.00 30.01 C </line>
<line>ATOM 1258 CA VAL A 231 10.726 -12.303 -50.401 1.00 25.11 C </line>
<line>ATOM 1265 CA LEU A 232 13.379 -14.804 -49.345 1.00 21.43 C </line>
<line>ATOM 1273 CA ASP A 233 12.688 -16.974 -52.386 1.00 23.66 C </line>
<line>ATOM 1281 CA SER A 234 13.144 -13.867 -54.546 1.00 21.97 C </line>
<line>ATOM 1287 CA ILE A 235 16.830 -13.808 -53.596 1.00 19.89 C </line>
<line>ATOM 1295 CA ARG A 236 17.637 -17.459 -52.882 1.00 21.77 C </line>
<line>ATOM 1306 CA GLU A 237 19.802 -17.775 -55.996 1.00 21.59 C </line>
<line>ATOM 1315 CA GLU A 238 21.557 -14.546 -55.035 1.00 16.17 C </line>
<line>ATOM 1324 CA LEU A 239 22.542 -15.836 -51.574 1.00 16.49 C </line>
<line>ATOM 1332 CA GLU A 240 23.444 -19.169 -53.149 1.00 21.02 C </line>
<line>ATOM 1341 CA ALA A 241 25.887 -17.396 -55.480 1.00 17.48 C </line>
<line>ATOM 1346 CA LEU A 242 27.641 -15.794 -52.494 1.00 16.49 C </line>
</atom-coordinate>
<distance-map>
<line> LEU ALA GLU LEU GLU GLU ARG ILE SER ASP LEU VAL GLN ASP THR </line>
<line> CA CA CA CA CA CA CA CA CA CA CA CA CA CA CA </line>
<line>THR CA 19.98 19.99 17.31 14.99 15.78 15.70 12.08 11.26 10.01 8.67 6.00 5.34 5.33 3.79 </line>
<line>ASP CA 19.05 18.53 15.51 13.92 14.71 13.77 10.13 10.32 8.86 6.30 4.97 5.69 3.82 </line>
<line>GLN CA 19.54 18.53 15.98 14.38 14.15 13.15 10.01 9.30 6.61 5.24 5.24 3.79 </line>
<line>VAL CA 17.40 16.78 14.71 12.39 11.99 11.98 8.97 7.05 5.05 5.44 3.80 </line>
<line>LEU CA 14.64 14.17 11.61 9.49 9.97 9.71 6.14 5.57 5.29 3.80 </line>
<line>ASP CA 15.00 13.56 11.00 9.95 9.57 8.02 5.00 5.35 3.81 </line>
<line>SER CA 14.77 13.26 11.67 10.05 8.45 7.86 5.99 3.81 </line>
<line>ILE CA 11.05 9.92 8.53 6.39 5.00 5.51 3.81 </line>
<line>ARG CA 10.15 8.65 6.06 5.33 5.34 3.81 </line>
<line>GLU CA 8.81 6.12 4.83 5.55 3.80 </line>
<line>GLU CA 6.71 5.20 5.34 3.82 </line>
<line>LEU CA 5.18 5.37 3.80 </line>
<line>GLU CA 5.43 3.81 </line>
<line>ALA CA 3.82 </line>
<line>LEU CA </line>
</distance-map>
<n14>
<line>THR CA 223</line>
<line>ASP CA 173</line>
<line>GLN CA 163</line>
<line>VAL CA 241</line>
<line>LEU CA 277</line>
<line>ASP CA 207</line>
<line>SER CA 223</line>
<line>ILE CA 296</line>
<line>ARG CA 271</line>
<line>GLU CA 226</line>
<line>GLU CA 282</line>
<line>LEU CA 347</line>
<line>GLU CA 281</line>
<line>ALA CA 260</line>
<line>LEU CA 324</line>
</n14>
</entryChain>
<parallel>
<x>14.378000259399414</x>
<y>53.979000091552734</y>
<z>99.75900268554688</z>
</parallel>
<rotation>
<x>-0.07199999690055847</x>
<y>0.6579999923706055</y>
<z>0.75</z>
<x>-0.828000009059906</x>
<y>-0.45899999141693115</y>
<z>0.3230000138282776</z>
<x>0.5559999942779541</x>
<y>-0.5979999899864197</y>
<z>0.5770000219345093</z>
</rotation>
<rmsd>4.296483039855957</rmsd>
<dmax>6.579329013824463</dmax>
</indel>