VFC171 | |
Library | VF (Link to library) |
Clone ID | VFC171 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16478-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFC1-C/VFC171Q.Seq.d/ |
Representative seq. ID | VFC171P (Link to Original site) |
Representative DNA sequence | ![]() >VFC171 (VFC171Q) /CSM/VF/VFC1-C/VFC171Q.Seq.d/ |
sequence update | 2001. 6. 1 |
Translated Amino Acid sequence | ![]() CWPTGFINFLQTNTTSIKMSYPPNQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQ |
Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
Homology vs CSM-cDNA | ![]()
|
own update | 2004.12.25 |
Homology vs DNA | ![]()
|
dna update | 2003. 9.11 |
Homology vs Protein | ![]()
|
protein update | 2009. 6.17 |
PSORT | ![]()
|
5' end seq. ID | VFC171F |
5' end seq. | ![]() >VFC171F.Seq |
Length of 5' end seq. | 482 |
3' end seq. ID | VFC171Z |
3' end seq. | ![]() >VFC171Z.Seq |
Length of 3' end seq. | 633 |
Connected seq. ID | VFC171P |
Connected seq. | ![]() >VFC171P.Seq |
Length of connected seq. | 1115 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |