| SHH247 | |
| Library | SH (Link to library) |
| Clone ID | SHH247 (Link to dictyBase) |
| Atlas ID | - |
| NBRP ID | - |
| dictyBase ID | - |
| Link to Contig | Contig-U15693-1 |
| Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHH2-B/SHH247Q.Seq.d/ |
| Representative seq. ID | (Link to Original site) |
| Representative DNA sequence | ![]() >SHH247 (SHH247Q) /CSM/SH/SHH2-B/SHH247Q.Seq.d/ |
| sequence update | 2002. 9.10 |
| Translated Amino Acid sequence | ![]() ---NKELEVRFNNALKLSGSELAKEIVSLLDLLKVVTISASVRMNLVETLKEVQALQRKQ |
| Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
| Homology vs CSM-cDNA | ![]()
|
| own update | 2002.12. 6 |
| Homology vs DNA | ![]()
|
| dna update | 2006. 4. 9 |
| Homology vs Protein | ![]()
|
| protein update | 2009. 5.29 |
| PSORT | ![]()
|
| 5' end seq. ID | - |
| 5' end seq. | - |
| Length of 5' end seq. | - |
| 3' end seq. ID | SHH247Z |
| 3' end seq. | ![]() >SHH247Z.Seq |
| Length of 3' end seq. | 601 |
| Connected seq. ID | - |
| Connected seq. | - |
| Length of connected seq. | - |
| Full length Seq ID | - |
| Full length Seq. | - |
| Length of full length seq. | - |