1BS7A-3CPMA
confEVID 1BS7A-3CPMA
pdbIDA 1BS7
pdbIDB 3CPM
pdbChainA A
pdbChainB A
identity 0.301099985837936
indelSize 3
alignment <alignment>
<seq1>-----SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRD--ERLVLINPELLEKS-GETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQ-----QRIRQKVEKLDRLKARA---</seq1>
<seq2>DVQFETPLKIVEYPDPILRAKNKRIDIFDENLKNLVDAMFDVMYKTDGIGLSAPQVGLNVQLMVFNPAGEPGEGKEIVLVNPKIKKYSDKLVPFDEGCLSFPGIYAEVVRPQSVKIDARDITGERFSISLSRLPARIFQHEYDHLEGVLFFDRMTDQVLDSIREELEALEKKYEEKTGLPSPER</seq2>
<ss_1>----- GGGG HHHHHHHHHHHHHHHH EEEEE EEEEEEEE -- EEEE EEE- EEEEE EEEEEEEEEEE EEEEEEEEEHHHHHHHHHHHH GGGG HHHH-----HHHHHHHHHHHHHH ---</ss_1>
<ss_2> HHHHHHHHHHHHHHHH EEEEE EEEEEEE EEEE EEEEEEEEE EEEEEEE EEEEEEEE EEEEEEE HHHHHHHHHHHHH GGGG HHHHGGGHHHHHHHHHHHHHHH </ss_2>
</alignment>
indel <indel>
<confEVID></confEVID>
<index>0</index>
<entryChain>
<pdbID>1BS7</pdbID>
<pdbChain>A</pdbChain>
<entryIDChain>1BS7A</entryIDChain>
<sequence>SENRD--ERLVL</sequence>
<secondary-structure> -- EEE</secondary-structure>
<atom-coordinate>
<line>ATOM 496 CA SER A 63 39.042 37.584 80.418 1.00 46.15 C </line>
<line>ATOM 502 CA GLU A 64 36.137 39.421 82.011 1.00 52.65 C </line>
<line>ATOM 511 CA ASN A 65 38.495 41.439 84.206 1.00 57.50 C </line>
<line>ATOM 519 CA ARG A 66 41.334 41.843 81.762 1.00 60.34 C </line>
<line>ATOM 530 CA ASP A 67 43.650 39.785 83.973 1.00 58.25 C </line>
<line>ATOM 538 CA GLU A 68 44.825 37.164 81.467 1.00 52.19 C </line>
<line>ATOM 547 CA ARG A 69 46.098 39.176 78.498 1.00 41.46 C </line>
<line>ATOM 558 CA LEU A 70 47.759 36.944 75.892 1.00 32.20 C </line>
<line>ATOM 566 CA VAL A 71 50.597 38.155 73.643 1.00 29.77 C </line>
<line>ATOM 573 CA LEU A 72 51.667 36.200 70.554 1.00 28.45 C </line>
</atom-coordinate>
<distance-map>
<line> LEU VAL LEU ARG GLU ASP ARG ASN GLU SER </line>
<line> CA CA CA CA CA CA CA CA CA CA </line>
<line>SER CA 16.08 13.41 9.84 7.48 5.89 6.22 5.02 5.43 3.79 </line>
<line>GLU CA 19.57 16.75 13.37 10.57 8.99 7.77 5.74 3.80 </line>
<line>ASN CA 19.68 16.40 13.23 9.77 8.11 5.42 3.77 </line>
<line>ARG CA 16.26 12.86 9.99 6.36 5.85 3.81 </line>
<line>ASP CA 16.04 12.55 9.50 6.03 3.81 </line>
<line>GLU CA 12.92 9.77 6.30 3.81 </line>
<line>ARG CA 10.15 6.70 3.81 </line>
<line>LEU CA 6.66 3.82 </line>
<line>VAL CA 3.81 </line>
<line>LEU CA </line>
</distance-map>
<n14>
<line>SER CA 190</line>
<line>GLU CA 146</line>
<line>ASN CA 140</line>
<line>ARG CA 205</line>
<line>ASP CA 153</line>
<line>GLU CA 213</line>
<line>ARG CA 316</line>
<line>LEU CA 407</line>
<line>VAL CA 453</line>
<line>LEU CA 494</line>
</n14>
</entryChain>
<entryChain>
<pdbID>3CPM</pdbID>
<pdbChain>A</pdbChain>
<entryIDChain>3CPMA</entryIDChain>
<sequence>AGEPGEGKEIVL</sequence>
<secondary-structure> EEE</secondary-structure>
<atom-coordinate>
<line>ATOM 538 CA ALA A 141 23.200 10.921 -46.138 1.00 31.62 C </line>
<line>ATOM 543 CA GLY A 142 25.989 8.461 -46.916 1.00 37.02 C </line>
<line>ATOM 547 CA GLU A 143 28.327 11.321 -47.808 1.00 40.97 C </line>
<line>ATOM 556 CA PRO A 144 31.062 12.690 -45.535 1.00 43.37 C </line>
<line>ATOM 563 CA GLY A 145 30.260 16.070 -44.010 1.00 47.83 C </line>
<line>ATOM 567 CA GLU A 146 26.834 15.989 -45.664 1.00 52.36 C </line>
<line>ATOM 576 CA GLY A 147 24.546 14.281 -43.167 1.00 46.68 C </line>
<line>ATOM 580 CA LYS A 148 24.353 13.171 -39.541 1.00 40.96 C </line>
<line>ATOM 589 CA GLU A 149 27.062 10.853 -38.227 1.00 34.47 C </line>
<line>ATOM 598 CA ILE A 150 25.808 8.622 -35.434 1.00 27.49 C </line>
<line>ATOM 606 CA VAL A 151 27.931 6.057 -33.629 1.00 20.62 C </line>
<line>ATOM 613 CA LEU A 152 26.600 3.716 -30.938 1.00 18.22 C </line>
</atom-coordinate>
<distance-map>
<line> LEU VAL ILE GLU LYS GLY GLU GLY PRO GLU GLY ALA </line>
<line> CA CA CA CA CA CA CA CA CA CA CA CA </line>
<line>ALA CA 17.16 14.23 11.25 8.80 7.06 4.68 6.25 8.99 8.08 5.41 3.80 </line>
<line>GLY CA 16.68 13.64 11.48 9.08 8.90 7.07 7.68 9.20 6.75 3.80 </line>
<line>GLU CA 18.59 15.13 12.91 9.68 9.36 6.68 5.35 6.38 3.81 </line>
<line>PRO CA 17.71 13.98 12.09 8.53 9.01 7.11 5.36 3.79 </line>
<line>GLY CA 18.35 14.61 12.20 8.42 7.95 6.05 3.81 </line>
<line>GLU CA 19.17 15.64 12.65 9.04 7.18 3.79 </line>
<line>GLY CA 16.29 13.04 9.67 6.52 3.80 </line>
<line>LYS CA 12.98 9.92 6.30 3.80 </line>
<line>GLU CA 10.21 6.70 3.79 </line>
<line>ILE CA 6.70 3.79 </line>
<line>VAL CA 3.81 </line>
<line>LEU CA </line>
</distance-map>
<n14>
<line>ALA CA 237</line>
<line>GLY CA 270</line>
<line>GLU CA 209</line>
<line>PRO CA 212</line>
<line>GLY CA 162</line>
<line>GLU CA 148</line>
<line>GLY CA 187</line>
<line>LYS CA 240</line>
<line>GLU CA 313</line>
<line>ILE CA 405</line>
<line>VAL CA 464</line>
<line>LEU CA 502</line>
</n14>
</entryChain>
<parallel>
<x>15.15999984741211</x>
<y>27.6560001373291</y>
<z>123.97899627685547</z>
</parallel>
<rotation>
<x>0.24500000476837158</x>
<y>0.9629999995231628</y>
<z>0.10899999737739563</z>
<x>0.4230000078678131</x>
<y>-0.2070000022649765</y>
<z>0.8820000290870667</z>
<x>0.8730000257492065</x>
<y>-0.17000000178813934</y>
<z>-0.4580000042915344</z>
</rotation>
<rmsd>1.8540329933166504</rmsd>
<dmax>2.6163909435272217</dmax>
</indel>
<indel>
<confEVID></confEVID>
<index>1</index>
<entryChain>
<pdbID>1BS7</pdbID>
<pdbChain>A</pdbChain>
<entryIDChain>1BS7A</entryIDChain>
<sequence>LLEKS-GETGI</sequence>
<secondary-structure> EEE- EEE</secondary-structure>
<atom-coordinate>
<line>ATOM 613 CA LEU A 77 51.167 26.922 63.991 1.00 31.15 C </line>
<line>ATOM 621 CA LEU A 78 52.633 23.566 64.926 1.00 33.43 C </line>
<line>ATOM 629 CA GLU A 79 49.506 21.428 64.783 1.00 39.35 C </line>
<line>ATOM 638 CA LYS A 80 45.793 21.680 64.180 1.00 33.58 C </line>
<line>ATOM 647 CA SER A 81 42.873 19.272 64.210 1.00 32.00 C </line>
<line>ATOM 653 CA GLY A 82 39.087 19.071 64.075 1.00 26.66 C </line>
<line>ATOM 657 CA GLU A 83 36.730 21.698 62.776 1.00 25.99 C </line>
<line>ATOM 666 CA THR A 84 34.373 24.311 64.240 1.00 24.09 C </line>
<line>ATOM 673 CA GLY A 85 32.780 27.634 63.601 1.00 24.51 C </line>
<line>ATOM 677 CA ILE A 86 31.118 30.516 65.443 1.00 22.31 C </line>
</atom-coordinate>
<distance-map>
<line> ILE GLY THR GLU GLY SER LYS GLU LEU LEU </line>
<line> CA CA CA CA CA CA CA CA CA CA </line>
<line>LEU CA 20.42 18.40 17.00 15.40 14.41 11.29 7.51 5.79 3.78 </line>
<line>LEU CA 22.62 20.31 18.29 16.16 14.30 10.69 7.13 3.79 </line>
<line>GLU CA 20.52 17.88 15.41 12.94 10.71 7.00 3.77 </line>
<line>LYS CA 17.18 14.32 11.72 9.17 7.20 3.78 </line>
<line>SER CA 16.31 13.12 9.88 6.76 3.79 </line>
<line>GLY CA 14.01 10.65 7.05 3.76 </line>
<line>GLU CA 10.79 7.18 3.81 </line>
<line>THR CA 7.11 3.74 </line>
<line>GLY CA 3.80 </line>
<line>ILE CA </line>
</distance-map>
<n14>
<line>LEU CA 306</line>
<line>LEU CA 213</line>
<line>GLU CA 205</line>
<line>LYS CA 246</line>
<line>SER CA 190</line>
<line>GLY CA 164</line>
<line>GLU CA 194</line>
<line>THR CA 223</line>
<line>GLY CA 250</line>
<line>ILE CA 233</line>
</n14>
</entryChain>
<entryChain>
<pdbID>3CPM</pdbID>
<pdbChain>A</pdbChain>
<entryIDChain>3CPMA</entryIDChain>
<sequence>IKKYSDKLVPF</sequence>
<secondary-structure> EEEEE</secondary-structure>
<atom-coordinate>
<line>ATOM 652 CA ILE A 157 16.571 -1.148 -27.616 1.00 25.06 C </line>
<line>ATOM 660 CA LYS A 158 14.411 0.052 -24.732 1.00 32.06 C </line>
<line>ATOM 669 CA LYS A 159 11.269 0.349 -26.834 1.00 34.67 C </line>
<line>ATOM 678 CA TYR A 160 10.187 -0.025 -30.439 1.00 35.87 C </line>
<line>ATOM 690 CA SER A 161 7.117 1.037 -32.406 1.00 24.27 C </line>
<line>ATOM 696 CA ASP A 162 3.988 -1.078 -32.512 1.00 17.56 C </line>
<line>ATOM 704 CA LYS A 163 3.458 -0.060 -36.157 1.00 14.27 C </line>
<line>ATOM 713 CA LEU A 164 5.167 -1.934 -38.987 1.00 14.48 C </line>
<line>ATOM 721 CA VAL A 165 6.466 -0.457 -42.209 1.00 17.17 C </line>
<line>ATOM 728 CA PRO A 166 8.137 -2.047 -45.251 1.00 20.13 C </line>
<line>ATOM 735 CA PHE A 167 11.405 -0.966 -46.859 1.00 24.14 C </line>
</atom-coordinate>
<distance-map>
<line> PHE PRO VAL LEU LYS ASP SER TYR LYS LYS ILE </line>
<line> CA CA CA CA CA CA CA CA CA CA CA </line>
<line>ILE CA 19.93 19.57 17.76 16.12 15.69 13.50 10.82 7.07 5.56 3.80 </line>
<line>LYS CA 22.35 21.56 19.20 17.11 15.83 13.06 10.63 7.10 3.79 </line>
<line>LYS CA 20.07 18.83 16.13 13.79 12.17 9.34 6.98 3.78 </line>
<line>TYR CA 16.49 15.09 12.35 10.10 8.83 6.62 3.80 </line>
<line>SER CA 15.21 13.25 9.94 7.48 5.35 3.78 </line>
<line>ASP CA 16.15 13.43 10.03 6.64 3.82 </line>
<line>LYS CA 13.36 10.42 6.77 3.80 </line>
<line>LEU CA 10.09 6.93 3.77 </line>
<line>VAL CA 6.80 3.82 </line>
<line>PRO CA 3.80 </line>
<line>PHE CA </line>
</distance-map>
<n14>
<line>ILE CA 328</line>
<line>LYS CA 224</line>
<line>LYS CA 226</line>
<line>TYR CA 270</line>
<line>SER CA 229</line>
<line>ASP CA 156</line>
<line>LYS CA 159</line>
<line>LEU CA 208</line>
<line>VAL CA 230</line>
<line>PRO CA 248</line>
<line>PHE CA 274</line>
</n14>
</entryChain>
<parallel>
<x>34.68899917602539</x>
<y>22.517000198364258</y>
<z>96.56999969482422</z>
</parallel>
<rotation>
<x>0.4350000023841858</x>
<y>0.8820000290870667</y>
<z>0.18199999630451202</z>
<x>0.004999999888241291</x>
<y>-0.20499999821186066</y>
<z>0.9789999723434448</z>
<x>0.9010000228881836</x>
<y>-0.42500001192092896</y>
<z>-0.09300000220537186</z>
</rotation>
<rmsd>0.7429140210151672</rmsd>
<dmax>1.171983003616333</dmax>
</indel>
<indel>
<confEVID></confEVID>
<index>2</index>
<entryChain>
<pdbID>1BS7</pdbID>
<pdbChain>A</pdbChain>
<entryIDChain>1BS7A</entryIDChain>
<sequence>SPLKQ-----QRIRQ</sequence>
<secondary-structure> HHHH-----HHHHH</secondary-structure>
<atom-coordinate>
<line>ATOM 1161 CA SER A 147 30.799 33.267 48.905 1.00 38.19 C </line>
<line>ATOM 1167 CA PRO A 148 31.385 36.089 46.386 1.00 42.67 C </line>
<line>ATOM 1174 CA LEU A 149 27.821 37.169 47.017 1.00 48.49 C </line>
<line>ATOM 1182 CA LYS A 150 28.127 37.117 50.798 1.00 46.31 C </line>
<line>ATOM 1191 CA GLN A 151 31.295 39.171 50.515 1.00 44.44 C </line>
<line>ATOM 1200 CA GLN A 152 29.766 41.758 48.189 1.00 53.05 C </line>
<line>ATOM 1209 CA ARG A 153 26.995 42.422 50.655 1.00 58.28 C </line>
<line>ATOM 1220 CA ILE A 154 29.461 42.741 53.628 1.00 52.99 C </line>
<line>ATOM 1228 CA ARG A 155 31.476 45.364 51.798 1.00 58.66 C </line>
<line>ATOM 1239 CA GLN A 156 28.420 47.587 51.237 1.00 57.84 C </line>
</atom-coordinate>
<distance-map>
<line> GLN ARG ILE ARG GLN GLN LYS LEU PRO SER </line>
<line> CA CA CA CA CA CA CA CA CA CA </line>
<line>SER CA 14.70 12.46 10.67 10.07 8.58 6.14 5.05 5.26 3.83 </line>
<line>PRO CA 12.83 10.74 10.02 8.81 6.17 5.15 5.58 3.78 </line>
<line>LEU CA 11.26 10.17 8.80 6.44 5.12 5.32 3.79 </line>
<line>LYS CA 10.48 8.96 6.44 5.43 5.57 3.79 </line>
<line>GLN CA 8.92 6.33 5.08 5.39 3.80 </line>
<line>GLN CA 6.71 5.38 5.54 3.77 </line>
<line>ARG CA 5.39 5.48 3.88 </line>
<line>ILE CA 5.50 3.78 </line>
<line>ARG CA 3.82 </line>
<line>GLN CA </line>
</distance-map>
<n14>
<line>SER CA 174</line>
<line>PRO CA 157</line>
<line>LEU CA 141</line>
<line>LYS CA 211</line>
<line>GLN CA 262</line>
<line>GLN CA 216</line>
<line>ARG CA 227</line>
<line>ILE CA 313</line>
<line>ARG CA 309</line>
<line>GLN CA 237</line>
</n14>
</entryChain>
<entryChain>
<pdbID>3CPM</pdbID>
<pdbChain>A</pdbChain>
<entryIDChain>3CPMA</entryIDChain>
<sequence>TDQVLDSIREELEAL</sequence>
<secondary-structure> HHHHGGGHHHHHHH</secondary-structure>
<atom-coordinate>
<line>ATOM 1234 CA THR A 228 9.129 -13.269 -45.401 1.00 21.50 C </line>
<line>ATOM 1241 CA ASP A 229 9.418 -16.689 -47.014 1.00 30.74 C </line>
<line>ATOM 1249 CA GLN A 230 8.238 -15.162 -50.305 1.00 30.01 C </line>
<line>ATOM 1258 CA VAL A 231 10.726 -12.303 -50.401 1.00 25.11 C </line>
<line>ATOM 1265 CA LEU A 232 13.379 -14.804 -49.345 1.00 21.43 C </line>
<line>ATOM 1273 CA ASP A 233 12.688 -16.974 -52.386 1.00 23.66 C </line>
<line>ATOM 1281 CA SER A 234 13.144 -13.867 -54.546 1.00 21.97 C </line>
<line>ATOM 1287 CA ILE A 235 16.830 -13.808 -53.596 1.00 19.89 C </line>
<line>ATOM 1295 CA ARG A 236 17.637 -17.459 -52.882 1.00 21.77 C </line>
<line>ATOM 1306 CA GLU A 237 19.802 -17.775 -55.996 1.00 21.59 C </line>
<line>ATOM 1315 CA GLU A 238 21.557 -14.546 -55.035 1.00 16.17 C </line>
<line>ATOM 1324 CA LEU A 239 22.542 -15.836 -51.574 1.00 16.49 C </line>
<line>ATOM 1332 CA GLU A 240 23.444 -19.169 -53.149 1.00 21.02 C </line>
<line>ATOM 1341 CA ALA A 241 25.887 -17.396 -55.480 1.00 17.48 C </line>
<line>ATOM 1346 CA LEU A 242 27.641 -15.794 -52.494 1.00 16.49 C </line>
</atom-coordinate>
<distance-map>
<line> LEU ALA GLU LEU GLU GLU ARG ILE SER ASP LEU VAL GLN ASP THR </line>
<line> CA CA CA CA CA CA CA CA CA CA CA CA CA CA CA </line>
<line>THR CA 19.98 19.99 17.31 14.99 15.78 15.70 12.08 11.26 10.01 8.67 6.00 5.34 5.33 3.79 </line>
<line>ASP CA 19.05 18.53 15.51 13.92 14.71 13.77 10.13 10.32 8.86 6.30 4.97 5.69 3.82 </line>
<line>GLN CA 19.54 18.53 15.98 14.38 14.15 13.15 10.01 9.30 6.61 5.24 5.24 3.79 </line>
<line>VAL CA 17.40 16.78 14.71 12.39 11.99 11.98 8.97 7.05 5.05 5.44 3.80 </line>
<line>LEU CA 14.64 14.17 11.61 9.49 9.97 9.71 6.14 5.57 5.29 3.80 </line>
<line>ASP CA 15.00 13.56 11.00 9.95 9.57 8.02 5.00 5.35 3.81 </line>
<line>SER CA 14.77 13.26 11.67 10.05 8.45 7.86 5.99 3.81 </line>
<line>ILE CA 11.05 9.92 8.53 6.39 5.00 5.51 3.81 </line>
<line>ARG CA 10.15 8.65 6.06 5.33 5.34 3.81 </line>
<line>GLU CA 8.81 6.12 4.83 5.55 3.80 </line>
<line>GLU CA 6.71 5.20 5.34 3.82 </line>
<line>LEU CA 5.18 5.37 3.80 </line>
<line>GLU CA 5.43 3.81 </line>
<line>ALA CA 3.82 </line>
<line>LEU CA </line>
</distance-map>
<n14>
<line>THR CA 223</line>
<line>ASP CA 173</line>
<line>GLN CA 163</line>
<line>VAL CA 241</line>
<line>LEU CA 277</line>
<line>ASP CA 207</line>
<line>SER CA 223</line>
<line>ILE CA 296</line>
<line>ARG CA 271</line>
<line>GLU CA 226</line>
<line>GLU CA 282</line>
<line>LEU CA 347</line>
<line>GLU CA 281</line>
<line>ALA CA 260</line>
<line>LEU CA 324</line>
</n14>
</entryChain>
<parallel>
<x>14.652000427246094</x>
<y>53.93899917602539</y>
<z>99.79000091552734</z>
</parallel>
<rotation>
<x>-0.0729999989271164</x>
<y>0.6690000295639038</y>
<z>0.7400000095367432</z>
<x>-0.8349999785423279</x>
<y>-0.44699999690055847</y>
<z>0.32100000977516174</z>
<x>0.5450000166893005</x>
<y>-0.593999981880188</y>
<z>0.5910000205039978</z>
</rotation>
<rmsd>4.387518882751465</rmsd>
<dmax>6.750853061676025</dmax>
</indel>