AFH742
Library AF
(Link to library)
Clone ID AFH742
Atlas ID -
NBRP ID
dictyBase ID
Link to Contig Contig-U08780-1
Original site URL
Representative seq. ID AFH742P
(Link to Original site)
Representative DNA sequence
>AFH742 (AFH742Q) /CSM/AF/AFH7-B/AFH742Q.Seq.d/
TTTTTTTTTAAAAAGATAATTATTATTATTTTTCATAAAATAATAGAAAAATGATTGAAG
AACATAATTGTTTTGAAGAATTTATAAATACAGCAGCAATTGGTGAACAACAAGTTTATG
GTGAATATAAATCTAAATTAGATTCATTTACAGATGAAAGTAAATTACCATATGAATTAT
TATTAGAGAGAAAGAATTTAGTAGAATTGAAAATTTCTGATGAAGAATATAAAAAGAGTG
AATCTGCATAAAAACACCAAATCCAACATTATTACAAAAGTTTCAAATTAATTTTTATCA
AACTATTGAATCGATTAATCAAGTATTTAAACCATCATCATCATCATCAAATCAATCATC
ATCATCGTCCTCCTCGAATGAAGATGATTCATTACAAAATAAAAAGATTAAAGTAATGTC
ATGGCATCCACAACATAGATTACTTGCAGTTTGTAATAAAAATGATGTTATTTATATCTA
CTATTTCCCAAATCAAGATATGTATGGTATGGGTAATGTCAGACCTTTAACATTATGGTT
TGAATTACAATCAAAAGTTTATGATATACAATGGAAACCTTTCTTACCATATACTTTAGC
TGTTGXXXXXXXXXXAATACAATTACATGGTCATCAAATGGTTTACAATTAGCATGTGGT
TCAACTAATCATAGTTCAATTCTATTATGGGATGTTGTATCTAGAGTACCAACATTCATA
CCACGTTATAATGGTAACTCATTATTAGTTTGGTCTCCAAAAAATGATTATCTTTTATCT
TGTGGTGGTAAAACTTGTAGAATTTTCGATATCTCAAAATGGGATTACAATAATAAAGAA
TGGCCAATGTTAACAAATTATCAAACAGGATCATGGAATGGAAAAGGTGAATATTTAGCA
GTTGCAAGTGGTGATAGAATTCAGTTTATTCAATGTATAAATAGAGCATTTGAATCAGGT
GGTGAATTAATGTATGTTGAGAAAACTTCAACCTATAGATTACAAAATGTTGGTGGTAGT
GGTGGTGGTTCAAGTAGTAGTGAATTATTTTTAGGCGGACATATAAAGAAAATTGCATGG
TCACCTGATAGTCAAAGATTGGCTGTCATCTTTTATTTAAATAGCAAGAGTAGAAATAAT
GATACTTATTGTGCAATCTATAAAATTAAAACTTATCCTAAATTTTCTGTAACACCAAGA
GGTTTCATAAGGTCAAAAGATCAATCAATTCAATCAGTTTCTTTTGTCCCAAATTATAAA
AAAGGTTCTTTATTATCAATTGCCTACAATGATGGAACAATTAAATTTTTCCCATTATTA
TATCAATATAAACAATAAGAAAATAAAGATTTTACACTT
sequence update 2001. 6. 2
Translated Amino Acid sequence
fflkr*lllffik**knd*rt*lf*riykyssnw*ttslw*i*i*irfiyr*k*iti*ii
irekefsrienf**ri*ke*ICIKTPNPTLLQKFQINFYQTIESINQVFKPSSSSSNQSS
SSSSSNEDDSLQNKKIKVMSWHPQHRLLAVCNKNDVIYIYYFPNQDMYGMGNVRPLTLWF
ELQSKVYDIQWKPFLPYTLAV---

---NTITWSSNGLQLACGSTNHSSILLWDVVSRVPTFIPRYNGNSLLVWSPKNDYLLSCG
GKTCRIFDISKWDYNNKEWPMLTNYQTGSWNGKGEYLAVASGDRIQFIQCINRAFESGGE
LMYVEKTSTYRLQNVGGSGGGSSSSELFLGGHIKKIAWSPDSQRLAVIFYLNSKSRNNDT
YCAIYKIKTYPKFSVTPRGFIRSKDQSIQSVSFVPNYKKGSLLSIAYNDGTIKFFPLLYQ
YKQ*enkdftl


Translated Amino Acid sequence (All Frames)
Frame A:
fffkkiiiiifhkiiek*lkniivlknl*iqqqlvnnkfmvninln*ihlqmkvnyhmny
y*reri**n*kflmknikrvnlhkntksniitkvsn*flsny*id*ssi*tiiiiiksii
iivlle*r*fitk*kd*snvmastt*itcsl**k*cylyllfpksryvwyg*cqtfnimv
*itiksl*ytmetfltiyfsc---

---NTITWSSNGLQLACGSTNHSSILLWDVVSRVPTFIPRYNGNSLLVWSPKNDYLLSCG
GKTCRIFDISKWDYNNKEWPMLTNYQTGSWNGKGEYLAVASGDRIQFIQCINRAFESGGE
LMYVEKTSTYRLQNVGGSGGGSSSSELFLGGHIKKIAWSPDSQRLAVIFYLNSKSRNNDT
YCAIYKIKTYPKFSVTPRGFIRSKDQSIQSVSFVPNYKKGSLLSIAYNDGTIKFFPLLYQ
YKQ*enkdftl

Frame B:
fflkr*lllffik**knd*rt*lf*riykyssnw*ttslw*i*i*irfiyr*k*iti*ii
irekefsrienf**ri*ke*ICIKTPNPTLLQKFQINFYQTIESINQVFKPSSSSSNQSS
SSSSSNEDDSLQNKKIKVMSWHPQHRLLAVCNKNDVIYIYYFPNQDMYGMGNVRPLTLWF
ELQSKVYDIQWKPFLPYTLAV---

---iqlhghqmvyn*hvvqliivqfyygmlyleyqhsyhvimvthy*fglqkmiifylvv
vklvefsisqngitiikngqc*qiikqdhgmekvni*qlqvviefslfnv*iehlnqvvn
*cmlrklqpidykmlvvvvvvqvvvnyf*adi*rklhghlivkdwlssfi*iarveimil
ivqsiklklilnfl*hqevs*gqkinqfnqfllsqiikkvlyyqlptmmeqlnfshyyin
innkkikilh

Frame C:
ff*kdnyyyfs*nnrkmieehncfeefintaaigeqqvygeykskldsftdesklpyell
lerknlvelkisdeeykksesa*khqiqhyyksfklifikllnrlikylnhhhhhqinhh
hrpprmkmihykikrlk*chgihnidylqfvikmmlfistisqikicmvwvmsdl*hygl
nynqkfmiyngnlsyhil*ll---

---ynymvikwftismwfn*s*fnsimgcci*stnihttl*w*liislvskk*lsfilww
*nl*nfrylkmglq**rmanvnklsnrimewkr*ifssckw**nsvysmyk*si*irw*i
nvc*enfnl*itkcww*wwwfk***iifrrtykencmvt**skigchllfk*qe*k**yl
lcnl*n*nls*ifcntkrfhkvkrsinsisffcpkl*krffiinclq*wnn*ifpiiisi
*tirk*rfyt

Homology vs CSM-cDNA

Score E
Sequences producing significant alignments: (bits) Value

AFH742 (AFH742Q) /CSM/AF/AFH7-B/AFH742Q.Seq.d/ 1909 0.0
AFI409 (AFI409Q) /CSM/AF/AFI4-A/AFI409Q.Seq.d/ 1475 0.0
VFI871 (VFI871Q) /CSM/VF/VFI8-C/VFI871Q.Seq.d/ 1473 0.0
SSK827 (SSK827Q) /CSM/SS/SSK8-B/SSK827Q.Seq.d/ 1296 0.0
CFG838 (CFG838Q) /CSM/CF/CFG8-B/CFG838Q.Seq.d/ 1221 0.0
CFG822 (CFG822Q) /CSM/CF/CFG8-A/CFG822Q.Seq.d/ 553 e-156
SSE416 (SSE416Q) /CSM/SS/SSE4-A/SSE416Q.Seq.d/ 149 1e-34
VSB478 (VSB478Q) /CSM/VS/VSB4-D/VSB478Q.Seq.d/ 105 2e-21
VSC172 (VSC172Q) /CSM/VS/VSC1-C/VSC172Q.Seq.d/ 46 0.001
VHH302 (VHH302Q) /CSM/VH/VHH3-A/VHH302Q.Seq.d/ 46 0.001

own update 2004.12.25
Homology vs DNA

Score E
Sequences producing significant alignments: (bits) Value N

AC115581|AC115581.3 Dictyostelium discoideum chromosome 2 map complement(3527391-3470188) strain AX4, complete sequence. 829 0.0 10
AC116957|AC116957.2 Dictyostelium discoideum chromosome 2 map 1685067-2090751 strain AX4, complete sequence. 34 1e-13 21
AL844507|AL844507.1 Plasmodium falciparum chromosome 8. 42 1e-12 23
AC117176|AC117176.2 Dictyostelium discoideum chromosome 2 map 5018074-5200947 strain AX4, complete sequence. 40 1e-11 18
AC116960|AC116960.2 Dictyostelium discoideum chromosome 2 map complement(1004496-821614) strain AX4, complete sequence. 38 3e-11 17
AE014824|AE014824.1 Plasmodium falciparum 3D7 chromosome 14 section 9 of 13 of the complete sequence. 34 2e-10 22
AL844509|AL844509.1 Plasmodium falciparum chromosome 13. 38 2e-10 21
AC116982|AC116982.2 Dictyostelium discoideum chromosome 2 map 3622643-3879522 strain AX4, complete sequence. 40 4e-10 20
AC116305|AC116305.2 Dictyostelium discoideum chromosome 2 map 1005175-1418323 strain AX4, complete sequence. 36 1e-09 21
AE014847|AE014847.1 Plasmodium falciparum 3D7 chromosome 12, section 4 of 9 of the complete sequence. 34 2e-09 20
dna update 2004. 6.22
Homology vs Protein

Score E
Sequences producing significant alignments: (bits) Value

AC115581_9(AC115581|pid:none) Dictyostelium discoideum chromosom... 477 e-133
BC077988_1(BC077988|pid:none) Xenopus laevis achalasia, adrenoco... 92 8e-20
AK088247_1(AK088247|pid:none) Mus musculus 2 days neonate thymus... 84 3e-17
BC067671_1(BC067671|pid:none) Danio rerio achalasia, adrenocorti... 82 7e-17
AY891872_1(AY891872|pid:none) Synthetic construct Homo sapiens c... 79 4e-16
AK222509_1(AK222509|pid:none) Homo sapiens mRNA for achalasia, a... 79 4e-16
(Q9NRG9) RecName: Full=Aladin; AltName: Full=Adracalin; &AF2260... 79 4e-16
AK000833_1(AK000833|pid:none) Homo sapiens cDNA FLJ20826 fis, cl... 79 5e-16
BC120418_1(BC120418|pid:none) Bos taurus achalasia, adrenocortic... 80 6e-16
EF147038_1(EF147038|pid:none) Populus trichocarpa clone WS01226_... 76 3e-12
protein update 2009. 4.22
PSORT

psg: 0.74 gvh: 0.38 alm: 0.45 top: 0.53 tms: 0.00 mit: 0.31 mip: 0.00
nuc: 0.00 erl: 0.00 erm: 0.20 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

40.0 %: nuclear
24.0 %: cytoplasmic
20.0 %: cytoskeletal
8.0 %: mitochondrial
4.0 %: extracellular, including cell wall
4.0 %: peroxisomal

>> prediction for AFH742 is nuc

5' end seq. ID AFH742F
5' end seq.
>AFH742F.Seq
TTTTTTTTTAAAAAGATAATTATTATTATTTTTCATAAAATAATAGAAAAATGATTGAAG
AACATAATTGTTTTGAAGAATTTATAAATACAGCAGCAATTGGTGAACAACAAGTTTATG
GTGAATATAAATCTAAATTAGATTCATTTACAGATGAAAGTAAATTACCATATGAATTAT
TATTAGAGAGAAAGAATTTAGTAGAATTGAAAATTTCTGATGAAGAATATAAAAAGAGTG
AATCTGCATAAAAACACCAAATCCAACATTATTACAAAAGTTTCAAATTAATTTTTATCA
AACTATTGAATCGATTAATCAAGTATTTAAACCATCATCATCATCATCAAATCAATCATC
ATCATCGTCCTCCTCGAATGAAGATGATTCATTACAAAATAAAAAGATTAAAGTAATGTC
ATGGCATCCACAACATAGATTACTTGCAGTTTGTAATAAAAATGATGTTATTTATATCTA
CTATTTCCCAAATCAAGATATGTATGGTATGGGTAATGTCAGACCTTTAACATTATGGTT
TGAATTACAATCAAAAGTTTATGATATACAATGGAAACCTTTCTTACCATATACTTTAGC
TGTTG----------
Length of 5' end seq. 605
3' end seq. ID AFH742Z
3' end seq.
>AFH742Z.Seq
----------AATACAATTACATGGTCATCAAATGGTTTACAATTAGCATGTGGTTCAAC
TAATCATAGTTCAATTCTATTATGGGATGTTGTATCTAGAGTACCAACATTCATACCACG
TTATAATGGTAACTCATTATTAGTTTGGTCTCCAAAAAATGATTATCTTTTATCTTGTGG
TGGTAAAACTTGTAGAATTTTCGATATCTCAAAATGGGATTACAATAATAAAGAATGGCC
AATGTTAACAAATTATCAAACAGGATCATGGAATGGAAAAGGTGAATATTTAGCAGTTGC
AAGTGGTGATAGAATTCAGTTTATTCAATGTATAAATAGAGCATTTGAATCAGGTGGTGA
ATTAATGTATGTTGAGAAAACTTCAACCTATAGATTACAAAATGTTGGTGGTAGTGGTGG
TGGTTCAAGTAGTAGTGAATTATTTTTAGGCGGACATATAAAGAAAATTGCATGGTCACC
TGATAGTCAAAGATTGGCTGTCATCTTTTATTTAAATAGCAAGAGTAGAAATAATGATAC
TTATTGTGCAATCTATAAAATTAAAACTTATCCTAAATTTTCTGTAACACCAAGAGGTTT
CATAAGGTCAAAAGATCAATCAATTCAATCAGTTTCTTTTGTCCCAAATTATAAAAAAGG
TTCTTTATTATCAATTGCCTACAATGATGGAACAATTAAATTTTTCCCATTATTATATCA
ATATAAACAATAAGAAAATAAAGATTTTACACTT
Length of 3' end seq. 744
Connected seq. ID AFH742P
Connected seq.
>AFH742P.Seq
TTTTTTTTTAAAAAGATAATTATTATTATTTTTCATAAAATAATAGAAAAATGATTGAAG
AACATAATTGTTTTGAAGAATTTATAAATACAGCAGCAATTGGTGAACAACAAGTTTATG
GTGAATATAAATCTAAATTAGATTCATTTACAGATGAAAGTAAATTACCATATGAATTAT
TATTAGAGAGAAAGAATTTAGTAGAATTGAAAATTTCTGATGAAGAATATAAAAAGAGTG
AATCTGCATAAAAACACCAAATCCAACATTATTACAAAAGTTTCAAATTAATTTTTATCA
AACTATTGAATCGATTAATCAAGTATTTAAACCATCATCATCATCATCAAATCAATCATC
ATCATCGTCCTCCTCGAATGAAGATGATTCATTACAAAATAAAAAGATTAAAGTAATGTC
ATGGCATCCACAACATAGATTACTTGCAGTTTGTAATAAAAATGATGTTATTTATATCTA
CTATTTCCCAAATCAAGATATGTATGGTATGGGTAATGTCAGACCTTTAACATTATGGTT
TGAATTACAATCAAAAGTTTATGATATACAATGGAAACCTTTCTTACCATATACTTTAGC
TGTTG----------AATACAATTACATGGTCATCAAATGGTTTACAATTAGCATGTGGT
TCAACTAATCATAGTTCAATTCTATTATGGGATGTTGTATCTAGAGTACCAACATTCATA
CCACGTTATAATGGTAACTCATTATTAGTTTGGTCTCCAAAAAATGATTATCTTTTATCT
TGTGGTGGTAAAACTTGTAGAATTTTCGATATCTCAAAATGGGATTACAATAATAAAGAA
TGGCCAATGTTAACAAATTATCAAACAGGATCATGGAATGGAAAAGGTGAATATTTAGCA
GTTGCAAGTGGTGATAGAATTCAGTTTATTCAATGTATAAATAGAGCATTTGAATCAGGT
GGTGAATTAATGTATGTTGAGAAAACTTCAACCTATAGATTACAAAATGTTGGTGGTAGT
GGTGGTGGTTCAAGTAGTAGTGAATTATTTTTAGGCGGACATATAAAGAAAATTGCATGG
TCACCTGATAGTCAAAGATTGGCTGTCATCTTTTATTTAAATAGCAAGAGTAGAAATAAT
GATACTTATTGTGCAATCTATAAAATTAAAACTTATCCTAAATTTTCTGTAACACCAAGA
GGTTTCATAAGGTCAAAAGATCAATCAATTCAATCAGTTTCTTTTGTCCCAAATTATAAA
AAAGGTTCTTTATTATCAATTGCCTACAATGATGGAACAATTAAATTTTTCCCATTATTA
TATCAATATAAACAATAAGAAAATAAAGATTTTACACTT
Length of connected seq. 1349
Full length Seq ID -
Full length Seq. -
Length of full length seq. -